Search Results

Search found 2287 results on 92 pages for 'reads'.

Page 89/92 | < Previous Page | 85 86 87 88 89 90 91 92  | Next Page >

  • Prime Numbers Code Help

    - by andrew
    Hello Everybody, I am suppose to "write a Java program that reads a positive integer n from standard input, then prints out the first n prime number." It's divided into 3 parts. 1st: This function will return true or false according to whether m is prime or composite. The array argument P will contain a sufficient number of primes to do the testing. Specifically, at the time isPrime() is called, array P must contain (at least) all primes p in the range 2 p m . For instance, to test m = 53 for primality, one must do successive trial divisions by 2, 3, 5, and 7. We go no further since 11 53 . Thus a precondition for the function call isPrime(53, P) is that P[0] = 2 , P[1] = 3 , P[2] = 5, and P[3] = 7 . The return value in this case would be true since all these divisions fail. Similarly to test m =143 , one must do trial divisions by 2, 3, 5, 7, and 11 (since 13 143 ). The precondition for the function call isPrime(143, P) is therefore P[0] = 2 , P[1] = 3 , P[2] = 5, P[3] = 7 , and P[4] =11. The return value in this case would be false since 11 divides 143. Function isPrime() should contain a loop that steps through array P, doing trial divisions. This loop should terminate when 2 either a trial division succeeds, in which case false is returned, or until the next prime in P is greater than m , in which case true is returned. Then there is the "main function" • Check that the user supplied exactly one command line argument which can be interpreted as a positive integer n. If the command line argument is not a single positive integer, your program will print a usage message as specified in the examples below, then exit. • Allocate array Primes[] of length n and initialize Primes[0] = 2 . • Enter a loop which will discover subsequent primes and store them as Primes[1] , Primes[2], Primes[3] , ……, Primes[n -1] . This loop should contain an inner loop which walks through successive integers and tests them for primality by calling function isPrime() with appropriate arguments. • Print the contents of array Primes[] to stdout, 10 to a line separated by single spaces. In other words Primes[0] through Primes[9] will go on line 1, Primes[10] though Primes[19] will go on line 2, and so on. Note that if n is not a multiple of 10, then the last line of output will contain fewer than 10 primes. The last function is called "usage" which I am not sure how to execute this! Your program will include a function called Usage() having signature static void Usage() that prints this message to stderr, then exits. Thus your program will contain three functions in all: main(), isPrime(), and Usage(). Each should be preceded by a comment block giving it’s name, a short description of it’s operation, and any necessary preconditions (such as those for isPrime().) And hear is my code, but I am having a bit of a problem and could you guys help me fix it? If I enter the number "5" it gives me the prime numbers which are "6,7,8,9" which doesn't make much sense. import java.util.; import java.io.; import java.lang.*; public class PrimeNumber { static boolean isPrime(int m, int[] P){ int squarert = Math.round( (float)Math.sqrt(m) ); int i = 2; boolean ans=false; while ((i<=squarert) & (ans==false)) { int c= P[i]; if (m%c==0) ans= true; else ans= false; i++; } /* if(ans ==true) ans=false; else ans=true; return ans; } ///****main public static void main(String[] args ) { Scanner in= new Scanner(System.in); int input= in.nextInt(); int i, j; int squarert; boolean ans = false; int userNum; int remander = 0; System.out.println("input: " + input); int[] prime = new int[input]; prime[0]= 2; for(i=1; i ans = isPrime(j,prime); j++;} prime[i] = j; } //prnt prime System.out.println("The first " + input + " prime number(s) are: "); for(int r=0; r }//end of main } Thanks for the help

    Read the article

  • IIS7 + WCF + Silverlight problems

    - by Eanna
    Hey, I've been building a silverlight application and a WCF service for a while now and recently tried to host them in IIS7. I installed IIS7 on Windows Server 2008 R2 and added these two application to my default website. I am having a number of problems so im hoping one of you can help out... 1) The silverlight and WCF service applications do not work with pass-through authentication. I need to "connect as" the administrator server account when setting up the application. I read online that you should only need to use the "connect as" field when you are connecting to another computer. If i dont supply the admin credentials i get this error. Do i have to set up permissions somewhere else? HTTP Error 500.19 - Internal Server Error The requested page cannot be accessed because the related configuration data for the page is invalid. Detailed Error Information Module IIS Web Core Notification BeginRequest Handler Not yet determined Error Code 0x80070005 Config Error Cannot read configuration file due to insufficient permissions Config File \?\C:\Users\Administrator\Documents\My Dropbox\Research Masters\Project\WCFService\Website\web.config Requested URL http:://localhost:80/WCFService/Service.svc Physical Path C:\Users\Administrator\Documents\My Dropbox\Research Masters\Project\WCFService\Website\Service.svc Logon Method Not yet determined Logon User Not yet determined Config Source -1: 0: Links and More Information This error occurs when there is a problem reading the configuration file for the Web server or Web application. In some cases, the event logs may contain more information about what caused this error. 2) Visual studio generated 2 webpages to run my silverlight application (.html and .aspx). When I am running the silverlight application (connected as admin) I can navigate to the .html page, no problem. When I try to open the .aspx file i get the following error Server Error in '/Platform' Application. Access is denied. Description: An error occurred while accessing the resources required to serve this request. You might not have permission to view the requested resources. Error message 401.3: You do not have permission to view this directory or page using the credentials you supplied (access denied due to Access Control Lists). Ask the Web server's administrator to give you access to 'C:\Users\Administrator\Documents\My Dropbox\Research Masters\Project\Platform\Website\PlatformTestPage.aspx'. Version Information: Microsoft .NET Framework Version:4.0.30128; ASP.NET Version:4.0.30128.1 3) The WCF service runs fine (again, connected as admin) until i restart the server. When i try to run the WCF service after a reboot, the mysql assembly seems to be missing from the solution. If i just rebuilt the solution and run the service again... it works (until next restart). Whats causing this error? Solution here - http://tinypic.com/view.php?pic=5yasqx&s=5 Server Error in '/WCFService' Application. Could not load file or assembly 'MySql.Data, Version=6.2.2.0, Culture=neutral, PublicKeyToken=c5687fc88969c44d' or one of its dependencies. Access is denied. Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.IO.FileLoadException: Could not load file or assembly 'MySql.Data, Version=6.2.2.0, Culture=neutral, PublicKeyToken=c5687fc88969c44d' or one of its dependencies. Access is denied. Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Assembly Load Trace: The following information can be helpful to determine why the assembly 'MySql.Data, Version=6.2.2.0, Culture=neutral, PublicKeyToken=c5687fc88969c44d' could not be loaded. WRN: Assembly binding logging is turned OFF. To enable assembly bind failure logging, set the registry value [HKLM\Software\Microsoft\Fusion!EnableLog] (DWORD) to 1. Note: There is some performance penalty associated with assembly bind failure logging. To turn this feature off, remove the registry value [HKLM\Software\Microsoft\Fusion!EnableLog]. Stack Trace: [FileLoadException: Could not load file or assembly 'MySql.Data, Version=6.2.2.0, Culture=neutral, PublicKeyToken=c5687fc88969c44d' or one of its dependencies. Access is denied.] System.Reflection.RuntimeAssembly._nLoad(AssemblyName fileName, String codeBase, Evidence assemblySecurity, RuntimeAssembly locationHint, StackCrawlMark& stackMark, Boolean throwOnFileNotFound, Boolean forIntrospection, Boolean suppressSecurityChecks) +0 System.Reflection.RuntimeAssembly.InternalLoadAssemblyName(AssemblyName assemblyRef, Evidence assemblySecurity, StackCrawlMark& stackMark, Boolean forIntrospection, Boolean suppressSecurityChecks) +567 System.Reflection.RuntimeAssembly.InternalLoad(String assemblyString, Evidence assemblySecurity, StackCrawlMark& stackMark, Boolean forIntrospection) +192 System.Reflection.Assembly.Load(String assemblyString) +35 System.ServiceModel.Activation.ServiceHostFactory.CreateServiceHost(String constructorString, Uri[] baseAddresses) +243 System.ServiceModel.HostingManager.CreateService(String normalizedVirtualPath) +1423 System.ServiceModel.HostingManager.ActivateService(String normalizedVirtualPath) +50 System.ServiceModel.HostingManager.EnsureServiceAvailable(String normalizedVirtualPath) +1132 [ServiceActivationException: The service '/WCFService/Service.svc' cannot be activated due to an exception during compilation. The exception message is: Could not load file or assembly 'MySql.Data, Version=6.2.2.0, Culture=neutral, PublicKeyToken=c5687fc88969c44d' or one of its dependencies. Access is denied..] System.Runtime.AsyncResult.End(IAsyncResult result) +889824 System.ServiceModel.Activation.HostedHttpRequestAsyncResult.End(IAsyncResult result) +179150 System.Web.AsyncEventExecutionStep.OnAsyncEventCompletion(IAsyncResult ar) +107 Version Information: Microsoft .NET Framework Version:4.0.30128; ASP.NET Version:4.0.30128.1 Thats about it, hope someone reads this message, I wasted most of the weekend trying to fix these problems on my own... thanks

    Read the article

  • NSOutlineView not refreshing when objects added to managed object context from NSOperations

    - by John Gallagher
    Background Cocoa app using core data Two processes - daemon and a main UI Daemon constantly writing to a data store UI process reads from same data store NSOutlineView in UI is bound to an NSTreeController which is bound to Application with key path of delegate.interpretedMOC What I want When the UI is activated, the outline view should update with the latest data inserted by the daemon. The Problem Main Thread Approach I fetch all the entities I'm interested in, then iterate over them, doing refreshObject:mergeChanges:YES. This works OK - the items get refreshed correctly. However, this is all running on the main thread, so the UI locks up for 10-20 seconds whilst it refreshes. Fine, so let's move these refreshes to NSOperations that run in the background instead. NSOperation Multithreaded Approach As soon as I move the refreshObject:mergeChanges: call into an NSOperation, the refresh no longer works. When I add logging messages, it's clear that the new objects are loaded in by the NSOperation subclass and refreshed. Not only that, but they are What I've tried I've messed around with this for 2 days solid and tried everything I can think of. Passing objectIDs to the NSOperation to refresh instead of an entity name. Resetting the interpretedMOC at various points - after the data refresh and before the outline view reload. I'd subclassed NSOutlineView. I discarded my subclass and set the view back to being an instance of NSOutlineView, just in case there was any funny goings on here. Added a rearrangeObjects call to the NSTreeController before reloading the NSOutlineView data. Made sure I had set the staleness interval to 0 on all managed object contexts I was using. I've got a feeling this problem is somehow related to caching core data objects in memory. But I've totally exhausted all my ideas on how I get this to work. I'd be eternally grateful of any ideas anyone else has. Code Main Thread Approach // In App Delegate -(void)applicationDidBecomeActive:(NSNotification *)notification { // Delay to allow time for the daemon to save [self performSelector:@selector(refreshTrainingEntriesAndGroups) withObject:nil afterDelay:3]; } -(void)refreshTrainingEntriesAndGroups { NSSet *allTrainingGroups = [[[NSApp delegate] interpretedMOC] fetchAllObjectsForEntityName:kTrainingGroup]; for(JGTrainingGroup *thisTrainingGroup in allTrainingGroups) [interpretedMOC refreshObject:thisTrainingGroup mergeChanges:YES]; NSError *saveError = nil; [interpretedMOC save:&saveError]; [windowController performSelectorOnMainThread:@selector(refreshTrainingView) withObject:nil waitUntilDone:YES]; } // In window controller class -(void)refreshTrainingView { [trainingViewTreeController rearrangeObjects]; // Didn't really expect this to have any effect. And it didn't. [trainingView reloadData]; } NSOperation Multithreaded Approach // In App Delegate -(void)refreshTrainingEntriesAndGroups { JGRefreshEntityOperation *trainingGroupRefresh = [[JGRefreshEntityOperation alloc] initWithEntityName:kTrainingGroup]; NSOperationQueue *refreshQueue = [[NSOperationQueue alloc] init]; [refreshQueue setMaxConcurrentOperationCount:1]; [refreshQueue addOperation:trainingGroupRefresh]; while ([[refreshQueue operations] count] > 0) { [[NSRunLoop currentRunLoop] runUntilDate:[NSDate dateWithTimeIntervalSinceNow:0.05]]; [windowController performSelectorOnMainThread:@selector(refreshTrainingView) withObject:nil waitUntilDone:YES]; } // JGRefreshEntityOperation.m @implementation JGRefreshEntityOperation @synthesize started; @synthesize executing; @synthesize paused; @synthesize finished; -(void)main { [self startOperation]; NSSet *allEntities = [imoc fetchAllObjectsForEntityName:entityName]; for(id thisEntity in allEntities) [imoc refreshObject:thisEntity mergeChanges:YES]; [self finishOperation]; } -(void)startOperation { [self willChangeValueForKey:@"isExecuting"]; [self willChangeValueForKey:@"isStarted"]; [self setStarted:YES]; [self setExecuting:YES]; [self didChangeValueForKey:@"isExecuting"]; [self didChangeValueForKey:@"isStarted"]; imoc = [[NSManagedObjectContext alloc] init]; [imoc setStalenessInterval:0]; [imoc setUndoManager:nil]; [imoc setPersistentStoreCoordinator:[[NSApp delegate] interpretedPSC]]; [[NSNotificationCenter defaultCenter] addObserver:self selector:@selector(mergeChanges:) name:NSManagedObjectContextDidSaveNotification object:imoc]; } -(void)finishOperation { saveError = nil; [imoc save:&saveError]; if (saveError) { NSLog(@"Error saving. %@", saveError); } imoc = nil; [self willChangeValueForKey:@"isExecuting"]; [self willChangeValueForKey:@"isFinished"]; [self setExecuting:NO]; [self setFinished:YES]; [self didChangeValueForKey:@"isExecuting"]; [self didChangeValueForKey:@"isFinished"]; } -(void)mergeChanges:(NSNotification *)notification { NSManagedObjectContext *mainContext = [[NSApp delegate] interpretedMOC]; [mainContext performSelectorOnMainThread:@selector(mergeChangesFromContextDidSaveNotification:) withObject:notification waitUntilDone:YES]; } -(id)initWithEntityName:(NSString *)entityName_ { [super init]; [self setStarted:false]; [self setExecuting:false]; [self setPaused:false]; [self setFinished:false]; [NSThread setThreadPriority:0.0]; entityName = entityName_; return self; } @end // JGRefreshEntityOperation.h @interface JGRefreshEntityOperation : NSOperation { NSString *entityName; NSManagedObjectContext *imoc; NSError *saveError; BOOL started; BOOL executing; BOOL paused; BOOL finished; } @property(readwrite, getter=isStarted) BOOL started; @property(readwrite, getter=isPaused) BOOL paused; @property(readwrite, getter=isExecuting) BOOL executing; @property(readwrite, getter=isFinished) BOOL finished; -(void)startOperation; -(void)finishOperation; -(id)initWithEntityName:(NSString *)entityName_; -(void)mergeChanges:(NSNotification *)notification; @end

    Read the article

  • Prim's MST algorithm implementation with Java

    - by user1290164
    I'm trying to write a program that'll find the MST of a given undirected weighted graph with Kruskal's and Prim's algorithms. I've successfully implemented Kruskal's algorithm in the program, but I'm having trouble with Prim's. To be more precise, I can't figure out how to actually build the Prim function so that it'll iterate through all the vertices in the graph. I'm getting some IndexOutOfBoundsException errors during program execution. I'm not sure how much information is needed for others to get the idea of what I have done so far, but hopefully there won't be too much useless information. This is what I have so far: I have a Graph, Edge and a Vertex class. Vertex class mostly just an information storage that contains the name (number) of the vertex. Edge class can create a new Edge that has gets parameters (Vertex start, Vertex end, int edgeWeight). The class has methods to return the usual info like start vertex, end vertex and the weight. Graph class reads data from a text file and adds new Edges to an ArrayList. The text file also tells us how many vertecis the graph has, and that gets stored too. In the Graph class, I have a Prim() -method that's supposed to calculate the MST: public ArrayList<Edge> Prim(Graph G) { ArrayList<Edge> edges = G.graph; // Copies the ArrayList with all edges in it. ArrayList<Edge> MST = new ArrayList<Edge>(); Random rnd = new Random(); Vertex startingVertex = edges.get(rnd.nextInt(G.returnVertexCount())).returnStartingVertex(); // This is just to randomize the starting vertex. // This is supposed to be the main loop to find the MST, but this is probably horribly wrong.. while (MST.size() < returnVertexCount()) { Edge e = findClosestNeighbour(startingVertex); MST.add(e); visited.add(e.returnStartingVertex()); visited.add(e.returnEndingVertex()); edges.remove(e); } return MST; } The method findClosesNeighbour() looks like this: public Edge findClosestNeighbour(Vertex v) { ArrayList<Edge> neighbours = new ArrayList<Edge>(); ArrayList<Edge> edges = graph; for (int i = 0; i < edges.size() -1; ++i) { if (edges.get(i).endPoint() == s.returnVertexID() && !visited(edges.get(i).returnEndingVertex())) { neighbours.add(edges.get(i)); } } return neighbours.get(0); // This is the minimum weight edge in the list. } ArrayList<Vertex> visited and ArrayList<Edges> graph get constructed when creating a new graph. Visited() -method is simply a boolean check to see if ArrayList visited contains the Vertex we're thinking about moving to. I tested the findClosestNeighbour() independantly and it seemed to be working but if someone finds something wrong with it then that feedback is welcome also. Mainly though as I mentioned my problem is with actually building the main loop in the Prim() -method, and if there's any additional info needed I'm happy to provide it. Thank you. Edit: To clarify what my train of thought with the Prim() method is. What I want to do is first randomize the starting point in the graph. After that, I will find the closest neighbor to that starting point. Then we'll add the edge connecting those two points to the MST, and also add the vertices to the visited list for checking later, so that we won't form any loops in the graph. Here's the error that gets thrown: Exception in thread "main" java.lang.IndexOutOfBoundsException: Index: 0, Size: 0 at java.util.ArrayList.rangeCheck(Unknown Source) at java.util.ArrayList.get(Unknown Source) at Graph.findClosestNeighbour(graph.java:203) at Graph.Prim(graph.java:179) at MST.main(MST.java:49) Line 203: return neighbour.get(0); in findClosestNeighbour() Line 179: Edge e = findClosestNeighbour(startingVertex); in Prim()

