Search Results

Search found 5619 results on 225 pages for 'starts'.

Page 91/225 | < Previous Page | 87 88 89 90 91 92 93 94 95 96 97 98  | Next Page >

  • Is it possible to view Facebook news feeds page by page rather than loading it all as I scroll?

    - by oscilatingcretin
    If you want to scroll through your Facebook news feed (be it on the main feed, your personal feed, or in groups) to older parts, you have to scroll to the bottom, wait for the ajax load of the next part of the feed, and repeat. The problem with this is that, if you're scrolling down very far, the HTML document just gets bigger and bigger until your browser starts to die due to the overload of resources brought on by added HTML, text, and even images. This pretty much sets a limit to how far back you can scroll. Clicking on months and years on your personal feed has the same effect of cumulatively adding feed segments to the HTML document. I notice that this month/year feature is not available on the main feed and for groups. If there were a way to literally page through the feed so that only a single page's worth of feed data is loaded at a time, that would make scrolling through it much more doable.

    Read the article

  • Ditto (clipboard manager): can't set shortcut of Win+<num>. Get “Error Registering Position 1”

    - by Jeff Kang
    Somone made a Youtube video on Ditto, and that person uses Win+Num to paste items from the list. He put a screenshot of his settings on Google Plus: When I try to do the same, which is to put “1” in the text field of Position 1, and check the “Win” box to add the Windows key as the sole modifier for the shortcut, which will be Win + 1, I get an error in that says “Error Registering Position 1” in a window titled CP_Main: Could it be because Win+Num conflicts with the natural Win+Num shortcut (starts the application pinned to the taskbar in that position, or switches to that program) of Windows 7? Thanks.

    Read the article

  • Windows audio service fails to automatically start after VirtualBox install

    - by humble_coder
    I'm having a completely nonsensical issue in Windows XP SP3. Basically my "Windows Audio" service no longer starts automatically. Despite being set to "Automatic" I have to manually go in and start it. This issue didn't start until the most recent update of VirtualBox, but I can't find anything on the forums related to this specific issue. I've tried reinstalling the RealTek drivers as well, in the event that that had something to do with it. Any assistance is most appreciated! EDIT 1: It is the host's audio that won't start. The update of Virtualbox was merely the "marker" of when these events started occurring. Given it's the only variable/change I'm assuming a correlation.

    Read the article

  • Why is file sharing over internet still working, despite all firewall exceptions for filesharing being disabled?

    - by Triynko
    Every exception in my windows server firewall that starts with "File and Printer Sharing" is disabled (ordered by name, so that includes domain, public (active), and private profiles). The Network and Sharing Center's options for everything except password protected sharing are off. Why would I still be able to access a network share on that server via an address like "\\my.server.com\" over the internet? The firewall is on for all profiles and blocking incoming connections by default. A "netstat -an" command on the server reveals the share connection is occurring over port 445 (SMB). I restarted the client to ensure it was actually re-establishing a new connection successfully. Is the "Password protected sharing: On" option in Network and Sharing Center bypassing the firewall restrictions, or adding some other exception somewhere that I'm missing? EDIT: "Custom" rules are not the problem. It's the "built-in" rules for Terminal Services that was the problem. Can you believe port 445 (File Sharing Port) has to be wide open to the internet to use Terminal Services Licensing?)

    Read the article

  • PuTTY automatically supply password

    - by Kyle Cronin
    I have a situation where I need to have PuTTY (or another SSH client for Windows) automatically log into another machine via SSH. I realize that this isn't a good idea security-wise, but unfortunately I'm constrained by the limitations both on the client and the server. The best solution would be to have a shortcut or script on the desktop that, when double clicked, will connect to the server and automatically log in. Can I do this with PuTTY? I am willing to explore public key authentication, but I'm not sure where the PuTTY key resides or how to copy it to the server, as the app starts automatically upon login.

    Read the article

  • Hidden bootloader

    - by Jack
    I need a bootloader that will work as described: I want my computer to boot Windows, that is my main OS installed on a primary bootable partition. However, I'd like to have a 2-3 second span with blinking cursor, before Windows starts. If I press any key in that period it should launch Ubuntu from a small Truecrypt-encoded partition, upon providing a correct password. In other words I'm looking for a hidden bootloader that would expose itself only when a key is pressed during a certain time. Do you happen to know anything like that?

    Read the article

  • Internet connection issues after installing Windows Phone 8 SDK

    - by Mosquito
    first of all I must admit, that I'm not good in all this network stuff. I am using Windows 8 OS. On my laptop (Lenovo G570) I have installed Windows Phone 8 SDK and shortly after this I started having weird issues with internet connection. When I start my laptop, internet usually works fine, but after a few minutes it starts slowing down so much, that I'm not able to open a single page. Rebooting doesn't work, after several disabling and enabling network adapter, it usually works again for a few minutes and then again it stops. I'm sure it has something to do with Windows Phone 8 SDK, because problems started with this. With SDK there was also installed "vEthernet (Internal Ethernet Port Windows Phone Emulator Internal Switch)" network adapter. It is worth to note that problems occur mostly in my school network, not at home. Both at home and school I am using Wi-Fi connection. I hope the information given are enough to help me. Thanks in advance for any answers!