    Read the article

  • Help required in adding new methods, properties into existing classes dynamically

    - by Bepenfriends
    Hi All, I am not sure whether it is possible to achieve this kind of implementation in Dot Net. Below are the information Currently we are on an application which is done in COM+, ASP, XSL, XML technologies. It is a multi tier architecture application in which COM+ acts as the BAL. The execution steps for any CRUD operation will be defined using a seperate UI which uses XML to store the information. BAL reads the XML and understands the execution steps which are defined and executes corresponding methods in DLL. Much like EDM we have our custom model (using XML) which determines which property of object is searchable, retrievable etc. Based on this information BAL constructs queries and calls procedures to get the data. In the current application both BAL and DAL are heavily customizable without doing any code change. the results will be transmitted to presentation layer in XML format which constructs the UI based on the data recieved. Now I am creating a migration project which deals with employee information. It is also going to follow the N Tier architecture in which the presentation layer communicates with BAL which connects to DAL to return the Data. Here is the problem, In our existing version we are handling every information as XML in its native form (no converstion of object etc), but in the migration project, Team is really interested in utilizing the OOP model of development where every information which is sent from BAL need to be converted to objects of its respective types (example employeeCollection, Address Collection etc). If we have the static number of data returned from BAL we can have a class which contains those nodes as properties and we can access the same. But in our case the data returned from our BAL need to be customized. How can we handle the customization in presentation layer which is converting the result to an Object. Below is an example of the XML returned <employees> <employee> <firstName>Employee 1 First Name</firstName> <lastName>Employee 1 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>3</addressType> <StreetName>Street name3</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> <employee> <firstName>Employee 2 First Name</firstName> <lastName>Employee 2 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> </employees> If these are the only columns then i can write a class which is like public class Address{ public int AddressType {get;set;}; public string StreetName {get;set;}; public string RegionName {get;set;}; } public class Employee{ public string FirstName {get; set;} public string LastName {get; set;} public string AddressCollection {get; set;} } public class EmployeeCollection : List<Employee>{ public bool Add (Employee Data){ .... } } public class AddressCollection : List<Address>{ public bool Add (Address Data){ .... } } This class will be provided to customers and consultants as DLLs. We will not provide the source code for the same. Now when the consultants or customers does customization(example adding country to address and adding passport information object with employee object) they must be able to access those properties in these classes, but without source code they will not be able to do those modifications.which makes the application useless. Is there is any way to acomplish this in DotNet. I thought of using Anonymous classes but, the problem with Anonymous classes are we can not have methods in it. I am not sure how can i fit the collection objects (which will be inturn an anonymous class) Not sure about datagrid / user control binding etc. I also thought of using CODEDom to create classes runtime but not sure about the meory, performance issues. also the classes must be created only once and must use the same till there is another change. Kindly help me out in this problem. Any kind of help meterial/ cryptic code/ links will be helpful.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Help needed on an SQL configuration problem.

    - by user321048
    I have been banging my head with this one more the two weeks, and still don't know what the problem is ( I can't narrow it down). The problem is the following. I have a solution with 3 project in it all written in c# and I with LINQ. One project is the main web site, the other is the data layer (communication with the database) and the third one is a custom little CMS. The problem is the following: On a hosting provider when I publish the site it all works perfectly, but this site was needed to be hosted on the client server so I needed to do that. But the problem is that I also needed to configure the client server, because they don't have an Administrator employed (I know, I know ;) ). For the first time I some how managed, to set it up but a problem appear. My main web site is working just as it suppose to be - it reads (communicates with) the database, but My CMS is not. It shows the first log in page, but after that when I try to log in it throws the following error: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Data.SqlClient.SqlException: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [SqlException (0x80131904): A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.)] System.Data.SqlClient.SqlInternalConnection.OnError(SqlException exception, Boolean breakConnection) +4846887 System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning(TdsParserStateObject stateObj) +194 System.Data.SqlClient.TdsParser.Connect(ServerInfo serverInfo, SqlInternalConnectionTds connHandler, Boolean ignoreSniOpenTimeout, Int64 timerExpire, Boolean encrypt, Boolean trustServerCert, Boolean integratedSecurity, SqlConnection owningObject) +4860189 System.Data.SqlClient.SqlInternalConnectionTds.AttemptOneLogin(ServerInfo serverInfo, String newPassword, Boolean ignoreSniOpenTimeout, Int64 timerExpire, SqlConnection owningObject) +90 System.Data.SqlClient.SqlInternalConnectionTds.LoginNoFailover(String host, String newPassword, Boolean redirectedUserInstance, SqlConnection owningObject, SqlConnectionString connectionOptions, Int64 timerStart) +342 System.Data.SqlClient.SqlInternalConnectionTds.OpenLoginEnlist(SqlConnection owningObject, SqlConnectionString connectionOptions, String newPassword, Boolean redirectedUserInstance) +221 System.Data.SqlClient.SqlInternalConnectionTds..ctor(DbConnectionPoolIdentity identity, SqlConnectionString connectionOptions, Object providerInfo, String newPassword, SqlConnection owningObject, Boolean redirectedUserInstance) +189 System.Data.SqlClient.SqlConnectionFactory.CreateConnection(DbConnectionOptions options, Object poolGroupProviderInfo, DbConnectionPool pool, DbConnection owningConnection) +185 System.Data.ProviderBase.DbConnectionFactory.CreatePooledConnection(DbConnection owningConnection, DbConnectionPool pool, DbConnectionOptions options) +31 System.Data.ProviderBase.DbConnectionPool.CreateObject(DbConnection owningObject) +433 System.Data.ProviderBase.DbConnectionPool.UserCreateRequest(DbConnection owningObject) +66 System.Data.ProviderBase.DbConnectionPool.GetConnection(DbConnection owningObject) +499 System.Data.ProviderBase.DbConnectionFactory.GetConnection(DbConnection owningConnection) +65 System.Data.ProviderBase.DbConnectionClosed.OpenConnection(DbConnection outerConnection, DbConnectionFactory connectionFactory) +117 System.Data.SqlClient.SqlConnection.Open() +122 System.Data.Linq.SqlClient.SqlConnectionManager.UseConnection(IConnectionUser user) +44 System.Data.Linq.SqlClient.SqlProvider.get_IsSqlCe() +45 System.Data.Linq.SqlClient.SqlProvider.InitializeProviderMode() +20 System.Data.Linq.SqlClient.SqlProvider.System.Data.Linq.Provider.IProvider.Execute(Expression query) +57 System.Data.Linq.DataQuery`1.System.Linq.IQueryProvider.Execute(Expression expression) +23 System.Linq.Queryable.Count(IQueryable`1 source) +240 CMS.Security.UserProfile.LoginUser() in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Classes\UserProfile.cs:132 CMS.Default.Login1_Authenticate(Object sender, AuthenticateEventArgs e) in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Default.aspx.cs:37 System.Web.UI.WebControls.Login.OnAuthenticate(AuthenticateEventArgs e) +108 System.Web.UI.WebControls.Login.AttemptLogin() +115 System.Web.UI.WebControls.Login.OnBubbleEvent(Object source, EventArgs e) +101 System.Web.UI.Control.RaiseBubbleEvent(Object source, EventArgs args) +37 System.Web.UI.WebControls.Button.OnCommand(CommandEventArgs e) +118 System.Web.UI.WebControls.Button.RaisePostBackEvent(String eventArgument) +166 System.Web.UI.WebControls.Button.System.Web.UI.IPostBackEventHandler.RaisePostBackEvent(String eventArgument) +10 System.Web.UI.Page.RaisePostBackEvent(IPostBackEventHandler sourceControl, String eventArgument) +13 System.Web.UI.Page.RaisePostBackEvent(NameValueCollection postData) +36 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +1565 Maybe this is a dumb question, but I cannot find the root of the problem, let alone the solution. So far I have tried the following: -setting time out on connection string to a higher value -configuration and after that turning off server firewall -checking the connection string over and over again (they are the same for all three projects and are saved in web.config) Important notes: I have tried executing the project from VS2008 with a connection string to the same database and the results are the same. That's why I think the problem is the SQL Server 2005 and not the IIS7. Any bit of information is more then welcomed.

    Read the article

  • Pass string between two threads in java

    - by geeta
    I have to search a string in a file and write the matched lines to another file. I have a thread to read a file and a thread to write a file. I want to send the stringBuffer from read thread to write thread. Please help me to pass this. I amm getting null value passed. write thread: class OutputThread extends Thread{ /****************** Writes the line with search string to the output file *************/ Thread runner1,runner; File Out_File; public OutputThread() { } public OutputThread(Thread runner,File Out_File) { runner1 = new Thread(this,"writeThread"); // (1) Create a new thread. this.Out_File=Out_File; this.runner=runner; runner1.start(); // (2) Start the thread. } public void run() { try{ BufferedWriter bufferedWriter=new BufferedWriter(new FileWriter(Out_File,true)); System.out.println("inside write"); synchronized(runner){ System.out.println("inside wait"); runner.wait(); } System.out.println("outside wait"); // bufferedWriter.write(line.toString()); Buffer Buf = new Buffer(); bufferedWriter.write(Buf.buffers); System.out.println(Buf.buffers); bufferedWriter.flush(); } catch(Exception e){ System.out.println(e); e.printStackTrace(); } } } Read Thraed: class FileThread extends Thread{ Thread runner; File dir; String search_string,stats; File Out_File,final_output; StringBuffer sb = new StringBuffer(); public FileThread() { } public FileThread(CountDownLatch latch,String threadName,File dir,String search_string,File Out_File,File final_output,String stats) { runner = new Thread(this, threadName); // (1) Create a new thread. this.dir=dir; this.search_string=search_string; this.Out_File=Out_File; this.stats=stats; this.final_output=final_output; this.latch=latch; runner.start(); // (2) Start the thread. } public void run() { try{ Enumeration entries; ZipFile zipFile; String source_file_name = dir.toString(); File Source_file = dir; String extension; OutputThread out = new OutputThread(runner,Out_File); int dotPos = source_file_name.lastIndexOf("."); extension = source_file_name.substring(dotPos+1); if(extension.equals("zip")) { zipFile = new ZipFile(source_file_name); entries = zipFile.entries(); while(entries.hasMoreElements()) { ZipEntry entry = (ZipEntry)entries.nextElement(); if(entry.isDirectory()) { (new File(entry.getName())).mkdir(); continue; } searchString(runner,entry.getName(),new BufferedInputStream(zipFile.getInputStream(entry)),Out_File,final_output,search_string,stats); } zipFile.close(); } else { searchString(runner,Source_file.toString(),new BufferedInputStream(new FileInputStream(Source_file)),Out_File,final_output,search_string,stats); } } catch(Exception e){ System.out.println(e); e.printStackTrace(); } } /********* Reads the Input Files and Searches for the String ******************************/ public void searchString(Thread runner,String Source_File,BufferedInputStream in,File output_file,File final_output,String search,String stats) { int count = 0; int countw = 0; int countl=0; String s; String[] str; String newLine = System.getProperty("line.separator"); try { BufferedReader br2 = new BufferedReader(new InputStreamReader(in)); //OutputFile outfile = new OutputFile(); BufferedWriter bufferedWriter = new BufferedWriter(new FileWriter(output_file,true)); Buffer Buf = new Buffer(); //StringBuffer sb = new StringBuffer(); StringBuffer sb1 = new StringBuffer(); while((s = br2.readLine()) != null ) { str = s.split(search); count = str.length-1; countw += count; if(s.contains(search)){ countl++; sb.append(s); sb.append(newLine); } if(countl%100==0) { System.out.println("inside count"); Buf.setBuffers(sb.toString()); sb.delete(0,sb.length()); System.out.println("outside notify"); synchronized(runner) { runner.notify(); } //outfile.WriteFile(sb,bufferedWriter); //sb.delete(0,sb.length()); } } } synchronized(runner) { runner.notify(); } br2.close(); in.close(); if(countw == 0) { System.out.println("Input File : "+Source_File ); System.out.println("Word not found"); System.exit(0); } else { System.out.println("Input File : "+Source_File ); System.out.println("Matched word count : "+countw ); System.out.println("Lines with Search String : "+countl); System.out.println("Output File : "+output_file.toString()); System.out.println(); } } catch(Exception e){ System.out.println(e); e.printStackTrace(); } } }

    Read the article

  • Database file is inexplicably locked during SQLite commit

    - by sweeney
    Hello, I'm performing a large number of INSERTS to a SQLite database. I'm using just one thread. I batch the writes to improve performance and have a bit of security in case of a crash. Basically I cache up a bunch of data in memory and then when I deem appropriate, I loop over all of that data and perform the INSERTS. The code for this is shown below: public void Commit() { using (SQLiteConnection conn = new SQLiteConnection(this.connString)) { conn.Open(); using (SQLiteTransaction trans = conn.BeginTransaction()) { using (SQLiteCommand command = conn.CreateCommand()) { command.CommandText = "INSERT OR IGNORE INTO [MY_TABLE] (col1, col2) VALUES (?,?)"; command.Parameters.Add(this.col1Param); command.Parameters.Add(this.col2Param); foreach (Data o in this.dataTemp) { this.col1Param.Value = o.Col1Prop; this. col2Param.Value = o.Col2Prop; command.ExecuteNonQuery(); } } this.TryHandleCommit(trans); } conn.Close(); } } I now employ the following gimmick to get the thing to eventually work: private void TryHandleCommit(SQLiteTransaction trans) { try { trans.Commit(); } catch (Exception e) { Console.WriteLine("Trying again..."); this.TryHandleCommit(trans); } } I create my DB like so: public DataBase(String path) { //build connection string SQLiteConnectionStringBuilder connString = new SQLiteConnectionStringBuilder(); connString.DataSource = path; connString.Version = 3; connString.DefaultTimeout = 5; connString.JournalMode = SQLiteJournalModeEnum.Persist; connString.UseUTF16Encoding = true; using (connection = new SQLiteConnection(connString.ToString())) { //check for existence of db FileInfo f = new FileInfo(path); if (!f.Exists) //build new blank db { SQLiteConnection.CreateFile(path); connection.Open(); using (SQLiteTransaction trans = connection.BeginTransaction()) { using (SQLiteCommand command = connection.CreateCommand()) { command.CommandText = DataBase.CREATE_MATCHES; command.ExecuteNonQuery(); command.CommandText = DataBase.CREATE_STRING_DATA; command.ExecuteNonQuery(); //TODO add logging } trans.Commit(); } connection.Close(); } } } I then export the connection string and use it to obtain new connections in different parts of the program. At seemingly random intervals, though at far too great a rate to ignore or otherwise workaround this problem, I get unhandled SQLiteException: Database file is locked. This occurs when I attempt to commit the transaction. No errors seem to occur prior to then. This does not always happen. Sometimes the whole thing runs without a hitch. No reads are being performed on these files before the commits finish. I have the very latest SQLite binary. I'm compiling for .NET 2.0. I'm using VS 2008. The db is a local file. All of this activity is encapsulated within one thread / process. Virus protection is off (though I think that was only relevant if you were connecting over a network?). As per Scotsman's post I have implemented the following changes: Journal Mode set to Persist DB files stored in C:\Docs + Settings\ApplicationData via System.Windows.Forms.Application.AppData windows call No inner exception Witnessed on two distinct machines (albeit very similar hardware and software) Have been running Process Monitor - no extraneous processes are attaching themselves to the DB files - the problem is definitely in my code... Does anyone have any idea whats going on here? I know I just dropped a whole mess of code, but I've been trying to figure this out for way too long. My thanks to anyone who makes it to the end of this question! brian UPDATES: Thanks for the suggestions so far! I've implemented many of the suggested changes. I feel that we are getting closer to the answer...however... The code above technically works however it is non-deterministic! It is not guaranteed to do anything aside from spin in neutral forever. In practice it seems to work somewhere between the 1st and 10th iteration. If i batch my commits at a reasonable interval damage will be mitigated but I really do not want to leave things in this state... More suggestions welcome!

    Read the article

  • I asked this yesterday, after the input given I'm still having trouble implementing..

    - by Josh
    I'm not sure how to fix this or what I did wrong, but whenever I enter in a value it just closes out the run prompt. So, seems I do have a problem somewhere in my coding. Whenever I run the program and input a variable, it always returns the same answer.."The content at location 76 is 0." On that note, someone told me that "I don't know, but I suspect that Program A incorrectly has a fixed address being branched to on instructions 10 and 11." - mctylr but I'm not sure how to fix that.. I'm trying to figure out how to incorporate this idea from R Samuel Klatchko.. I'm still not sure what I'm missing but I can't get it to work.. const int OP_LOAD = 3; const int OP_STORE = 4; const int OP_ADD = 5; ... const int OP_LOCATION_MULTIPLIER = 100; mem[0] = OP_LOAD * OP_LOCATION_MULTIPLIER + ...; mem[1] = OP_ADD * OP_LOCATION_MULTIPLIER + ...; operand = memory[ j ] % OP_LOCATION_MULTIPLIER; operation = memory[ j ] / OP_LOCATION_MULTIPLIER; I'm new to programming, I'm not the best, so I'm going for simplicity. Also this is an SML program. Anyway, this IS a homework assignment and I'm wanting a good grade on this. So I was looking for input and making sure this program will do what I'm hoping they are looking for. Anyway, here are the instructions: Write SML (Simpletron Machine language) programs to accomplish each of the following task: A) Use a sentinel-controlled loop to read positive number s and compute and print their sum. Terminate input when a neg number is entered. B) Use a counter-controlled loop to read seven numbers, some positive and some negative, and compute + print the avg. C) Read a series of numbers, and determine and print the largest number. The first number read indicates how many numbers should be processed. Without further a due, here is my program. All together. int main() { const int READ = 10; const int WRITE = 11; const int LOAD = 20; const int STORE = 21; const int ADD = 30; const int SUBTRACT = 31; const int DIVIDE = 32; const int MULTIPLY = 33; const int BRANCH = 40; const int BRANCHNEG = 41; const int BRANCHZERO = 41; const int HALT = 43; int mem[100] = {0}; //Making it 100, since simpletron contains a 100 word mem. int operation; //taking the rest of these variables straight out of the book seeing as how they were italisized. int operand; int accum = 0; // the special register is starting at 0 int j; // This is for part a, it will take in positive variables in a sent-controlled loop and compute + print their sum. Variables from example in text. memory [0] = 1010; memory [01] = 2009; memory [02] = 3008; memory [03] = 2109; memory [04] = 1109; memory [05] = 4300; memory [06] = 1009; j = 0; //Makes the variable j start at 0. while ( true ) { operand = memory[ j ]%100; // Finds the op codes from the limit on the memory (100) operation = memory[ j ]/100; //using a switch loop to set up the loops for the cases switch ( operation ){ case 10: //reads a variable into a word from loc. Enter in -1 to exit cout <<"\n Input a positive variable: "; cin >> memory[ operand ]; break; case 11: // takes a word from location cout << "\n\nThe content at location " << operand << "is " << memory[operand]; break; case 20:// loads accum = memory[ operand ]; break; case 21: //stores memory[ operand ] = accum; break; case 30: //adds accum += mem[operand]; break; case 31: // subtracts accum-= memory[ operand ]; break; case 32: //divides accum /=(memory[ operand ]); break; case 33: // multiplies accum*= memory [ operand ]; break; case 40: // Branches to location j = -1; break; case 41: //branches if acc. is < 0 if (accum < 0) j = 5; break; case 42: //branches if acc = 0 if (accum == 0) j = 5; break; case 43: // Program ends exit(0); break; } j++; } return 0; }

    Read the article

  • PHP: How to automate building a 100 <UL>/<LI> menuitems, while keeping the Menu Structure File Flat / Simply Managable?

    - by Sam
    Above: current "stupid" menu. (entire ul/li menu for javascript menu system) + (some li lines as page-specific submenu) Hi folks! With passion for automation and elegancy, but limited knowledge/knowhow, im stuck with "my hands in my hair" as we Dutch say, for my current menu system works perfectly, but is a pain in the a*s to update! So, i would appreciate it greatly, if you can suggest how to automate this in php: how to let the php generate the html menu code basing on a flat menu input file with TABS indented. OLD SITUATION <ul> <!-- about 100 of these <li>....</li> lines --> <li><a href="carrot.php"><p class="mnu" style="background-position:0 -820px"><? echo __("carrot juice") ?></p></a></li> <!-- lots of data, with only little bit thats really the menu itself--> </ul a javascript file reads a ul/li structure as input to build menu of format in that ul/li, the items with a hyperlink and sprite-bg position represent webpages, (inside LI) while items without hyperlink and sprite-bg are just headers of that menusection, (inside H6) to highlight the current page in the menu, the javascript menumaker uses an id number. this number corresponds to the consequtive li that is a webpage, skips h6 headers correctly. these h6 headers are only there for when importing sections of the same menu as submenu. non-li headers are not shown in menu, nore counted by the javascript menu for their ID. to know which page should be shown, i have to count from ID 0, the li items till finding the current webpage in the li structure and then manually put it in each webpage! BUT: changing an item in li order, means stupidly re-counting their entire li again! each webpage has an icon (= sprite bg-position numer), which is also used in the webpage. INTENDED RESULT I dream of, once setting what the current webpage is (e.g carrot.php) the menu system automatically "finds" and "counts" the li's and returns the id nr (for proper highlight of main menu); generates the entire menu html, and depending on which headings are set for submenu, (e.g. meals, drinks) generates those submenu (entire section below each given header); ginally adds h5 highlight inside the li of that submenu item. For the menu, i wish an easily readable, simple plain txt menu that is indented with tabs, (each tab is one depth for example) and further tabs follow for url and sprite position of icon. MY DREAM MENU-MANAGEMENT FILE |>TAB SEPARATED/INDENTED FLATMENU FILE |MUST BE CALCULATED BY PHP: |>MENUTEXT============URL=============SPRITE=====|ID===TAG================== |>about "#" -520 |00 li |> INFORMATION |—— h6 |> physical state "physical.php" -920 |01 li |> mental health "mental.php" -10 |02 li |> |>apetite "#" -1290 |03 li |> meals "#" -600 |04 li |> COLD MEAL |—— h6 |> egg salade "salad.php" -1040 |05 li |> salmon fish "salmon.php" -540 |06 li |> HOT MEAL |—— h6 |> spare ribs "spareribs.php" -120 |07 li |> di macaroni "macaroni.php" -870 |08 li |> |> drinks "#" -230 |09 li |> JUCY DRINK |—— h6 |> carrot juice "carrot.php" -820 |10 li |> mango hive "mango.php" -270 |11 li DESIRED CHRONOLOGY php outputs the entire ul/li html so the javascript can show the menu: webpage items go inside li tags, and header items go inside h6 tags, e.g. <h6>JUCY DRINK</h6> Each website page has a url filename [eg: salad.php]. Based on this given fact, the php menu generator detects the pagename, gives the IDnr of the position of that page according to the li-item nr and sets variable for javascript to highlight current menu item. the menu items below the specified headers are loaded as submenu in which the current page.php is wrapped inside h5 to highlight current page in submenu: e.g. (<li><h5><a href="carrot.php"><p>..etc..</p></h5></li> Question Which methods / steps / (chronological)ways are there for doing this? I am no good in php programming, but am learning it so please dont write any code without a line of comment why I should use that method etc. Where do I start? If I am unclear in my question, please ask. Thanks. Much appreciated!! Concrete Task List from the provided Comments/Answers, sofar: (RobertB) First, get some PHP code working that can read through a tab-delimited file and put the data into an appropriate data structure. NOW WORKING AT THIS

    Read the article

  • Qt C++ signals and slots did not fire

    - by Xegara
    I have programmed Qt a couple of times already and I really like the signals and slots feature. But now, I guess I'm having a problem when a signal is emitted from one thread, the corresponding slot from another thread is not fired. The connection was made in the main program. This is also my first time to use Qt for ROS which uses CMake. The signal fired by the QThread triggered their corresponding slots but the emitted signal of my class UserInput did not trigger the slot in tflistener where it supposed to. I have tried everything I can. Any help? The code is provided below. Main.cpp #include <QCoreApplication> #include <QThread> #include "userinput.h" #include "tfcompleter.h" int main(int argc, char** argv) { QCoreApplication app(argc, argv); QThread *thread1 = new QThread(); QThread *thread2 = new QThread(); UserInput *input1 = new UserInput(); TfCompleter *completer = new TfCompleter(); QObject::connect(input1, SIGNAL(togglePause2()), completer, SLOT(toggle())); QObject::connect(thread1, SIGNAL(started()), completer, SLOT(startCounting())); QObject::connect(thread2, SIGNAL(started()), input1, SLOT(start())); completer->moveToThread(thread1); input1->moveToThread(thread2); thread1->start(); thread2->start(); app.exec(); return 0; } What I want to do is.. There are two seperate threads. One thread is for the user input. When the user enters [space], the thread emits a signal to toggle the boolean member field of the other thread. The other thread 's task is to just continue its process if the user wants it to run, otherwise, the user does not want it to run. I wanted to grant the user to toggle the processing anytime that he wants, that's why I decided to bring them into seperate threads. The following codes are the tflistener and userinput. tfcompleter.h #ifndef TFCOMPLETER_H #define TFCOMPLETER_H #include <QObject> #include <QtCore> class TfCompleter : public QObject { Q_OBJECT private: bool isCount; public Q_SLOTS: void toggle(); void startCounting(); }; #endif tflistener.cpp #include "tfcompleter.h" #include <iostream> void TfCompleter::startCounting() { static uint i = 0; while(true) { if(isCount) std::cout << i++ << std::endl; } } void TfCompleter::toggle() { // isCount = ~isCount; std::cout << "isCount " << std::endl; } UserInput.h #ifndef USERINPUT_H #define USERINPUT_H #include <QObject> #include <QtCore> class UserInput : public QObject { Q_OBJECT public Q_SLOTS: void start(); // Waits for the keypress from the user and emits the corresponding signal. public: Q_SIGNALS: void togglePause2(); }; #endif UserInput.cpp #include "userinput.h" #include <iostream> #include <cstdio> // Implementation of getch #include <termios.h> #include <unistd.h> /* reads from keypress, doesn't echo */ int getch(void) { struct termios oldattr, newattr; int ch; tcgetattr( STDIN_FILENO, &oldattr ); newattr = oldattr; newattr.c_lflag &= ~( ICANON | ECHO ); tcsetattr( STDIN_FILENO, TCSANOW, &newattr ); ch = getchar(); tcsetattr( STDIN_FILENO, TCSANOW, &oldattr ); return ch; } void UserInput::start() { char c = 0; while (true) { c = getch(); if (c == ' ') { Q_EMIT togglePause2(); std::cout << "SPACE" << std::endl; } c = 0; } } Here is the CMakeLists.txt. I just placed it here also since I don't know maybe the CMake has also a factor here. CMakeLists.txt ############################################################################## # CMake ############################################################################## cmake_minimum_required(VERSION 2.4.6) ############################################################################## # Ros Initialisation ############################################################################## include($ENV{ROS_ROOT}/core/rosbuild/rosbuild.cmake) rosbuild_init() set(CMAKE_AUTOMOC ON) #set the default path for built executables to the "bin" directory set(EXECUTABLE_OUTPUT_PATH ${PROJECT_SOURCE_DIR}/bin) #set the default path for built libraries to the "lib" directory set(LIBRARY_OUTPUT_PATH ${PROJECT_SOURCE_DIR}/lib) # Set the build type. Options are: # Coverage : w/ debug symbols, w/o optimization, w/ code-coverage # Debug : w/ debug symbols, w/o optimization # Release : w/o debug symbols, w/ optimization # RelWithDebInfo : w/ debug symbols, w/ optimization # MinSizeRel : w/o debug symbols, w/ optimization, stripped binaries #set(ROS_BUILD_TYPE Debug) ############################################################################## # Qt Environment ############################################################################## # Could use this, but qt-ros would need an updated deb, instead we'll move to catkin # rosbuild_include(qt_build qt-ros) rosbuild_find_ros_package(qt_build) include(${qt_build_PACKAGE_PATH}/qt-ros.cmake) rosbuild_prepare_qt4(QtCore) # Add the appropriate components to the component list here ADD_DEFINITIONS(-DQT_NO_KEYWORDS) ############################################################################## # Sections ############################################################################## #file(GLOB QT_FORMS RELATIVE ${CMAKE_CURRENT_SOURCE_DIR} ui/*.ui) #file(GLOB QT_RESOURCES RELATIVE ${CMAKE_CURRENT_SOURCE_DIR} resources/*.qrc) file(GLOB_RECURSE QT_MOC RELATIVE ${CMAKE_CURRENT_SOURCE_DIR} FOLLOW_SYMLINKS include/rgbdslam_client/*.hpp) #QT4_ADD_RESOURCES(QT_RESOURCES_CPP ${QT_RESOURCES}) #QT4_WRAP_UI(QT_FORMS_HPP ${QT_FORMS}) QT4_WRAP_CPP(QT_MOC_HPP ${QT_MOC}) ############################################################################## # Sources ############################################################################## file(GLOB_RECURSE QT_SOURCES RELATIVE ${CMAKE_CURRENT_SOURCE_DIR} FOLLOW_SYMLINKS src/*.cpp) ############################################################################## # Binaries ############################################################################## rosbuild_add_executable(rgbdslam_client ${QT_SOURCES} ${QT_MOC_HPP}) #rosbuild_add_executable(rgbdslam_client ${QT_SOURCES} ${QT_RESOURCES_CPP} ${QT_FORMS_HPP} ${QT_MOC_HPP}) target_link_libraries(rgbdslam_client ${QT_LIBRARIES})

    Read the article

  • Java Array Index Out of Bounds Exception

    - by user1302023
    I need help debugging the following program: I'm getting a run time error that reads: Exception in thread "main" java.lang.ArrayIndexOutOfBoundsException: -1 at SearchEngine.main(SearchEngine.java:126) import java.util.*; import java.io.*; public class SearchEngine { public static int getNumberOfWords (File f) throws FileNotFoundException { int numWords = 0; Scanner scan = new Scanner(f); while (scan.hasNext()) { numWords++; scan.next(); } scan.close(); return numWords; } public static void readInWords (File input, String [] x) throws FileNotFoundException { Scanner scan = new Scanner(input); int i = 0; while (scan.hasNext() && i<x.length) { x[i] = scan.next(); i++; } scan.close(); } public static int getNumOfDistinctWords (File input, String [] x) throws FileNotFoundException { Scanner scan = new Scanner(input); int count = 0; int i = 1; while (scan.hasNext() && i<x.length) { if (!x[i].equals(x[i-1])) { count++; } i++; } scan.close(); return count; } public static void readInDistinctWords (String [] x, String [] y) { int i = 1; int k = 0; while (i<x.length) { if (!x[i].equals(x[i-1])) { y[k] = x[i]; k++; } i++; } } public static int getNumberOfLines (File input) throws FileNotFoundException { int numLines = 0; Scanner scan = new Scanner(input); while (scan.hasNextLine()) { numLines++; scan.nextLine(); } scan.close(); return numLines; } public static void readInLines (File input, String [] x) throws FileNotFoundException { Scanner scan = new Scanner(input); int i = 0; while (scan.hasNextLine() && i<x.length) { x[i] = scan.nextLine(); i++; } scan.close(); } public static void main(String [] args) { try { //gets file name System.out.println("Enter the name of the text file you wish to search"); Scanner kb = new Scanner(System.in); String fileName = kb.nextLine(); String TXT = ".txt"; if (!fileName.endsWith(TXT)) { fileName = fileName.concat(TXT); } File input = new File(fileName); //First part of creating index System.out.println("Creating vocabArray"); int NUM_WORDS = getNumberOfWords(input); //System.out.println(NUM_WORDS); String [] wordArray = new String[NUM_WORDS]; readInWords(input, wordArray); Arrays.sort(wordArray); int NUM_DISTINCT_WORDS = getNumOfDistinctWords(input, wordArray); String [] vocabArray = new String[NUM_DISTINCT_WORDS]; readInDistinctWords(wordArray, vocabArray); System.out.println("Finished creating vocabArray"); System.out.println("Creating concordanceArray"); int NUM_LINES = getNumberOfLines(input); String [] concordanceArray = new String[NUM_LINES]; readInLines(input, concordanceArray); System.out.println("Finished creating concordanceArray"); System.out.println("Creating invertedIndex"); int [][] invertedIndex = new int[NUM_DISTINCT_WORDS][10]; int [] wordCountArray = new int[NUM_DISTINCT_WORDS]; int lineNum = 0; while (lineNum<concordanceArray.length) { Scanner scan = new Scanner(concordanceArray[lineNum]); while (scan.hasNext()) { int wordPos = Arrays.binarySearch(vocabArray, scan.next()); wordCountArray[wordPos]+=1; for(int i = 0; i < invertedIndex.length; i++) { for(int j = 0; j < invertedIndex[i].length; j++) { if (invertedIndex[i][j] == 0) { invertedIndex[i][j] = lineNum; break; } } } } lineNum++; } System.out.println("Finished creating invertedIndex"); } catch (FileNotFoundException exception) { System.out.println("File Not Found"); } } //main } //class

    Read the article

  • Why doesn't JFreeCharts correctly connect the points in my xy-line graph?

    - by Javajava
    /Each letter A,T,G,C represents a direction for the plot to graph. Specifically, “A” means move right, “T” is move down, “C” is move up, and “G” is move left. When the applet reads A,T,C, it plots the graph correctly. However, when I plot G, the graph is messed up. When I input "ACACACA," the graph is like a rising staircase. When I input "gtgtgt," the graph should look like a staircase, but it looks like a lightning bolt instead/ /This is all one code... i don't know why it's all split up like this:/ import java.applet.Applet; import java.awt.*; import java.awt.event.*; import java.util.Scanner.*; import java.jfree.chart.*; import java.jfree.data.xy.*; import java.jfree.chart.plot.PlotOrientation; public class If_Graph extends Applet implements ActionListener{ Panel panel; TextArea textarea, outputArea; Button move; String thetext; Scanner reader = new Scanner(System.in); String thetext2; int size,p,q; int x,y; public void init(){ setSize(500,500); //set size of applet panel = new Panel(); add(panel); setVisible(true); textarea= new TextArea(10,20); add(textarea); move=new Button("Graph"); move.addActionListener(this); add(move); } public void actionPerformed(ActionEvent e) { XYSeries series = new XYSeries("DNA Walk"); x= 0; y = 0; series.add(x,y); if(e.getSource() == move) { thetext=textarea.getText(); //the text is the DNA bases pasted thetext=thetext.replaceAll(" ",""); //removes spaces thetext2 = ""; for(int i=0; i<thetext.length(); i++) { char a = thetext.charAt(i); switch (a) { case 'A': //moves right x+=1; y+=0; series.add(x,y); break; case 'a': x+=1;y+=0; series.add(x,y); break; case 'C': //moves up x+=0; y+=1; series.add(x,y); break; case 'c': x+=0; y+=1; System.out.println(x + "," + y); series.add(x,y); break; case 'G': //move left x-=1; y+=0; series.add(x,y); System.out.println("G is: "+ x +"," +y); break; case 'g': x-=1; y+=0; System.out.println("g is: " +x + "," + y); series.add(x,y); break; case 'T': //move down x+=0; y-=1; series.add(x,y); System.out.println("T is: "+ x +"," +y); break; case 't': x+=0; y-=1; series.add(x,y); System.out.println("t is: "+ x +"," +y); break; default: // series.add(0,0); break; } } XYDataset xyDataset = new XYSeriesCollection(series); JFreeChart chart = ChartFactory.createXYLineChart ("DNA Random Walk", "", "", xyDataset, PlotOrientation.VERTICAL, true, true, false); ChartFrame frame1=new ChartFrame("DNA Random Walk",chart); frame1.setVisible(true); frame1.setSize(300,300); outputArea.setText(thetext2); } } }

    Read the article

  • Is multithreading the right way to go for my case?

    - by Julien Lebosquain
    Hello, I'm currently designing a multi-client / server application. I'm using plain good old sockets because WCF or similar technology is not what I need. Let me explain: it isn't the classical case of a client simply calling a service; all clients can 'interact' with each other by sending a packet to the server, which will then do some action, and possible re-dispatch an answer message to one or more clients. Although doable with WCF, the application will get pretty complex with hundreds of different messages. For each connected client, I'm of course using asynchronous methods to send and receive bytes. I've got the messages fully working, everything's fine. Except that for each line of code I'm writing, my head just burns because of multithreading issues. Since there could be around 200 clients connected at the same time, I chose to go the fully multithreaded way: each received message on a socket is immediately processed on the thread pool thread it was received, not on a single consumer thread. Since each client can interact with other clients, and indirectly with shared objects on the server, I must protect almost every object that is mutable. I first went with a ReaderWriterLockSlim for each resource that must be protected, but quickly noticed that there are more writes overall than reads in the server application, and switched to the well-known Monitor to simplify the code. So far, so good. Each resource is protected, I have helper classes that I must use to get a lock and its protected resource, so I can't use an object without getting a lock. Moreover, each client has its own lock that is entered as soon as a packet is received from its socket. It's done to prevent other clients from making changes to the state of this client while it has some messages being processed, which is something that will happen frequently. Now, I don't just need to protect resources from concurrent accesses. I must keep every client in sync with the server for some collections I have. One tricky part that I'm currently struggling with is the following: I have a collection of clients. Each client has its own unique ID. When a client connects, it must receive the IDs of every connected client, and each one of them must be notified of the newcomer's ID. When a client disconnects, every other client must know it so that its ID is no longer valid for them. Every client must always have, at a given time, the same clients collection as the server so that I can assume that everybody knows everybody. This way if I'm sending a message to client #1 telling "Client #2 has done something", I know that it will always be correctly interpreted: Client 1 will never wonder "but who is Client 2 anyway?". My first attempt for handling the connection of a new client (let's call it X) was this pseudo-code (remember that newClient is already locked here): lock (clients) { foreach (var client in clients) { lock (client) { client.Send("newClient with id X has connected"); } } clients.Add(newClient); newClient.Send("the list of other clients"); } Now imagine that in the same time, another client has sent a packet that translates into a message that must be broadcasted to every connected client, the pseudo-code will be something like this (remember that the current client - let's call it Y - is already locked here): lock (clients) { foreach (var client in clients) { lock (client) { client.Send("something"); } } } An obvious deadlock occurs here: on one thread X is locked, the clients lock has been entered, started looping through the clients, and at one moment must get Y's lock... which is already acquired on the second thread, itself waiting for the clients collection lock to be released! This is not the only case like this in the server application. There are other collections which must be kept in sync with the clients, some properties on a client can be changed by another one, etc. I tried other types of locks, lock-free mechanisms and a bunch of other things. Either there were obvious deadlocks when I'm using too much locks for safety, or obvious race conditions otherwise. When I finally find a good middle point between the two, it usually comes with very subtle race conditions / dead locks and other multi-threading issues... my head hurts very quickly since for any single line of code I'm writing I have to review almost the whole application to ensure everything will behave correctly with any number of threads. So here's my final question: how would you resolve this specific case, the general case, and more importantly: aren't I going the wrong way here? I have little problems with the .NET framework, C#, simple concurrency or algorithms in general. Still, I'm lost here. I know I could use only one thread processing the incoming requests and everything will be fine. However, that won't scale well at all with more clients... But I'm thinking more and more to go this simple way. What do you think? Thanks in advance to you, StackOverflow people which have taken the time to read this huge question. I really had to explain the whole context if I want to get some help.

    Read the article

  • Fastest way to move records from a oracle DB into MS sql server after processing

    - by user347748
    Hi.. Ok this is the scenario...I have a table in Oracle that acts like a queue... A VB.net program reads the queue and calls a stored proc in MS SQL Server that processes and then inserts the message into another SQL server table and then deletes the record from the oracle table. We use a datareader to read the records from Oracle and then call the stored proc for each of the records. The program seems to be a little slow. The stored procedure itself isnt slow. The SP by itself when called in a loop can process about 2000 records in 20 seconds. BUt when called from the .Net program, the execution time is about 5 records per second. I have seen that most of the time consumed is in calling the stored procedure and waiting for it to return. Is there a better way of doing this? Here is a snippet of the actual code Function StartDataXfer() As Boolean Dim status As Boolean = False Try SqlConn.Open() OraConn.Open() c.ErrorLog(Now.ToString & "--Going to Get the messages from oracle", 1) If GetMsgsFromOracle() Then c.ErrorLog(Now.ToString & "--Got messages from oracle", 1) If ProcessMessages() Then c.ErrorLog(Now.ToString & "--Finished Processing all messages in the queue", 0) status = True Else c.ErrorLog(Now.ToString & "--Failed to Process all messages in the queue", 0) status = False End If Else status = True End If StartDataXfer = status Catch ex As Exception Finally SqlConn.Close() OraConn.Close() End Try End Function Private Function GetMsgsFromOracle() As Boolean Try OraDataAdapter = New OleDb.OleDbDataAdapter OraDataTable = New System.Data.DataTable OraSelCmd = New OleDb.OleDbCommand GetMsgsFromOracle = False With OraSelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = GetMsgSql End With OraDataAdapter.SelectCommand = OraSelCmd OraDataAdapter.Fill(OraDataTable) If OraDataTable.Rows.Count > 0 Then GetMsgsFromOracle = True End If Catch ex As Exception GetMsgsFromOracle = False End Try End Function Private Function ProcessMessages() As Boolean Try ProcessMessages = False PrepareSQLInsert() PrepOraDel() i = 0 Dim Method As Integer Dim OraDataRow As DataRow c.ErrorLog(Now.ToString & "--Going to call message sending procedure", 2) For Each OraDataRow In OraDataTable.Rows With OraDataRow Method = GetMethod(.Item(0)) SQLInsCmd.Parameters("RelLifeTime").Value = c.RelLifetime SQLInsCmd.Parameters("Param1").Value = Nothing SQLInsCmd.Parameters("ID").Value = GenerateTransactionID() ' Nothing SQLInsCmd.Parameters("UID").Value = Nothing SQLInsCmd.Parameters("Param").Value = Nothing SQLInsCmd.Parameters("Credit").Value = 0 SQLInsCmd.ExecuteNonQuery() 'check the return value If SQLInsCmd.Parameters("ReturnValue").Value = 1 And SQLInsCmd.Parameters("OutPutParam").Value = 0 Then 'success 'delete the input record from the source table once it is logged c.ErrorLog(Now.ToString & "--Moved record successfully", 2) OraDataAdapter.DeleteCommand.Parameters("P(0)").Value = OraDataRow.Item(6) OraDataAdapter.DeleteCommand.ExecuteNonQuery() c.ErrorLog(Now.ToString & "--Deleted record successfully", 2) OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Committed record successfully", 2) i = i + 1 Else 'failure c.ErrorLog(Now.ToString & "--Failed to exec: " & c.DestIns & "Status: " & SQLInsCmd.Parameters("OutPutParam").Value & " and TrackId: " & SQLInsCmd.Parameters("TrackID").Value.ToString, 0) End If If File.Exists("stop.txt") Then c.ErrorLog(Now.ToString & "--Stop File Found", 1) 'ProcessMessages = True 'Exit Function Exit For End If End With Next OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Updated Oracle Table", 1) c.ErrorLog(Now.ToString & "--Moved " & i & " records from Oracle to SQL Table", 1) ProcessMessages = True Catch ex As Exception ProcessMessages = False c.ErrorLog(Now.ToString & "--MoveMsgsToSQL: " & ex.Message, 0) Finally OraDataTable.Clear() OraDataTable.Dispose() OraDataAdapter.Dispose() OraDelCmd.Dispose() OraDelCmd = Nothing OraSelCmd = Nothing OraDataTable = Nothing OraDataAdapter = Nothing End Try End Function Public Function GenerateTransactionID() As Int64 Dim SeqNo As Int64 Dim qry As String Dim SqlTransCmd As New OleDb.OleDbCommand qry = " select seqno from StoreSeqNo" SqlTransCmd.CommandType = CommandType.Text SqlTransCmd.Connection = SqlConn SqlTransCmd.CommandText = qry SeqNo = SqlTransCmd.ExecuteScalar If SeqNo > 2147483647 Then qry = "update StoreSeqNo set seqno=1" SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = 1 Else qry = "update StoreSeqNo set seqno=" & SeqNo + 1 SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = SeqNo End If End Function Private Function PrepareSQLInsert() As Boolean 'function to prepare the insert statement for the insert into the SQL stmt using 'the sql procedure SMSProcessAndDispatch Try Dim dr As DataRow SQLInsCmd = New OleDb.OleDbCommand With SQLInsCmd .CommandType = CommandType.StoredProcedure .Connection = SqlConn .CommandText = SQLInsProc .Parameters.Add("ReturnValue", OleDb.OleDbType.Integer) .Parameters("ReturnValue").Direction = ParameterDirection.ReturnValue .Parameters.Add("OutPutParam", OleDb.OleDbType.Integer) .Parameters("OutPutParam").Direction = ParameterDirection.Output .Parameters.Add("TrackID", OleDb.OleDbType.VarChar, 70) .Parameters.Add("RelLifeTime", OleDb.OleDbType.TinyInt) .Parameters("RelLifeTime").Direction = ParameterDirection.Input .Parameters.Add("Param1", OleDb.OleDbType.VarChar, 160) .Parameters("Param1").Direction = ParameterDirection.Input .Parameters.Add("TransID", OleDb.OleDbType.VarChar, 70) .Parameters("TransID").Direction = ParameterDirection.Input .Parameters.Add("UID", OleDb.OleDbType.VarChar, 20) .Parameters("UID").Direction = ParameterDirection.Input .Parameters.Add("Param", OleDb.OleDbType.VarChar, 160) .Parameters("Param").Direction = ParameterDirection.Input .Parameters.Add("CheckCredit", OleDb.OleDbType.Integer) .Parameters("CheckCredit").Direction = ParameterDirection.Input .Prepare() End With Catch ex As Exception c.ErrorLog(Now.ToString & "--PrepareSQLInsert: " & ex.Message) End Try End Function Private Function PrepOraDel() As Boolean OraDelCmd = New OleDb.OleDbCommand Try PrepOraDel = False With OraDelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = DelSrcSQL .Parameters.Add("P(0)", OleDb.OleDbType.VarChar, 160) 'RowID .Parameters("P(0)").Direction = ParameterDirection.Input .Prepare() End With OraDataAdapter.DeleteCommand = OraDelCmd PrepOraDel = True Catch ex As Exception PrepOraDel = False End Try End Function WHat i would like to know is, if there is anyway to speed up this program? Any ideas/suggestions would be highly appreciated... Regardss, Chetan

    Read the article

  • Many-to-one relation exception due to closed session after loading

    - by Nick Thissen
    Hi, I am using NHibernate (version 1.2.1) for the first time so I wrote a simple test application (an ASP.NET project) that uses it. In my database I have two tables: Persons and Categories. Each person gets one category, seems easy enough. | Persons | | Categories | |--------------| |--------------| | Id (PK) | | Id (PK) | | Firstname | | CategoryName | | Lastname | | CreatedTime | | CategoryId | | UpdatedTime | | CreatedTime | | Deleted | | UpdatedTime | | Deleted | The Id, CreatedTime, UpdatedTime and Deleted attributes are a convention I use in all my tables, so I have tried to bring this fact into an additional abstraction layer. I have a project DatabaseFramework which has three important classes: Entity: an abstract class that defines these four properties. All 'entity objects' (in this case Person and Category) must inherit Entity. IEntityManager: a generic interface (type parameter as Entity) that defines methods like Load, Insert, Update, etc. NHibernateEntityManager: an implementation of this interface using NHibernate to do the loading, saving, etc. Now, the Person and Category classes are straightforward, they just define the attributes of the tables of course (keeping in mind that four of them are in the base Entity class). Since the Persons table is related to the Categories table via the CategoryId attribute, the Person class has a Category property that holds the related category. However, in my webpage, I will also need the name of this category (CategoryName), for databinding purposes for example. So I created an additional property CategoryName that returns the CategoryName property of the current Category property, or an empty string if the Category is null: Namespace Database Public Class Person Inherits DatabaseFramework.Entity Public Overridable Property Firstname As String Public Overridable Property Lastname As String Public Overridable Property Category As Category Public Overridable ReadOnly Property CategoryName As String Get Return If(Me.Category Is Nothing, _ String.Empty, _ Me.Category.CategoryName) End Get End Property End Class End Namespace I am mapping the Person class using this mapping file. The many-to-one relation was suggested by Yads in another thread: <id name="Id" column="Id" type="int" unsaved-value="0"> <generator class="identity" /> </id> <property name="CreatedTime" type="DateTime" not-null="true" /> <property name="UpdatedTime" type="DateTime" not-null="true" /> <property name="Deleted" type="Boolean" not-null="true" /> <property name="Firstname" type="String" /> <property name="Lastname" type="String" /> <many-to-one name="Category" column="CategoryId" class="NHibernateWebTest.Database.Category, NHibernateWebTest" /> (I can't get it to show the root node, this forum hides it, I don't know how to escape the html-like tags...) The final important detail is the Load method of the NHibernateEntityManager implementation. (This is in C# as it's in a different project, sorry about that). I simply open a new ISession (ISessionFactory.OpenSession) in the GetSession method and then use that to fill an EntityCollection(Of TEntity) which is just a collection inheriting System.Collections.ObjectModel.Collection(Of T). public virtual EntityCollection< TEntity Load() { using (ISession session = this.GetSession()) { var entities = session .CreateCriteria(typeof (TEntity)) .Add(Expression.Eq("Deleted", false)) .List< TEntity (); return new EntityCollection< TEntity (entities); } } (Again, I can't get it to format the code correctly, it hides the generic type parameters, probably because it reads the angled symbols as a HTML tag..? If you know how to let me do that, let me know!) Now, the idea of this Load method is that I get a fully functional collection of Persons, all their properties set to the correct values (including the Category property, and thus, the CategoryName property should return the correct name). However, it seems that is not the case. When I try to data-bind the result of this Load method to a GridView in ASP.NET, it tells me this: Property accessor 'CategoryName' on object 'NHibernateWebTest.Database.Person' threw the following exception:'Could not initialize proxy - the owning Session was closed.' The exception occurs on the DataBind method call here: public virtual void LoadGrid() { if (this.Grid == null) return; this.Grid.DataSource = this.Manager.Load(); this.Grid.DataBind(); } Well, of course the session is closed, I closed it via the using block. Isn't that the correct approach, should I keep the session open? And for how long? Can I close it after the DataBind method has been run? In each case, I'd really like my Load method to just return a functional collection of items. It seems to me that it is now only getting the Category when it is required (eg, when the GridView wants to read the CategoryName, which wants to read the Category property), but at that time the session is closed. Is that reasoning correct? How do I stop this behavior? Or shouldn't I? And what should I do otherwise? Thanks!

    Read the article

  • Parsing csv line to Java objects

    - by Noobling
    I was wondering if someone here could help me, I can't find a solution for my problem and I have tried everything. What I am trying to do is read and parse lines in a csv file into java objects and I have succeeded in doing that but after it reads all the lines it should insert the lines into the database but it only inserts the 1st line the entire time and I don't no why. When I do a print it shows that it is reading all the lines and placing them in the objects but as soon as I do the insert it wants to insert only the 1st line. Please see my code below: public boolean lineReader(File file){ BufferedReader br = null; String line= ""; String splitBy = ","; storeList = new ArrayList<StoreFile>(); try { br = new BufferedReader(new FileReader(file)); while((line = br.readLine())!=null){ line = line.replace('|', ','); //split on pipe ( | ) String[] array = line.split(splitBy, 14); //Add values from csv to store object //Add values from csv to storeF objects StoreFile StoreF = new StoreFile(); if (array[0].equals("H") || array[0].equals("T")) { return false; } else { StoreF.setRetailID(array[1].replaceAll("/", "")); StoreF.setChain(array[2].replaceAll("/","")); StoreF.setStoreID(array[3].replaceAll("/", "")); StoreF.setStoreName(array[4].replaceAll("/", "")); StoreF.setAddress1(array[5].replaceAll("/", "")); StoreF.setAddress2(array[6].replaceAll("/", "")); StoreF.setAddress3(array[7].replaceAll("/", "")); StoreF.setProvince(array[8].replaceAll("/", "")); StoreF.setAddress4(array[9].replaceAll("/", "")); StoreF.setCountry(array[10].replaceAll("/", "")); StoreF.setCurrency(array[11].replaceAll("/", "")); StoreF.setAddress5(array[12].replaceAll("/", "")); StoreF.setTelNo(array[13].replaceAll("/", "")); //Add stores to list storeList.add(StoreF); } } //print list stores in file printStoreList(storeList); executeStoredPro(storeList); } catch (Exception ex) { nmtbatchservice.NMTBatchService2.LOG.error("An exception accoured: " + ex.getMessage(), ex); //copy to error folder //email } return false; } public void printStoreList(List<StoreFile> storeListToPrint) { for(int i = 0; i <storeListToPrint.size();i++){ System.out.println( storeListToPrint.get(i).getRetailID() + storeListToPrint.get(i).getChain() + storeListToPrint.get(i).getStoreID() + storeListToPrint.get(i).getStoreName() + storeListToPrint.get(i).getAddress1() + storeListToPrint.get(i).getAddress2() + storeListToPrint.get(i).getAddress3() + storeListToPrint.get(i).getProvince() + storeListToPrint.get(i).getAddress4() + storeListToPrint.get(i).getCountry() + storeListToPrint.get(i).getCurrency() + storeListToPrint.get(i).getAddress5() + storeListToPrint.get(i).getTelNo()); } } public void unzip(String source, String destination) { try { ZipFile zipFile = new ZipFile(source); zipFile.extractAll(destination); deleteStoreFile(source); } catch (ZipException ex) { nmtbatchservice.NMTBatchService2.LOG.error("Error unzipping file : " + ex.getMessage(), ex); } } public void deleteStoreFile(String directory) { try { File file = new File(directory); file.delete(); } catch (Exception ex) { nmtbatchservice.NMTBatchService2.LOG.error("An exception accoured when trying to delete file " + directory + " : " + ex.getMessage(), ex); } } public void executeStoredPro(List<StoreFile> storeListToInsert) { Connection con = null; CallableStatement st = null; try { String connectionURL = MSSQLConnectionURL; Class.forName("com.microsoft.sqlserver.jdbc.SQLServerDriver").newInstance(); con = DriverManager.getConnection(connectionURL, MSSQLUsername, MSSQLPassword); for(int i = 0; i <storeListToInsert.size();i++){ st = con.prepareCall( "IF EXISTS (SELECT * FROM tblPay@RetailStores WHERE StoreID = " + storeListToInsert.get(i).getStoreID() + " AND RetailID = "+ storeListToInsert.get(i).getRetailID() + ")" + " UPDATE tblPay@RetailStores " + " SET RetailID = '" + storeListToInsert.get(i).getRetailID() + "'," + " StoreID = '" + storeListToInsert.get(i).getStoreID() + "'," + " StoreName = '" + storeListToInsert.get(i).getStoreName() + "'," + " TestStore = 0," + " Address1 = '" + storeListToInsert.get(i).getAddress1() + "'," + " Address2 = '" + storeListToInsert.get(i).getAddress2() + "'," + " Address3 = '" + storeListToInsert.get(i).getAddress3() + "'," + " Address4 = '" + storeListToInsert.get(i).getAddress4() + "'," + " Address5 = '" + storeListToInsert.get(i).getAddress5() + "'," + " Province = '" + storeListToInsert.get(i).getProvince() + "'," + " TelNo = '" + storeListToInsert.get(i).getTelNo() + "'," + " Enabled = 1" + " ELSE " + " INSERT INTO tblPay@RetailStores ( [RetailID], [StoreID], [StoreName], [TestStore], [Address1], [Address2], [Address3], [Address4], [Address5], [Province], [TelNo] , [Enabled] ) " + " VALUES " + "('" + storeListToInsert.get(i).getRetailID() + "'," + "'" + storeListToInsert.get(i).getStoreID() + "'," + "'" + storeListToInsert.get(i).getStoreName() + "'," + "0," + "'" + storeListToInsert.get(i).getAddress1() + "'," + "'" + storeListToInsert.get(i).getAddress2() + "'," + "'" + storeListToInsert.get(i).getAddress3() + "'," + "'" + storeListToInsert.get(i).getAddress4() + "'," + "'" + storeListToInsert.get(i).getAddress5() + "'," + "'" + storeListToInsert.get(i).getProvince() + "'," + "'" + storeListToInsert.get(i).getTelNo() + "'," + "1)"); st.executeUpdate(); } con.close(); } catch (Exception ex) { nmtbatchservice.NMTBatchService2.LOG.error("Error executing Stored proc with error : " + ex.getMessage(), ex); nmtbatchservice.NMTBatchService2.mailingQueue.addToQueue(new Mail("[email protected]", "Service Email Error", "An error occurred during Store Import failed with error : " + ex.getMessage())); } } Any advise would be appreciated. Thanks

    Read the article

  • Fastest way to move records from an Oracle database into SQL Server

    - by user347748
    Ok this is the scenario... I have a table in Oracle that acts like a queue... A VB.net program reads the queue and calls a stored proc in SQL Server that processes and then inserts the message into another SQL Server table and then deletes the record from the oracle table. We use a DataReader to read the records from Oracle and then call the stored proc for each of the records. The program seems to be a little slow. The stored procedure itself isn't slow. The SP by itself when called in a loop can process about 2000 records in 20 seconds. But when called from the .Net program, the execution time is about 5 records per second. I have seen that most of the time consumed is in calling the stored procedure and waiting for it to return. Is there a better way of doing this? Here is a snippet of the actual code Function StartDataXfer() As Boolean Dim status As Boolean = False Try SqlConn.Open() OraConn.Open() c.ErrorLog(Now.ToString & "--Going to Get the messages from oracle", 1) If GetMsgsFromOracle() Then c.ErrorLog(Now.ToString & "--Got messages from oracle", 1) If ProcessMessages() Then c.ErrorLog(Now.ToString & "--Finished Processing all messages in the queue", 0) status = True Else c.ErrorLog(Now.ToString & "--Failed to Process all messages in the queue", 0) status = False End If Else status = True End If StartDataXfer = status Catch ex As Exception Finally SqlConn.Close() OraConn.Close() End Try End Function Private Function GetMsgsFromOracle() As Boolean Try OraDataAdapter = New OleDb.OleDbDataAdapter OraDataTable = New System.Data.DataTable OraSelCmd = New OleDb.OleDbCommand GetMsgsFromOracle = False With OraSelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = GetMsgSql End With OraDataAdapter.SelectCommand = OraSelCmd OraDataAdapter.Fill(OraDataTable) If OraDataTable.Rows.Count > 0 Then GetMsgsFromOracle = True End If Catch ex As Exception GetMsgsFromOracle = False End Try End Function Private Function ProcessMessages() As Boolean Try ProcessMessages = False PrepareSQLInsert() PrepOraDel() i = 0 Dim Method As Integer Dim OraDataRow As DataRow c.ErrorLog(Now.ToString & "--Going to call message sending procedure", 2) For Each OraDataRow In OraDataTable.Rows With OraDataRow Method = GetMethod(.Item(0)) SQLInsCmd.Parameters("RelLifeTime").Value = c.RelLifetime SQLInsCmd.Parameters("Param1").Value = Nothing SQLInsCmd.Parameters("ID").Value = GenerateTransactionID() ' Nothing SQLInsCmd.Parameters("UID").Value = Nothing SQLInsCmd.Parameters("Param").Value = Nothing SQLInsCmd.Parameters("Credit").Value = 0 SQLInsCmd.ExecuteNonQuery() 'check the return value If SQLInsCmd.Parameters("ReturnValue").Value = 1 And SQLInsCmd.Parameters("OutPutParam").Value = 0 Then 'success 'delete the input record from the source table once it is logged c.ErrorLog(Now.ToString & "--Moved record successfully", 2) OraDataAdapter.DeleteCommand.Parameters("P(0)").Value = OraDataRow.Item(6) OraDataAdapter.DeleteCommand.ExecuteNonQuery() c.ErrorLog(Now.ToString & "--Deleted record successfully", 2) OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Committed record successfully", 2) i = i + 1 Else 'failure c.ErrorLog(Now.ToString & "--Failed to exec: " & c.DestIns & "Status: " & SQLInsCmd.Parameters("OutPutParam").Value & " and TrackId: " & SQLInsCmd.Parameters("TrackID").Value.ToString, 0) End If If File.Exists("stop.txt") Then c.ErrorLog(Now.ToString & "--Stop File Found", 1) 'ProcessMessages = True 'Exit Function Exit For End If End With Next OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Updated Oracle Table", 1) c.ErrorLog(Now.ToString & "--Moved " & i & " records from Oracle to SQL Table", 1) ProcessMessages = True Catch ex As Exception ProcessMessages = False c.ErrorLog(Now.ToString & "--MoveMsgsToSQL: " & ex.Message, 0) Finally OraDataTable.Clear() OraDataTable.Dispose() OraDataAdapter.Dispose() OraDelCmd.Dispose() OraDelCmd = Nothing OraSelCmd = Nothing OraDataTable = Nothing OraDataAdapter = Nothing End Try End Function Public Function GenerateTransactionID() As Int64 Dim SeqNo As Int64 Dim qry As String Dim SqlTransCmd As New OleDb.OleDbCommand qry = " select seqno from StoreSeqNo" SqlTransCmd.CommandType = CommandType.Text SqlTransCmd.Connection = SqlConn SqlTransCmd.CommandText = qry SeqNo = SqlTransCmd.ExecuteScalar If SeqNo > 2147483647 Then qry = "update StoreSeqNo set seqno=1" SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = 1 Else qry = "update StoreSeqNo set seqno=" & SeqNo + 1 SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = SeqNo End If End Function Private Function PrepareSQLInsert() As Boolean 'function to prepare the insert statement for the insert into the SQL stmt using 'the sql procedure SMSProcessAndDispatch Try Dim dr As DataRow SQLInsCmd = New OleDb.OleDbCommand With SQLInsCmd .CommandType = CommandType.StoredProcedure .Connection = SqlConn .CommandText = SQLInsProc .Parameters.Add("ReturnValue", OleDb.OleDbType.Integer) .Parameters("ReturnValue").Direction = ParameterDirection.ReturnValue .Parameters.Add("OutPutParam", OleDb.OleDbType.Integer) .Parameters("OutPutParam").Direction = ParameterDirection.Output .Parameters.Add("TrackID", OleDb.OleDbType.VarChar, 70) .Parameters.Add("RelLifeTime", OleDb.OleDbType.TinyInt) .Parameters("RelLifeTime").Direction = ParameterDirection.Input .Parameters.Add("Param1", OleDb.OleDbType.VarChar, 160) .Parameters("Param1").Direction = ParameterDirection.Input .Parameters.Add("TransID", OleDb.OleDbType.VarChar, 70) .Parameters("TransID").Direction = ParameterDirection.Input .Parameters.Add("UID", OleDb.OleDbType.VarChar, 20) .Parameters("UID").Direction = ParameterDirection.Input .Parameters.Add("Param", OleDb.OleDbType.VarChar, 160) .Parameters("Param").Direction = ParameterDirection.Input .Parameters.Add("CheckCredit", OleDb.OleDbType.Integer) .Parameters("CheckCredit").Direction = ParameterDirection.Input .Prepare() End With Catch ex As Exception c.ErrorLog(Now.ToString & "--PrepareSQLInsert: " & ex.Message) End Try End Function Private Function PrepOraDel() As Boolean OraDelCmd = New OleDb.OleDbCommand Try PrepOraDel = False With OraDelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = DelSrcSQL .Parameters.Add("P(0)", OleDb.OleDbType.VarChar, 160) 'RowID .Parameters("P(0)").Direction = ParameterDirection.Input .Prepare() End With OraDataAdapter.DeleteCommand = OraDelCmd PrepOraDel = True Catch ex As Exception PrepOraDel = False End Try End Function WHat i would like to know is, if there is anyway to speed up this program? Any ideas/suggestions would be highly appreciated... Regardss, Chetan

    Read the article

  • How should I implement simple caches with concurrency on Redis?

    - by solublefish
    Background I have a 2-tier web service - just my app server and an RDBMS. I want to move to a pool of identical app servers behind a load balancer. I currently cache a bunch of objects in-process. I hope to move them to a shared Redis. I have a dozen or so caches of simple, small-sized business objects. For example, I have a set of Foos. Each Foo has a unique FooId and an OwnerId. One "owner" may own multiple Foos. In a traditional RDBMS this is just a table with an index on the PK FooId and one on OwnerId. I'm caching this in one process simply: Dictionary<int,Foo> _cacheFooById; Dictionary<int,HashSet<int>> _indexFooIdsByOwnerId; Reads come straight from here, and writes go here and to the RDBMS. I usually have this invariant: "For a given group [say by OwnerId], the whole group is in cache or none of it is." So when I cache miss on a Foo, I pull that Foo and all the owner's other Foos from the RDBMS. Updates make sure to keep the index up to date and respect the invariant. When an owner calls GetMyFoos I never have to worry that some are cached and some aren't. What I did already The first/simplest answer seems to be to use plain ol' SET and GET with a composite key and json value: SET( "ServiceCache:Foo:" + theFoo.Id, JsonSerialize(theFoo)); I later decided I liked: HSET( "ServiceCache:Foo", theFoo.FooId, JsonSerialize(theFoo)); That lets me get all the values in one cache as HVALS. It also felt right - I'm literally moving hashtables to Redis, so perhaps my top-level items should be hashes. This works to first order. If my high-level code is like: UpdateCache(myFoo); AddToIndex(myFoo); That translates into: HSET ("ServiceCache:Foo", theFoo.FooId, JsonSerialize(theFoo)); var myFoos = JsonDeserialize( HGET ("ServiceCache:FooIndex", theFoo.OwnerId) ); myFoos.Add(theFoo.OwnerId); HSET ("ServiceCache:FooIndex", theFoo.OwnerId, JsonSerialize(myFoos)); However, this is broken in two ways. Two concurrent operations can read/modify/write at the same time. The latter "wins" the final HSET and the former's index update is lost. Another operation could read the index in between the first and second lines. It would miss a Foo that it should find. So how do I index properly? I think I could use a Redis set instead of a json-encoded value for the index. That would solve part of the problem since the "add-to-index-if-not-already-present" would be atomic. I also read about using MULTI as a "transaction" but it doesn't seem like it does what I want. Am I right that I can't really MULTI; HGET; {update}; HSET; EXEC since it doesn't even do the HGET before I issue the EXEC? I also read about using WATCH and MULTI for optimistic concurrency, then retrying on failure. But WATCH only works on top-level keys. So it's back to SET/GET instead of HSET/HGET. And now I need a new index-like-thing to support getting all the values in a given cache. If I understand it right, I can combine all these things to do the job. Something like: while(!succeeded) { WATCH( "ServiceCache:Foo:" + theFoo.FooId ); WATCH( "ServiceCache:FooIndexByOwner:" + theFoo.OwnerId ); WATCH( "ServiceCache:FooIndexAll" ); MULTI(); SET ("ServiceCache:Foo:" + theFoo.FooId, JsonSerialize(theFoo)); SADD ("ServiceCache:FooIndexByOwner:" + theFoo.OwnerId, theFoo.FooId); SADD ("ServiceCache:FooIndexAll", theFoo.FooId); EXEC(); //TODO somehow set succeeded properly } Finally I'd have to translate this pseudocode into real code depending how my client library uses WATCH/MULTI/EXEC; it looks like they need some sort of context to hook them together. All in all this seems like a lot of complexity for what has to be a very common case; I can't help but think there's a better, smarter, Redis-ish way to do things that I'm just not seeing. How do I lock properly? Even if I had no indexes, there's still a (probably rare) race condition. A: HGET - cache miss B: HGET - cache miss A: SELECT B: SELECT A: HSET C: HGET - cache hit C: UPDATE C: HSET B: HSET ** this is stale data that's clobbering C's update. Note that C could just be a really-fast A. Again I think WATCH, MULTI, retry would work, but... ick. I know in some places people use special Redis keys as locks for other objects. Is that a reasonable approach here? Should those be top-level keys like ServiceCache:FooLocks:{Id} or ServiceCache:Locks:Foo:{Id}? Or make a separate hash for them - ServiceCache:Locks with subkeys Foo:{Id}, or ServiceCache:Locks:Foo with subkeys {Id} ? How would I work around abandoned locks, say if a transaction (or a whole server) crashes while "holding" the lock?

    Read the article

  • Inheritance Mapping Strategies with Entity Framework Code First CTP5: Part 3 – Table per Concrete Type (TPC) and Choosing Strategy Guidelines

    - by mortezam
    This is the third (and last) post in a series that explains different approaches to map an inheritance hierarchy with EF Code First. I've described these strategies in previous posts: Part 1 – Table per Hierarchy (TPH) Part 2 – Table per Type (TPT)In today’s blog post I am going to discuss Table per Concrete Type (TPC) which completes the inheritance mapping strategies supported by EF Code First. At the end of this post I will provide some guidelines to choose an inheritance strategy mainly based on what we've learned in this series. TPC and Entity Framework in the Past Table per Concrete type is somehow the simplest approach suggested, yet using TPC with EF is one of those concepts that has not been covered very well so far and I've seen in some resources that it was even discouraged. The reason for that is just because Entity Data Model Designer in VS2010 doesn't support TPC (even though the EF runtime does). That basically means if you are following EF's Database-First or Model-First approaches then configuring TPC requires manually writing XML in the EDMX file which is not considered to be a fun practice. Well, no more. You'll see that with Code First, creating TPC is perfectly possible with fluent API just like other strategies and you don't need to avoid TPC due to the lack of designer support as you would probably do in other EF approaches. Table per Concrete Type (TPC)In Table per Concrete type (aka Table per Concrete class) we use exactly one table for each (nonabstract) class. All properties of a class, including inherited properties, can be mapped to columns of this table, as shown in the following figure: As you can see, the SQL schema is not aware of the inheritance; effectively, we’ve mapped two unrelated tables to a more expressive class structure. If the base class was concrete, then an additional table would be needed to hold instances of that class. I have to emphasize that there is no relationship between the database tables, except for the fact that they share some similar columns. TPC Implementation in Code First Just like the TPT implementation, we need to specify a separate table for each of the subclasses. We also need to tell Code First that we want all of the inherited properties to be mapped as part of this table. In CTP5, there is a new helper method on EntityMappingConfiguration class called MapInheritedProperties that exactly does this for us. Here is the complete object model as well as the fluent API to create a TPC mapping: public abstract class BillingDetail {     public int BillingDetailId { get; set; }     public string Owner { get; set; }     public string Number { get; set; } }          public class BankAccount : BillingDetail {     public string BankName { get; set; }     public string Swift { get; set; } }          public class CreditCard : BillingDetail {     public int CardType { get; set; }     public string ExpiryMonth { get; set; }     public string ExpiryYear { get; set; } }      public class InheritanceMappingContext : DbContext {     public DbSet<BillingDetail> BillingDetails { get; set; }              protected override void OnModelCreating(ModelBuilder modelBuilder)     {         modelBuilder.Entity<BankAccount>().Map(m =>         {             m.MapInheritedProperties();             m.ToTable("BankAccounts");         });         modelBuilder.Entity<CreditCard>().Map(m =>         {             m.MapInheritedProperties();             m.ToTable("CreditCards");         });                 } } The Importance of EntityMappingConfiguration ClassAs a side note, it worth mentioning that EntityMappingConfiguration class turns out to be a key type for inheritance mapping in Code First. Here is an snapshot of this class: namespace System.Data.Entity.ModelConfiguration.Configuration.Mapping {     public class EntityMappingConfiguration<TEntityType> where TEntityType : class     {         public ValueConditionConfiguration Requires(string discriminator);         public void ToTable(string tableName);         public void MapInheritedProperties();     } } As you have seen so far, we used its Requires method to customize TPH. We also used its ToTable method to create a TPT and now we are using its MapInheritedProperties along with ToTable method to create our TPC mapping. TPC Configuration is Not Done Yet!We are not quite done with our TPC configuration and there is more into this story even though the fluent API we saw perfectly created a TPC mapping for us in the database. To see why, let's start working with our object model. For example, the following code creates two new objects of BankAccount and CreditCard types and tries to add them to the database: using (var context = new InheritanceMappingContext()) {     BankAccount bankAccount = new BankAccount();     CreditCard creditCard = new CreditCard() { CardType = 1 };                      context.BillingDetails.Add(bankAccount);     context.BillingDetails.Add(creditCard);     context.SaveChanges(); } Running this code throws an InvalidOperationException with this message: The changes to the database were committed successfully, but an error occurred while updating the object context. The ObjectContext might be in an inconsistent state. Inner exception message: AcceptChanges cannot continue because the object's key values conflict with another object in the ObjectStateManager. Make sure that the key values are unique before calling AcceptChanges. The reason we got this exception is because DbContext.SaveChanges() internally invokes SaveChanges method of its internal ObjectContext. ObjectContext's SaveChanges method on its turn by default calls AcceptAllChanges after it has performed the database modifications. AcceptAllChanges method merely iterates over all entries in ObjectStateManager and invokes AcceptChanges on each of them. Since the entities are in Added state, AcceptChanges method replaces their temporary EntityKey with a regular EntityKey based on the primary key values (i.e. BillingDetailId) that come back from the database and that's where the problem occurs since both the entities have been assigned the same value for their primary key by the database (i.e. on both BillingDetailId = 1) and the problem is that ObjectStateManager cannot track objects of the same type (i.e. BillingDetail) with the same EntityKey value hence it throws. If you take a closer look at the TPC's SQL schema above, you'll see why the database generated the same values for the primary keys: the BillingDetailId column in both BankAccounts and CreditCards table has been marked as identity. How to Solve The Identity Problem in TPC As you saw, using SQL Server’s int identity columns doesn't work very well together with TPC since there will be duplicate entity keys when inserting in subclasses tables with all having the same identity seed. Therefore, to solve this, either a spread seed (where each table has its own initial seed value) will be needed, or a mechanism other than SQL Server’s int identity should be used. Some other RDBMSes have other mechanisms allowing a sequence (identity) to be shared by multiple tables, and something similar can be achieved with GUID keys in SQL Server. While using GUID keys, or int identity keys with different starting seeds will solve the problem but yet another solution would be to completely switch off identity on the primary key property. As a result, we need to take the responsibility of providing unique keys when inserting records to the database. We will go with this solution since it works regardless of which database engine is used. Switching Off Identity in Code First We can switch off identity simply by placing DatabaseGenerated attribute on the primary key property and pass DatabaseGenerationOption.None to its constructor. DatabaseGenerated attribute is a new data annotation which has been added to System.ComponentModel.DataAnnotations namespace in CTP5: public abstract class BillingDetail {     [DatabaseGenerated(DatabaseGenerationOption.None)]     public int BillingDetailId { get; set; }     public string Owner { get; set; }     public string Number { get; set; } } As always, we can achieve the same result by using fluent API, if you prefer that: modelBuilder.Entity<BillingDetail>()             .Property(p => p.BillingDetailId)             .HasDatabaseGenerationOption(DatabaseGenerationOption.None); Working With The Object Model Our TPC mapping is ready and we can try adding new records to the database. But, like I said, now we need to take care of providing unique keys when creating new objects: using (var context = new InheritanceMappingContext()) {     BankAccount bankAccount = new BankAccount()      {          BillingDetailId = 1                          };     CreditCard creditCard = new CreditCard()      {          BillingDetailId = 2,         CardType = 1     };                      context.BillingDetails.Add(bankAccount);     context.BillingDetails.Add(creditCard);     context.SaveChanges(); } Polymorphic Associations with TPC is Problematic The main problem with this approach is that it doesn’t support Polymorphic Associations very well. After all, in the database, associations are represented as foreign key relationships and in TPC, the subclasses are all mapped to different tables so a polymorphic association to their base class (abstract BillingDetail in our example) cannot be represented as a simple foreign key relationship. For example, consider the the domain model we introduced here where User has a polymorphic association with BillingDetail. This would be problematic in our TPC Schema, because if User has a many-to-one relationship with BillingDetail, the Users table would need a single foreign key column, which would have to refer both concrete subclass tables. This isn’t possible with regular foreign key constraints. Schema Evolution with TPC is Complex A further conceptual problem with this mapping strategy is that several different columns, of different tables, share exactly the same semantics. This makes schema evolution more complex. For example, a change to a base class property results in changes to multiple columns. It also makes it much more difficult to implement database integrity constraints that apply to all subclasses. Generated SQLLet's examine SQL output for polymorphic queries in TPC mapping. For example, consider this polymorphic query for all BillingDetails and the resulting SQL statements that being executed in the database: var query = from b in context.BillingDetails select b; Just like the SQL query generated by TPT mapping, the CASE statements that you see in the beginning of the query is merely to ensure columns that are irrelevant for a particular row have NULL values in the returning flattened table. (e.g. BankName for a row that represents a CreditCard type). TPC's SQL Queries are Union Based As you can see in the above screenshot, the first SELECT uses a FROM-clause subquery (which is selected with a red rectangle) to retrieve all instances of BillingDetails from all concrete class tables. The tables are combined with a UNION operator, and a literal (in this case, 0 and 1) is inserted into the intermediate result; (look at the lines highlighted in yellow.) EF reads this to instantiate the correct class given the data from a particular row. A union requires that the queries that are combined, project over the same columns; hence, EF has to pad and fill up nonexistent columns with NULL. This query will really perform well since here we can let the database optimizer find the best execution plan to combine rows from several tables. There is also no Joins involved so it has a better performance than the SQL queries generated by TPT where a Join is required between the base and subclasses tables. Choosing Strategy GuidelinesBefore we get into this discussion, I want to emphasize that there is no one single "best strategy fits all scenarios" exists. As you saw, each of the approaches have their own advantages and drawbacks. Here are some rules of thumb to identify the best strategy in a particular scenario: If you don’t require polymorphic associations or queries, lean toward TPC—in other words, if you never or rarely query for BillingDetails and you have no class that has an association to BillingDetail base class. I recommend TPC (only) for the top level of your class hierarchy, where polymorphism isn’t usually required, and when modification of the base class in the future is unlikely. If you do require polymorphic associations or queries, and subclasses declare relatively few properties (particularly if the main difference between subclasses is in their behavior), lean toward TPH. Your goal is to minimize the number of nullable columns and to convince yourself (and your DBA) that a denormalized schema won’t create problems in the long run. If you do require polymorphic associations or queries, and subclasses declare many properties (subclasses differ mainly by the data they hold), lean toward TPT. Or, depending on the width and depth of your inheritance hierarchy and the possible cost of joins versus unions, use TPC. By default, choose TPH only for simple problems. For more complex cases (or when you’re overruled by a data modeler insisting on the importance of nullability constraints and normalization), you should consider the TPT strategy. But at that point, ask yourself whether it may not be better to remodel inheritance as delegation in the object model (delegation is a way of making composition as powerful for reuse as inheritance). Complex inheritance is often best avoided for all sorts of reasons unrelated to persistence or ORM. EF acts as a buffer between the domain and relational models, but that doesn’t mean you can ignore persistence concerns when designing your classes. SummaryIn this series, we focused on one of the main structural aspect of the object/relational paradigm mismatch which is inheritance and discussed how EF solve this problem as an ORM solution. We learned about the three well-known inheritance mapping strategies and their implementations in EF Code First. Hopefully it gives you a better insight about the mapping of inheritance hierarchies as well as choosing the best strategy for your particular scenario. Happy New Year and Happy Code-Firsting! References ADO.NET team blog Java Persistence with Hibernate book a { color: #5A99FF; } a:visited { color: #5A99FF; } .title { padding-bottom: 5px; font-family: Segoe UI; font-size: 11pt; font-weight: bold; padding-top: 15px; } .code, .typeName { font-family: consolas; } .typeName { color: #2b91af; } .padTop5 { padding-top: 5px; } .padTop10 { padding-top: 10px; } .exception { background-color: #f0f0f0; font-style: italic; padding-bottom: 5px; padding-left: 5px; padding-top: 5px; padding-right: 5px; }

    Read the article

  • JMS Step 6 - How to Set Up an AQ JMS (Advanced Queueing JMS) for SOA Purposes

    - by John-Brown.Evans
    JMS Step 6 - How to Set Up an AQ JMS (Advanced Queueing JMS) for SOA Purposes .jblist{list-style-type:disc;margin:0;padding:0;padding-left:0pt;margin-left:36pt} ol{margin:0;padding:0} .c17_6{vertical-align:top;width:468pt;border-style:solid;border-color:#000000;border-width:1pt;padding:5pt 5pt 5pt 5pt} .c5_6{vertical-align:top;border-style:solid;border-color:#000000;border-width:1pt;padding:0pt 5pt 0pt 5pt} .c6_6{vertical-align:top;width:156pt;border-style:solid;border-color:#000000;border-width:1pt;padding:5pt 5pt 5pt 5pt} .c15_6{background-color:#ffffff} .c10_6{color:#1155cc;text-decoration:underline} .c1_6{text-align:center;direction:ltr} .c0_6{line-height:1.0;direction:ltr} .c16_6{color:#666666;font-size:12pt} .c18_6{color:inherit;text-decoration:inherit} .c8_6{background-color:#f3f3f3} .c2_6{direction:ltr} .c14_6{font-size:8pt} .c11_6{font-size:10pt} .c7_6{font-weight:bold} .c12_6{height:0pt} .c3_6{height:11pt} .c13_6{border-collapse:collapse} .c4_6{font-family:"Courier New"} .c9_6{font-style:italic} .title{padding-top:24pt;line-height:1.15;text-align:left;color:#000000;font-size:36pt;font-family:"Arial";font-weight:bold;padding-bottom:6pt} .subtitle{padding-top:18pt;line-height:1.15;text-align:left;color:#666666;font-style:italic;font-size:24pt;font-family:"Georgia";padding-bottom:4pt} li{color:#000000;font-size:10pt;font-family:"Arial"} p{color:#000000;font-size:10pt;margin:0;font-family:"Arial"} h1{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:24pt;font-family:"Arial";font-weight:normal} h2{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:18pt;font-family:"Arial";font-weight:normal} h3{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:14pt;font-family:"Arial";font-weight:normal} h4{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:12pt;font-family:"Arial";font-weight:normal} h5{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:11pt;font-family:"Arial";font-weight:normal} h6{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:10pt;font-family:"Arial";font-weight:normal} This post continues the series of JMS articles which demonstrate how to use JMS queues in a SOA context. The previous posts were: JMS Step 1 - How to Create a Simple JMS Queue in Weblogic Server 11g JMS Step 2 - Using the QueueSend.java Sample Program to Send a Message to a JMS Queue JMS Step 3 - Using the QueueReceive.java Sample Program to Read a Message from a JMS Queue JMS Step 4 - How to Create an 11g BPEL Process Which Writes a Message Based on an XML Schema to a JMS Queue JMS Step 5 - How to Create an 11g BPEL Process Which Reads a Message Based on an XML Schema from a JMS Queue This example leads you through the creation of an Oracle database Advanced Queue and the related WebLogic server objects in order to use AQ JMS in connection with a SOA composite. If you have not already done so, I recommend you look at the previous posts in this series, as they include steps which this example builds upon. The following examples will demonstrate how to write and read from the queue from a SOA process. 1. Recap and Prerequisites In the previous examples, we created a JMS Queue, a Connection Factory and a Connection Pool in the WebLogic Server Console. Then we wrote and deployed BPEL composites, which enqueued and dequeued a simple XML payload. AQ JMS allows you to interoperate with database Advanced Queueing via JMS in WebLogic server and therefore take advantage of database features, while maintaining compliance with the JMS architecture. AQ JMS uses the WebLogic JMS Foreign Server framework. A full description of this functionality can be found in the following Oracle documentation Oracle® Fusion Middleware Configuring and Managing JMS for Oracle WebLogic Server 11g Release 1 (10.3.6) Part Number E13738-06 7. Interoperating with Oracle AQ JMS http://docs.oracle.com/cd/E23943_01/web.1111/e13738/aq_jms.htm#CJACBCEJ For easier reference, this sample will use the same names for the objects as in the above document, except for the name of the database user, as it is possible that this user already exists in your database. We will create the following objects Database Objects Name Type AQJMSUSER Database User MyQueueTable Advanced Queue (AQ) Table UserQueue Advanced Queue WebLogic Server Objects Object Name Type JNDI Name aqjmsuserDataSource Data Source jdbc/aqjmsuserDataSource AqJmsModule JMS System Module AqJmsForeignServer JMS Foreign Server AqJmsForeignServerConnectionFactory JMS Foreign Server Connection Factory AqJmsForeignServerConnectionFactory AqJmsForeignDestination AQ JMS Foreign Destination queue/USERQUEUE eis/aqjms/UserQueue Connection Pool eis/aqjms/UserQueue 2. Create a Database User and Advanced Queue The following steps can be executed in the database client of your choice, e.g. JDeveloper or SQL Developer. The examples below use SQL*Plus. Log in to the database as a DBA user, for example SYSTEM or SYS. Create the AQJMSUSER user and grant privileges to enable the user to create AQ objects. Create Database User and Grant AQ Privileges sqlplus system/password as SYSDBA GRANT connect, resource TO aqjmsuser IDENTIFIED BY aqjmsuser; GRANT aq_user_role TO aqjmsuser; GRANT execute ON sys.dbms_aqadm TO aqjmsuser; GRANT execute ON sys.dbms_aq TO aqjmsuser; GRANT execute ON sys.dbms_aqin TO aqjmsuser; GRANT execute ON sys.dbms_aqjms TO aqjmsuser; Create the Queue Table and Advanced Queue and Start the AQ The following commands are executed as the aqjmsuser database user. Create the Queue Table connect aqjmsuser/aqjmsuser; BEGIN dbms_aqadm.create_queue_table ( queue_table = 'myQueueTable', queue_payload_type = 'sys.aq$_jms_text_message', multiple_consumers = false ); END; / Create the AQ BEGIN dbms_aqadm.create_queue ( queue_name = 'userQueue', queue_table = 'myQueueTable' ); END; / Start the AQ BEGIN dbms_aqadm.start_queue ( queue_name = 'userQueue'); END; / The above commands can be executed in a single PL/SQL block, but are shown as separate blocks in this example for ease of reference. You can verify the queue by executing the SQL command SELECT object_name, object_type FROM user_objects; which should display the following objects: OBJECT_NAME OBJECT_TYPE ------------------------------ ------------------- SYS_C0056513 INDEX SYS_LOB0000170822C00041$$ LOB SYS_LOB0000170822C00040$$ LOB SYS_LOB0000170822C00037$$ LOB AQ$_MYQUEUETABLE_T INDEX AQ$_MYQUEUETABLE_I INDEX AQ$_MYQUEUETABLE_E QUEUE AQ$_MYQUEUETABLE_F VIEW AQ$MYQUEUETABLE VIEW MYQUEUETABLE TABLE USERQUEUE QUEUE Similarly, you can view the objects in JDeveloper via a Database Connection to the AQJMSUSER. 3. Configure WebLogic Server and Add JMS Objects All these steps are executed from the WebLogic Server Administration Console. Log in as the webLogic user. Configure a WebLogic Data Source The data source is required for the database connection to the AQ created above. Navigate to domain > Services > Data Sources and press New then Generic Data Source. Use the values:Name: aqjmsuserDataSource JNDI Name: jdbc/aqjmsuserDataSource Database type: Oracle Database Driver: *Oracle’ Driver (Thin XA) for Instance connections; Versions:9.0.1 and later Connection Properties: Enter the connection information to the database containing the AQ created above and enter aqjmsuser for the User Name and Password. Press Test Configuration to verify the connection details and press Next. Target the data source to the soa server. The data source will be displayed in the list. It is a good idea to test the data source at this stage. Click on aqjmsuserDataSource, select Monitoring > Testing > soa_server1 and press Test Data Source. The result is displayed at the top of the page. Configure a JMS System Module The JMS system module is required to host the JMS foreign server for AQ resources. Navigate to Services > Messaging > JMS Modules and select New. Use the values: Name: AqJmsModule (Leave Descriptor File Name and Location in Domain empty.) Target: soa_server1 Click Finish. The other resources will be created in separate steps. The module will be displayed in the list.   Configure a JMS Foreign Server A foreign server is required in order to reference a 3rd-party JMS provider, in this case the database AQ, within a local WebLogic server JNDI tree. Navigate to Services > Messaging > JMS Modules and select (click on) AqJmsModule to configure it. Under Summary of Resources, select New then Foreign Server. Name: AqJmsForeignServer Targets: The foreign server is targeted automatically to soa_server1, based on the JMS module’s target. Press Finish to create the foreign server. The foreign server resource will be listed in the Summary of Resources for the AqJmsModule, but needs additional configuration steps. Click on AqJmsForeignServer and select Configuration > General to complete the configuration: JNDI Initial Context Factory: oracle.jms.AQjmsInitialContextFactory JNDI Connection URL: <empty> JNDI Properties Credential:<empty> Confirm JNDI Properties Credential: <empty> JNDI Properties: datasource=jdbc/aqjmsuserDataSource This is an important property. It is the JNDI name of the data source created above, which points to the AQ schema in the database and must be entered as a name=value pair, as in this example, e.g. datasource=jdbc/aqjmsuserDataSource, including the “datasource=” property name. Default Targeting Enabled: Leave this value checked. Press Save to save the configuration. At this point it is a good idea to verify that the data source was written correctly to the config file. In a terminal window, navigate to $MIDDLEWARE_HOME/user_projects/domains/soa_domain/config/jms  and open the file aqjmsmodule-jms.xml . The foreign server configuration should contain the datasource name-value pair, as follows:   <foreign-server name="AqJmsForeignServer">         <default-targeting-enabled>true</default-targeting-enabled>         <initial-context-factory>oracle.jms.AQjmsInitialContextFactory</initial-context-factory>         <jndi-property>           <key> datasource </key>           <value> jdbc/aqjmsuserDataSource </value>         </jndi-property>   </foreign-server> </weblogic-jms> Configure a JMS Foreign Server Connection Factory When creating the foreign server connection factory, you enter local and remote JNDI names. The name of the connection factory itself and the local JNDI name are arbitrary, but the remote JNDI name must match a specific format, depending on the type of queue or topic to be accessed in the database. This is very important and if the incorrect value is used, the connection to the queue will not be established and the error messages you get will not immediately reflect the cause of the error. The formats required (Remote JNDI names for AQ JMS Connection Factories) are described in the section Configure AQ Destinations  of the Oracle® Fusion Middleware Configuring and Managing JMS for Oracle WebLogic Server document mentioned earlier. In this example, the remote JNDI name used is   XAQueueConnectionFactory  because it matches the AQ and data source created earlier, i.e. thin with AQ. Navigate to JMS Modules > AqJmsModule > AqJmsForeignServer > Connection Factories then New.Name: AqJmsForeignServerConnectionFactory Local JNDI Name: AqJmsForeignServerConnectionFactory Note: this local JNDI name is the JNDI name which your client application, e.g. a later BPEL process, will use to access this connection factory. Remote JNDI Name: XAQueueConnectionFactory Press OK to save the configuration. Configure an AQ JMS Foreign Server Destination A foreign server destination maps the JNDI name on the foreign JNDI provider to the respective local JNDI name, allowing the foreign JNDI name to be accessed via the local server. As with the foreign server connection factory, the local JNDI name is arbitrary (but must be unique), but the remote JNDI name must conform to a specific format defined in the section Configure AQ Destinations  of the Oracle® Fusion Middleware Configuring and Managing JMS for Oracle WebLogic Server document mentioned earlier. In our example, the remote JNDI name is Queues/USERQUEUE , because it references a queue (as opposed to a topic) with the name USERQUEUE. We will name the local JNDI name queue/USERQUEUE, which is a little confusing (note the missing “s” in “queue), but conforms better to the JNDI nomenclature in our SOA server and also allows us to differentiate between the local and remote names for demonstration purposes. Navigate to JMS Modules > AqJmsModule > AqJmsForeignServer > Destinations and select New.Name: AqJmsForeignDestination Local JNDI Name: queue/USERQUEUE Remote JNDI Name:Queues/USERQUEUE After saving the foreign destination configuration, this completes the JMS part of the configuration. We still need to configure the JMS adapter in order to be able to access the queue from a BPEL processt. 4. Create a JMS Adapter Connection Pool in Weblogic Server Create the Connection Pool Access to the AQ JMS queue from a BPEL or other SOA process in our example is done via a JMS adapter. To enable this, the JmsAdapter in WebLogic server needs to be configured to have a connection pool which points to the local connection factory JNDI name which was created earlier. Navigate to Deployments > Next and select (click on) the JmsAdapter. Select Configuration > Outbound Connection Pools and New. Check the radio button for oracle.tip.adapter.jms.IJmsConnectionFactory and press Next. JNDI Name: eis/aqjms/UserQueue Press Finish Expand oracle.tip.adapter.jms.IJmsConnectionFactory and click on eis/aqjms/UserQueue to configure it. The ConnectionFactoryLocation must point to the foreign server’s local connection factory name created earlier. In our example, this is AqJmsForeignServerConnectionFactory . As a reminder, this connection factory is located under JMS Modules > AqJmsModule > AqJmsForeignServer > Connection Factories and the value needed here is under Local JNDI Name. Enter AqJmsForeignServerConnectionFactory  into the Property Value field for ConnectionFactoryLocation. You must then press Return/Enter then Save for the value to be accepted. If your WebLogic server is running in Development mode, you should see the message that the changes have been activated and the deployment plan successfully updated. If not, then you will manually need to activate the changes in the WebLogic server console.Although the changes have been activated, the JmsAdapter needs to be redeployed in order for the changes to become effective. This should be confirmed by the message Remember to update your deployment to reflect the new plan when you are finished with your changes. Redeploy the JmsAdapter Navigate back to the Deployments screen, either by selecting it in the left-hand navigation tree or by selecting the “Summary of Deployments” link in the breadcrumbs list at the top of the screen. Then select the checkbox next to JmsAdapter and press the Update button. On the Update Application Assistant page, select “Redeploy this application using the following deployment files” and press Finish. After a few seconds you should get the message that the selected deployments were updated. The JMS adapter configuration is complete and it can now be used to access the AQ JMS queue. You can verify that the JNDI name was created correctly, by navigating to Environment > Servers > soa_server1 and View JNDI Tree. Then scroll down in the JNDI Tree Structure to eis and select aqjms. This concludes the sample. In the following post, I will show you how to create a BPEL process which sends a message to this advanced queue via JMS. Best regards John-Brown Evans Oracle Technology Proactive Support Delivery

    Read the article

  • JMS Step 7 - How to Write to an AQ JMS (Advanced Queueing JMS) Queue from a BPEL Process

    - by John-Brown.Evans
    JMS Step 7 - How to Write to an AQ JMS (Advanced Queueing JMS) Queue from a BPEL Process ol{margin:0;padding:0} .jblist{list-style-type:disc;margin:0;padding:0;padding-left:0pt;margin-left:36pt} .c4_7{vertical-align:top;width:468pt;border-style:solid;border-color:#000000;border-width:1pt;padding:5pt 5pt 5pt 5pt} .c3_7{vertical-align:top;width:234pt;border-style:solid;border-color:#000000;border-width:1pt;padding:0pt 5pt 0pt 5pt} .c6_7{vertical-align:top;width:156pt;border-style:solid;border-color:#000000;border-width:1pt;padding:5pt 5pt 5pt 5pt} .c16_7{background-color:#ffffff;padding:0pt 0pt 0pt 0pt} .c0_7{height:11pt;direction:ltr} .c9_7{color:#1155cc;text-decoration:underline} .c17_7{color:inherit;text-decoration:inherit} .c5_7{direction:ltr} .c18_7{background-color:#ffff00} .c2_7{background-color:#f3f3f3} .c14_7{height:0pt} .c8_7{text-indent:36pt} .c11_7{text-align:center} .c7_7{font-style:italic} .c1_7{font-family:"Courier New"} .c13_7{line-height:1.0} .c15_7{border-collapse:collapse} .c12_7{font-weight:bold} .c10_7{font-size:8pt} .title{padding-top:24pt;line-height:1.15;text-align:left;color:#000000;font-size:36pt;font-family:"Arial";font-weight:bold;padding-bottom:6pt} .subtitle{padding-top:18pt;line-height:1.15;text-align:left;color:#666666;font-style:italic;font-size:24pt;font-family:"Georgia";padding-bottom:4pt} li{color:#000000;font-size:10pt;font-family:"Arial"} p{color:#000000;font-size:10pt;margin:0;font-family:"Arial"} h1{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:24pt;font-family:"Arial";font-weight:normal} h2{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:18pt;font-family:"Arial";font-weight:normal} h3{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:14pt;font-family:"Arial";font-weight:normal} h4{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:12pt;font-family:"Arial";font-weight:normal} h5{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:11pt;font-family:"Arial";font-weight:normal} h6{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:10pt;font-family:"Arial";font-weight:normal} This post continues the series of JMS articles which demonstrate how to use JMS queues in a SOA context. The previous posts were: JMS Step 1 - How to Create a Simple JMS Queue in Weblogic Server 11g JMS Step 2 - Using the QueueSend.java Sample Program to Send a Message to a JMS Queue JMS Step 3 - Using the QueueReceive.java Sample Program to Read a Message from a JMS Queue JMS Step 4 - How to Create an 11g BPEL Process Which Writes a Message Based on an XML Schema to a JMS Queue JMS Step 5 - How to Create an 11g BPEL Process Which Reads a Message Based on an XML Schema from a JMS Queue JMS Step 6 - How to Set Up an AQ JMS (Advanced Queueing JMS) for SOA Purposes This example demonstrates how to write a simple message to an Oracle AQ via the the WebLogic AQ JMS functionality from a BPEL process and a JMS adapter. If you have not yet reviewed the previous posts, please do so first, especially the JMS Step 6 post, as this one references objects created there. 1. Recap and Prerequisites In the previous example, we created an Oracle Advanced Queue (AQ) and some related JMS objects in WebLogic Server to be able to access it via JMS. Here are the objects which were created and their names and JNDI names: Database Objects Name Type AQJMSUSER Database User MyQueueTable Advanced Queue (AQ) Table UserQueue Advanced Queue WebLogic Server Objects Object Name Type JNDI Name aqjmsuserDataSource Data Source jdbc/aqjmsuserDataSource AqJmsModule JMS System Module AqJmsForeignServer JMS Foreign Server AqJmsForeignServerConnectionFactory JMS Foreign Server Connection Factory AqJmsForeignServerConnectionFactory AqJmsForeignDestination AQ JMS Foreign Destination queue/USERQUEUE eis/aqjms/UserQueue Connection Pool eis/aqjms/UserQueue 2 . Create a BPEL Composite with a JMS Adapter Partner Link This step requires that you have a valid Application Server Connection defined in JDeveloper, pointing to the application server on which you created the JMS Queue and Connection Factory. You can create this connection in JDeveloper under the Application Server Navigator. Give it any name and be sure to test the connection before completing it. This sample will write a simple XML message to the AQ JMS queue via the JMS adapter, based on the following XSD file, which consists of a single string element: stringPayload.xsd <?xml version="1.0" encoding="windows-1252" ?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema"                xmlns="http://www.example.org"                targetNamespace="http://www.example.org"                elementFormDefault="qualified">  <xsd:element name="exampleElement" type="xsd:string">  </xsd:element> </xsd:schema> The following steps are all executed in JDeveloper. The SOA project will be created inside a JDeveloper Application. If you do not already have an application to contain the project, you can create a new one via File > New > General > Generic Application. Give the application any name, for example JMSTests and, when prompted for a project name and type, call the project   JmsAdapterWriteAqJms  and select SOA as the project technology type. If you already have an application, continue below. Create a SOA Project Create a new project and select SOA Tier > SOA Project as its type. Name it JmsAdapterWriteAqJms . When prompted for the composite type, choose Composite With BPEL Process. When prompted for the BPEL Process, name it JmsAdapterWriteAqJms too and choose Synchronous BPEL Process as the template. This will create a composite with a BPEL process and an exposed SOAP service. Double-click the BPEL process to open and begin editing it. You should see a simple BPEL process with a Receive and Reply activity. As we created a default process without an XML schema, the input and output variables are simple strings. Create an XSD File An XSD file is required later to define the message format to be passed to the JMS adapter. In this step, we create a simple XSD file, containing a string variable and add it to the project. First select the xsd item in the left-hand navigation tree to ensure that the XSD file is created under that item. Select File > New > General > XML and choose XML Schema. Call it stringPayload.xsd  and when the editor opens, select the Source view. then replace the contents with the contents of the stringPayload.xsd example above and save the file. You should see it under the XSD item in the navigation tree. Create a JMS Adapter Partner Link We will create the JMS adapter as a service at the composite level. If it is not already open, double-click the composite.xml file in the navigator to open it. From the Component Palette, drag a JMS adapter over onto the right-hand swim lane, under External References. This will start the JMS Adapter Configuration Wizard. Use the following entries: Service Name: JmsAdapterWrite Oracle Enterprise Messaging Service (OEMS): Oracle Advanced Queueing AppServer Connection: Use an existing application server connection pointing to the WebLogic server on which the connection factory created earlier is located. You can use the “+” button to create a connection directly from the wizard, if you do not already have one. Adapter Interface > Interface: Define from operation and schema (specified later) Operation Type: Produce Message Operation Name: Produce_message Produce Operation Parameters Destination Name: Wait for the list to populate. (Only foreign servers are listed here, because Oracle Advanced Queuing was selected earlier, in step 3) .         Select the foreign server destination created earlier, AqJmsForeignDestination (queue) . This will automatically populate the Destination Name field with the name of the foreign destination, queue/USERQUEUE . JNDI Name: The JNDI name to use for the JMS connection. This is the JNDI name of the connection pool created in the WebLogic Server.JDeveloper does not verify the value entered here. If you enter a wrong value, the JMS adapter won’t find the queue and you will get an error message at runtime. In our example, this is the value eis/aqjms/UserQueue Messages URL: We will use the XSD file we created earlier, stringPayload.xsd to define the message format for the JMS adapter. Press the magnifying glass icon to search for schema files. Expand Project Schema Files > stringPayload.xsd and select exampleElement : string . Press Next and Finish, which will complete the JMS Adapter configuration. Wire the BPEL Component to the JMS Adapter In this step, we link the BPEL process/component to the JMS adapter. From the composite.xml editor, drag the right-arrow icon from the BPEL process to the JMS adapter’s in-arrow.   This completes the steps at the composite level. 3. Complete the BPEL Process Design Invoke the JMS Adapter Open the BPEL component by double-clicking it in the design view of the composite.xml. This will display the BPEL process in the design view. You should see the JmsAdapterWrite partner link under one of the two swim lanes. We want it in the right-hand swim lane. If JDeveloper displays it in the left-hand lane, right-click it and choose Display > Move To Opposite Swim Lane. An Invoke activity is required in order to invoke the JMS adapter. Drag an Invoke activity between the Receive and Reply activities. Drag the right-hand arrow from the Invoke activity to the JMS adapter partner link. This will open the Invoke editor. The correct default values are entered automatically and are fine for our purposes. We only need to define the input variable to use for the JMS adapter. By pressing the green “+” symbol, a variable of the correct type can be auto-generated, for example with the name Invoke1_Produce_Message_InputVariable. Press OK after creating the variable. Assign Variables Drag an Assign activity between the Receive and Invoke activities. We will simply copy the input variable to the JMS adapter and, for completion, so the process has an output to print, again to the process’s output variable. Double-click the Assign activity and create two Copy rules: for the first, drag Variables > inputVariable > payload > client:process > client:input_string to Invoke1_Produce_Message_InputVariable > body > ns2:exampleElement for the second, drag the same input variable to outputVariable > payload > client:processResponse > client:result This will create two copy rules, similar to the following: Press OK. This completes the BPEL and Composite design. 4. Compile and Deploy the Composite Compile the process by pressing the Make or Rebuild icons or by right-clicking the project name in the navigator and selecting Make... or Rebuild... If the compilation is successful, deploy it to the SOA server connection defined earlier. (Right-click the project name in the navigator, select Deploy to Application Server, choose the application server connection, choose the partition on the server (usually default) and press Finish. You should see the message ----  Deployment finished.  ---- in the Deployment frame, if the deployment was successful. 5. Test the Composite Execute a Test Instance In a browser, log in to the Enterprise Manager 11g Fusion Middleware Control (EM) for your SOA installation. Navigate to SOA > soa-infra (soa_server1) > default (or wherever you deployed your composite) and click on  JmsAdapterWriteAqJms [1.0] , then press the Test button. Enter any string into the text input field, for example “Test message from JmsAdapterWriteAqJms” then press Test Web Service. If the instance is successful, you should see the same text you entered in the Response payload frame. Monitor the Advanced Queue The test message will be written to the advanced queue created at the top of this sample. To confirm it, log in to the database as AQJMSUSER and query the MYQUEUETABLE database table. For example, from a shell window with SQL*Plus sqlplus aqjmsuser/aqjmsuser SQL> SELECT user_data FROM myqueuetable; which will display the message contents, for example Similarly, you can use the JDeveloper Database Navigator to view the contents. Use a database connection to the AQJMSUSER and in the navigator, expand Queues Tables and select MYQUEUETABLE. Select the Data tab and scroll to the USER_DATA column to view its contents. This concludes this example. The following post will be the last one in this series. In it, we will learn how to read the message we just wrote using a BPEL process and AQ JMS. Best regards John-Brown Evans Oracle Technology Proactive Support Delivery

    Read the article

  • Built-in GZip/Deflate Compression on IIS 7.x

    - by Rick Strahl
    IIS 7 improves internal compression functionality dramatically making it much easier than previous versions to take advantage of compression that’s built-in to the Web server. IIS 7 also supports dynamic compression which allows automatic compression of content created in your own applications (ASP.NET or otherwise!). The scheme is based on content-type sniffing and so it works with any kind of Web application framework. While static compression on IIS 7 is super easy to set up and turned on by default for most text content (text/*, which includes HTML and CSS, as well as for JavaScript, Atom, XAML, XML), setting up dynamic compression is a bit more involved, mostly because the various default compression settings are set in multiple places down the IIS –> ASP.NET hierarchy. Let’s take a look at each of the two approaches available: Static Compression Compresses static content from the hard disk. IIS can cache this content by compressing the file once and storing the compressed file on disk and serving the compressed alias whenever static content is requested and it hasn’t changed. The overhead for this is minimal and should be aggressively enabled. Dynamic Compression Works against application generated output from applications like your ASP.NET apps. Unlike static content, dynamic content must be compressed every time a page that requests it regenerates its content. As such dynamic compression has a much bigger impact than static caching. How Compression is configured Compression in IIS 7.x  is configured with two .config file elements in the <system.WebServer> space. The elements can be set anywhere in the IIS/ASP.NET configuration pipeline all the way from ApplicationHost.config down to the local web.config file. The following is from the the default setting in ApplicationHost.config (in the %windir%\System32\inetsrv\config forlder) on IIS 7.5 with a couple of small adjustments (added json output and enabled dynamic compression): <?xml version="1.0" encoding="UTF-8"?> <configuration> <system.webServer> <httpCompression directory="%SystemDrive%\inetpub\temp\IIS Temporary Compressed Files"> <scheme name="gzip" dll="%Windir%\system32\inetsrv\gzip.dll" staticCompressionLevel="9" /> <dynamicTypes> <add mimeType="text/*" enabled="true" /> <add mimeType="message/*" enabled="true" /> <add mimeType="application/x-javascript" enabled="true" /> <add mimeType="application/json" enabled="true" /> <add mimeType="*/*" enabled="false" /> </dynamicTypes> <staticTypes> <add mimeType="text/*" enabled="true" /> <add mimeType="message/*" enabled="true" /> <add mimeType="application/x-javascript" enabled="true" /> <add mimeType="application/atom+xml" enabled="true" /> <add mimeType="application/xaml+xml" enabled="true" /> <add mimeType="*/*" enabled="false" /> </staticTypes> </httpCompression> <urlCompression doStaticCompression="true" doDynamicCompression="true" /> </system.webServer> </configuration> You can find documentation on the httpCompression and urlCompression keys here respectively: http://msdn.microsoft.com/en-us/library/ms690689%28v=vs.90%29.aspx http://msdn.microsoft.com/en-us/library/aa347437%28v=vs.90%29.aspx The httpCompression Element – What and How to compress Basically httpCompression configures what types to compress and how to compress them. It specifies the DLL that handles gzip encoding and the types of documents that are to be compressed. Types are set up based on mime-types which looks at returned Content-Type headers in HTTP responses. For example, I added the application/json to mime type to my dynamic compression types above to allow that content to be compressed as well since I have quite a bit of AJAX content that gets sent to the client. The UrlCompression Element – Enables and Disables Compression The urlCompression element is a quick way to turn compression on and off. By default static compression is enabled server wide, and dynamic compression is disabled server wide. This might be a bit confusing because the httpCompression element also has a doDynamicCompression attribute which is set to true by default, but the urlCompression attribute by the same name actually overrides it. The urlCompression element only has three attributes: doStaticCompression, doDynamicCompression and dynamicCompressionBeforeCache. The doCompression attributes are the final determining factor whether compression is enabled, so it’s a good idea to be explcit! The default for doDynamicCompression='false”, but doStaticCompression="true"! Static Compression is enabled by Default, Dynamic Compression is not Because static compression is very efficient in IIS 7 it’s enabled by default server wide and there probably is no reason to ever change that setting. Dynamic compression however, since it’s more resource intensive, is turned off by default. If you want to enable dynamic compression there are a few quirks you have to deal with, namely that enabling it in ApplicationHost.config doesn’t work. Setting: <urlCompression doDynamicCompression="true" /> in applicationhost.config appears to have no effect and I had to move this element into my local web.config to make dynamic compression work. This is actually a smart choice because you’re not likely to want dynamic compression in every application on a server. Rather dynamic compression should be applied selectively where it makes sense. However, nowhere is it documented that the setting in applicationhost.config doesn’t work (or more likely is overridden somewhere and disabled lower in the configuration hierarchy). So: remember to set doDynamicCompression=”true” in web.config!!! How Static Compression works Static compression works against static content loaded from files on disk. Because this content is static and not bound to change frequently – such as .js, .css and static HTML content – it’s fairly easy for IIS to compress and then cache the compressed content. The way this works is that IIS compresses the files into a special folder on the server’s hard disk and then reads the content from this location if already compressed content is requested and the underlying file resource has not changed. The semantics of serving an already compressed file are very efficient – IIS still checks for file changes, but otherwise just serves the already compressed file from the compression folder. The compression folder is located at: %windir%\inetpub\temp\IIS Temporary Compressed Files\ApplicationPool\ If you look into the subfolders you’ll find compressed files: These files are pre-compressed and IIS serves them directly to the client until the underlying files are changed. As I mentioned before – static compression is on by default and there’s very little reason to turn that functionality off as it is efficient and just works out of the box. The one tweak you might want to do is to set the compression level to maximum. Since IIS only compresses content very infrequently it would make sense to apply maximum compression. You can do this with the staticCompressionLevel setting on the scheme element: <scheme name="gzip" dll="%Windir%\system32\inetsrv\gzip.dll" staticCompressionLevel="9" /> Other than that the default settings are probably just fine. Dynamic Compression – not so fast! By default dynamic compression is disabled and that’s actually quite sensible – you should use dynamic compression very carefully and think about what content you want to compress. In most applications it wouldn’t make sense to compress *all* generated content as it would generate a significant amount of overhead. Scott Fortsyth has a great post that details some of the performance numbers and how much impact dynamic compression has. Depending on how busy your server is you can play around with compression and see what impact it has on your server’s performance. There are also a few settings you can tweak to minimize the overhead of dynamic compression. Specifically the httpCompression key has a couple of CPU related keys that can help minimize the impact of Dynamic Compression on a busy server: dynamicCompressionDisableCpuUsage dynamicCompressionEnableCpuUsage By default these are set to 90 and 50 which means that when the CPU hits 90% compression will be disabled until CPU utilization drops back down to 50%. Again this is actually quite sensible as it utilizes CPU power from compression when available and falling off when the threshold has been hit. It’s a good way some of that extra CPU power on your big servers to use when utilization is low. Again these settings are something you likely have to play with. I would probably set the upper limit a little lower than 90% maybe around 70% to make this a feature that kicks in only if there’s lots of power to spare. I’m not really sure how accurate these CPU readings that IIS uses are as Cpu usage on Web Servers can spike drastically even during low loads. Don’t trust settings – do some load testing or monitor your server in a live environment to see what values make sense for your environment. Finally for dynamic compression I tend to add one Mime type for JSON data, since a lot of my applications send large chunks of JSON data over the wire. You can do that with the application/json content type: <add mimeType="application/json" enabled="true" /> What about Deflate Compression? The default compression is GZip. The documentation hints that you can use a different compression scheme and mentions Deflate compression. And sure enough you can change the compression settings to: <scheme name="deflate" dll="%Windir%\system32\inetsrv\gzip.dll" staticCompressionLevel="9" /> to get deflate style compression. The deflate algorithm produces slightly more compact output so I tend to prefer it over GZip but more HTTP clients (other than browsers) support GZip than Deflate so be careful with this option if you build Web APIs. I also had some issues with the above value actually being applied right away. Changing the scheme in applicationhost.config didn’t show up on the site  right away. It required me to do a full IISReset to get that change to show up before I saw the change over to deflate compressed content. Content was slightly more compressed with deflate – not sure if it’s worth the slightly less common compression type, but the option at least is available. IIS 7 finally makes GZip Easy In summary IIS 7 makes GZip easy finally, even if the configuration settings are a bit obtuse and the documentation is seriously lacking. But once you know the basic settings I’ve described here and the fact that you can override all of this in your local web.config it’s pretty straight forward to configure GZip support and tweak it exactly to your needs. Static compression is a total no brainer as it adds very little overhead compared to direct static file serving and provides solid compression. Dynamic Compression is a little more tricky as it does add some overhead to servers, so it probably will require some tweaking to get the right balance of CPU load vs. compression ratios. Looking at large sites like Amazon, Yahoo, NewEgg etc. – they all use Related Content Code based ASP.NET GZip Caveats HttpWebRequest and GZip Responses © Rick Strahl, West Wind Technologies, 2005-2011Posted in IIS7   ASP.NET  

    Read the article

  • CodePlex Daily Summary for Tuesday, February 08, 2011

    CodePlex Daily Summary for Tuesday, February 08, 2011Popular ReleasesyoutubeFisher: youtubeFisher 3.0 [beta]: What's new: Supports YouTube's new layout Complete internal refactoringNearforums - ASP.NET MVC forum engine: Nearforums v5.0: Version 5.0 of the ASP.NET MVC Forum Engine, containing the following improvements: .NET 4.0 as target framework using ASP.NET MVC 3. All views migrated to Razor for cleaner markup. Alternate template (Layout file) for mobile devices 4 Bug Fixes since Version 4.1 Visit the project Roadmap for more details.fuv: 1.0 release, codename Chopper Joe: features: search/replace :o to open file :s to save file :q to quitASP.NET MVC Project Awesome, jQuery Ajax helpers (controls): 1.7: A rich set of helpers (controls) that you can use to build highly responsive and interactive Ajax-enabled Web applications. These helpers include Autocomplete, AjaxDropdown, Lookup, Confirm Dialog, Popup Form, Popup and Pager html generation optimized new features for the lookup (add additional search data ) live demo went aeroEnhSim: EnhSim 2.3.6 BETA: 2.3.6 BETAThis release supports WoW patch 4.06 at level 85 To use this release, you must have the Microsoft Visual C++ 2010 Redistributable Package installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=A7B7A05E-6DE6-4D3A-A423-37BF0912DB84 To use the GUI you must have the .NET 4.0 Framework installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=9cfb2d51-5ff4-4491-b0e5-b386f32c0992 Changes since 2.3.0 ...TestApi - a library of Test APIs: TestApi v0.6: TestApi v0.6 comes with the following changes: TestApi code development has been moved to Codeplex: Moved TestApi soluton to VS 2010; Moved all source code to Codeplex. All development work is done there now. Fault Injection API: Integrated the unmanaged FaultInjectionEngine.dll COM component in the build; Cleaned up FaultInjectionEngine.dll to build at warning level 4; Implemented “FaultScope” which allows for in-process fault injection; Added automation scripts & sample program; ...AutoLoL: AutoLoL v1.5.5: AutoChat now allows up to 6 items. Items with nr. 7-0 will be removed! News page url's are now opened in the default browser Added a context menu to the system tray icon (thanks to Alex Banagos) AutoChat now allows configuring the Chat Keys and the Modifier Key The recent files list now supports compact and full mode Fix: Swapped mouse buttons are now properly detected Fix: Sometimes the Play button was pressed while still greyed out Champion: Karma Note: You can also run the u...mojoPortal: 2.3.6.2: see release notes on mojoportal.com http://www.mojoportal.com/mojoportal-2362-released.aspx Note that we have separate deployment packages for .NET 3.5 and .NET 4.0 The deployment package downloads on this page are pre-compiled and ready for production deployment, they contain no C# source code. To download the source code see the Source Code Tab I recommend getting the latest source code using TortoiseHG, you can get the source code corresponding to this release here.Rawr: Rawr 4.0.19 Beta: Rawr is now web-based. The link to use Rawr4 is: http://elitistjerks.com/rawr.phpThis is the Cataclysm Beta Release. More details can be found at the following link http://rawr.codeplex.com/Thread/View.aspx?ThreadId=237262 As of the 4.0.16 release, you can now also begin using the new Downloadable WPF version of Rawr!This is a pre-alpha release of the WPF version, there are likely to be a lot of issues. If you have a problem, please follow the Posting Guidelines and put it into the Issue Trac...IronRuby: 1.1.2: IronRuby 1.1.2 is a servicing release that keeps on improving compatibility with Ruby 1.9.2 and includes IronRuby integration to Visual Studio 2010. We decided to drop 1.8.6 compatibility mode in all post-1.0 releases. We recommend using IronRuby 1.0 if you need 1.8.6 compatibility. In this release we fixed several major issues: - problems that blocked Gem installation in certain cases - regex syntax: the parser was replaced with a new one that is much more compatible with Ruby 1.9.2 - cras...Pyxis 2: Production Release: Pyxis 2.0.0.13 - Full Production Release This release of Pyxis 2 offers you a wide range of features: Launch Applications in their own threads & domains Render alpha-blended icons on the desktop Support for SD & USB drives Online App Store Dynamic & Static IP support Menus & Modals Over a dozen GUI controls File selection dialogs Folder selection dialog Application, Bootloader, and Firmware Updating Update Release Notes Much More!Microsoft All-In-One Code Framework: Sample Browser v2 (CTP Release): Sample Browser v2 (CTP Release) http://i3.codeplex.com/Project/Download/FileDownload.aspx?ProjectName=1code&DownloadId=205917MVVM Light Toolkit: MVVM Light Toolkit V3 SP1 (4): There was a small issue with the previous release that caused errors when installing the templates in VS10 Express. This release corrects the error. Only use this if you encountered issues when installing the previous release. No changes in the binaries.Finestra Virtual Desktops: 1.0: Finally the version 1.0 release! Sorry for the long delay since the last release, but I think that you'll find this release to be really smooth, really stable, and a really great enhancement to Windows. New features include: Windows 7 taskbar integration Major performance and usability improvements Redesigned look and feel New name: Finestra Better automatic updating Much faster full-screen switcher Fixes Windows 7 hotkey collisions by default Updated installerFacebook C# SDK: 5.0.2 (BETA): PLEASE TAKE A FEW MINUTES TO GIVE US SOME FEEDBACK: Facebook C# SDK Survey This is third BETA release of the version 5 branch of the Facebook C# SDK. Remember this is a BETA build. Some things may change or not work exactly as planned. We are absolutely looking for feedback on this release to help us improve the final 5.X.X release. This release contains some breaking changes. Particularly with authentication. After spending time reviewing the trouble areas that people are having using th...ASP.NET MVC SiteMap provider: MvcSiteMapProvider 3.0.0 for MVC3: Using NuGet?MvcSiteMapProvider is also listed in the NuGet feed. Learn more... Like the project? Consider a donation!Donate via PayPal via PayPal. ChangelogTargeting ASP.NET MVC 3 and .NET 4.0 Additional UpdatePriority options for generating XML sitemaps Allow to specify target on SiteMapTitleAttribute One action with multiple routes and breadcrumbs Medium Trust optimizations Create SiteMapTitleAttribute for setting parent title IntelliSense for your sitemap with MvcSiteMapSchem...patterns & practices SharePoint Guidance: SharePoint Guidance 2010 Hands On Lab: SharePoint Guidance 2010 Hands On Lab consists of six labs: one for logging, one for service location, and four for application setting manager. Each lab takes about 20 minutes to walk through. Each lab consists of a PDF document. You can go through the steps in the doc to create solution and then build/deploy the solution and run the lab. For those of you who wants to save the time, we included the final solution so you can just build/deploy the solution and run the lab.Value Injecter - object(s) to -> object mapper: 2.3: it lets you define your own convention-based matching algorithms (ValueInjections) in order to match up (inject) source values to destination values. inject from multiple sources in one InjectFrom added ConventionInjectionMobile Device Detection and Redirection: 0.1.11.11: Improvements to Beta Release The following changes have been made in version 0.1.11.11: BlackBerry Version 6 devices (such as the 9800 Torch) are now correctly identified with a dedicated handler. Android powered devices are now correctly identified. Minor change to Provider.cs to improve performance and optimise data sent to 51Degrees.mobi if the option is enabled. GC.collect is no longer called at any point. All garbage collection now happens automatically IMPORTANT CHANGES This rele...TweetSharp: TweetSharp v2.0.0.0 - Preview 10: Documentation for this release may be found at http://tweetsharp.codeplex.com/wikipage?title=UserGuide&referringTitle=Documentation. Note: This code is currently preview quality. Preview 9 ChangesAdded support for trends Added support for Silverlight 4 Elevated WP7 fixes Third Party Library VersionsHammock v1.1.7: http://hammock.codeplex.com Json.NET 4.0 Release 1: http://json.codeplex.comNew Projectsbisolu_sendus: bisolu smsBlack & Scholes: Black & Scholes OptionsCosLabs: CosLabs makes it easy to see the full capabilities of the Cosmos operating system toolkit. CosLabs has a number of experiments to find new and unique uses for Cosmos. It's developed in C#.DeployToAzure: DeployToAzure allows automating deployment of Windows Azure project and making it a part of TFS 2010 build process without using PowerShell and Azure Management CmdLets. Digital: Educational purposesDiscogsNet: DiscogsNet is a .NET library to query the Discogs.com API and parse the Discogs XML data dump files. It's developed in C# and usable from any .NET language. The API of the library is focused on ease of use and intuitiveness.DJME - The jQuery extensions for ASP.NET MVC: DJME - The jQuery extensions for ASP.NET MVC is a lightweight framework which helps you build rich user interfaces for ASP.NET MVC while enjoying great developer productivity. DokuDB: Visio AddIn to document different versions of a databaseDtsConfig Explorer: This project is a windows froms application that helps explore a SSIS dtsconfig file with an easy wayEveryDNS Service: Windows service to automatically send your current IP address to everydns.net for dynamic domains. Automatically monitors and sends IP address changes without having to be logged in. The project is built in C# targeting the .NET 4.0 framework.EvoSim - Evolution Simulation: EvoSim is a pet project to learn aspects of MVVM, WPF/Silverlight, and Parallel Processing features of .NET 4. The goal is to simulate a world filled with creatures that move, eat, reproduce, and die according to Darwinian evolutionary principles. It is tile and turn based.EZStorage: A storage library for XNA based on EasyStorage but abstracting in an XML based file list for each folder, allowing file listings on all folders and details like file creation dates which are no longer possible in XNA 4.0ForeverBell's Snake: A snake game written in VB.NET.Glauca Browser: This is a browser with a webkit core inside.Grauers SharePoint 2010 Custom MasterPage Feature: This is a SharePoint 2010 Custom MastePage feature. Custom Master and custom CSS Blog post about the project: http://www.grauers.net/archive/2011/02/07/build-a-sharepoint-2010-custom-mastepage-with-visual-studio-2010.aspxHamming Code Sample: HamCode demonstrate how the hamming code work, result of coded and decoded data. Shows the benefits of hamming method/codeHydroDesktop Mercurial Test: This is a trial version of the HydroDesktop project (hydrodesktop.codeplex.com) running on Mercurial source code repository. We first want to test whether the data update/download is happening fine before switching the official HydroDesktop website to the new system.LateBindingApi: Creates .Net Proxy Components from COM Type Libraries.Middlesex County College Library Wireless Auto Login: The Middlesex County College Library Wireless Auto Login automatically logs a computer in to the Middlesex County College (Edison, NJ) Library's WifiMobility: Mobility is a small program that reads from a text file. The text file includes everything about the program, right down to that cute little bunny on your desktop! Try Mobility today!OpenMFC: OpenMFC is opensource version of MFC for using with C/C++ compiler without MFC.Orchard Content Sharing: This Orchard module adds content sharing functionality via integration with AddThis.com sharing service.Orchard Wunder Weather Widget: This project is used to maintain the source code for the Wunder Weather widget in the Orchard gallery.Professional Audio Recorder: Professional Audio Recorder is a Audio Recorder for Windows Phone 7Python Node Info for Umbraco: Designed to assist Umbraco macro authors who are writing their macros in Python. Provides a helper macro that, when inserted into a page, will enable the display of an info panel showing the page node properties as represented in Python.Softina.Graphs: Softina.Graphs is a graph managment and algorithm utility. It includes a set of libraries to work with graph processing. It is written using .net framework with c# language and MS Visual Studio 2008. Client applications is created using devexpress components.spangesharp: Application to help people learn c#Visual Studio Private Extension Gallery: Add a new tab in the Visual Studio extension manager to manage private extensions.WCF Home Framework: Home Framework is a service-oriented framework able to facilitate deploy and management of wcf services in a mid-size scenario project.Windows Phone 7 Video Player: This project contains all the source of an application for Windows Phone 7 to consume an RSS Media exposed by our Smooth Streaming Video Player plugin for WordPress (http://smooth.codeplex.com).WOL Shopping List: This is a shoppingList version of WOL's NearMeWP7RSSReader: Updated RSSReader project for Windows Phone 7 using the RTM tools with the October 2010 update.Xen (XNA Extended) Framework: The Xen Framework is a set of libraries that provides and extends XNA 4.0 functionality to make game development easier and faster while producing clean, maintainable code. Xen frees you up to spend more time building your game.

    Read the article

< Previous Page | 85 86 87 88 89 90 91 92  | Next Page >