    Read the article

  • Sound leaks from speaker even when headphones are inserted

    - by instantsetsuna
    I've a Dell Optiplex 960 (which I presume has a speaker inside the tower). This speaker is normally in use whenever I play music (lets call this "tower speaker"), and when I insert my headphones in the 3.5mm jack (of the tower), the tower speaker stops and the music is played through the headphones (an obvious thing to happen). But sometimes, the tower speaker starts playing the music even when the headphones are inserted! So, the music is played through both of them! This gets quite embarrassing. So, my question is - Is there a way to turn off this "tower speaker"? EDIT : I'm using Windows XP

    Read the article

  • How to make sure clients update their browser cache when my website is updated?

    - by user64204
    I am using the HTTP 1.1 Cache-Control header to implement client-side caching. Since I update my website only once a month I would like the CSS and JS files to be cached for 30 days with Cache-Control: max-age=2592000. The problem is that the 30-day period defined by Cache-Control doesn't coincide with the website update cycle, it starts from the moment the users visit the site and ends 30 days later, which means an update could occur in the meantime and users would be running with outdated content for a while, which could break the rendering of the website if for instance the HTML and CSS no longer match. How can I perform client-side caching of content for periods of several days but somehow get users to refresh their CSS/JS files after the website has been updated? One solution I could think of is that if website updates can be schedule, the max-age returned by the server could be decreased every day accordingly so that no matter when people visit the website, the end of caching period would coincide with the update of the website, but changing the server configuration every day goes against one of my sysadmin principles (once it's running, don't touch it).

    Read the article

  • Set up Ubuntu in Virtualbox to have static ip

    - by Don H
    I frequently work in different locations, and need to have a virtualbox version of Ubuntu server running locally. While I was at home getting it set up, I was able to ssh into the server using the locally allocated IP address. However, now that I'm elsewhere, ifconfig is still showing the old 10.0.x.x ip address, but instead of being in the 10.0.x.x space, my laptop's ip starts with 192.168.x.x With that in mind, if there a straightforward way to set up the virtual box Ubuntu server in such a way that I can just connect using "ssh servername" regardless of it's ip address?

    Read the article

  • Windows 2008 R2 on ESXi 4.1 cpu utilization kernel high

    - by MK.
    I have a Win2k8 guest running on ESXi 4.1. The host has 12 cores and the problem happens even if the guest is the only VM on the host. We have 4 cores dedicated to the guest. We noticed that network starts chocking when the CPU load goes up. After some testing we noticed that when running a simple CPU hogging tool set up to run 3 threads at 100% the regular CPU load goes to 75% like it should and the "kernel times" graph in task manager goes up to 25%. My intuition tells me that the network problem and kernel times problem are the same. This is confirmed by another similar VM we created on the same host which doesn't have either of the problems. VMWare tools are obviously installed. The nic is e1000. What else can we do to troubleshoot this?

    Read the article

  • Starting VM as an executable with as low overhead as possible

    - by Robert Koritnik
    Is there a solution to create a virtual machine and start it by having an executable file, that will start the machine? If possible to start as quickly as possible. Strange situation? Not at all. Read on... Real life scenario Since we can't have domain controller on a non-server OS it would be nice to have domain controller in an as thin as possible machine (possibly Samba or similar because we'd like to make it startup as quickly as possible - in a matter of a few seconds) packed in a single executable. We could then configure our non-server OS to run the executable when it starts and before user logs in. This would make it possible to login into a domain.

    Read the article

  • What is making iTunes stop playing when my computer idles?

    - by OwenP
    I've got a rare weekend with nothing to do, so I'm getting some housework done. I have iTunes playing for some background noise. Every 20 minutes or so, it just stops playing; if I move the mouse it starts again. I'm on Windows 7 64-bit. My power settings have my monitor turning off at 10 minutes and hard drives at 20. Both sleep and hibernate are disabled. "Aha!", you say, "Clearly when the hard drive is turned off iTunes is stopping!" Not so. I fiddled with the settings and changed them to make the hard drive sleep in 5 minutes, and iTunes kept playing for the 7 minutes I watched it. I'm currently trying to see what happens if I set the hard drive to never turn off, but I'd prefer to leave it at 20 minutes to save minor amounts of energy. What other settings could be the culprit?

    Read the article

  • Terminal Server Spoolsv.exe error

    - by Voyager
    We are having a terminal server ibm x3650 with 8 gb of RAM. On many occasions, at least once in a day, we get the error "The instruction at "0x7c8199b2" refrenced memory at "0x9ddc2ade". The memory could not be "read". Click OK to terminate the program. Click on CANCEL to debug the program. I have surfed very many sites, microsoft included, but none of them have been able to give conclusive solution for ending this problem. When we press on ok or cancel, then our ERP application (VB-MS SQL) starts to work normally. till such time the message is there, all our reports are hanged (Business Objects reports). We have already installed all the drivers of printers on the TS. Can anyone help?

    Read the article

  • How to restrict windows service to X cores?

    - by Martinnj
    I'm currently trying ot figure out a decent/nice way of determening what core(s) a single service should run on, in Windows Server 2008. I'm aware that for procceses there is two ways to do it: set affinity through task manager after proccess is launched. use "start /AFFINITY 0x1" or similar bitmask However this does not seem to work very well with services. When i try to launch the exe that the service will also run (the one that needs restriction) it just spawns a new commandline (and starts the process) but the process terminates shortly after. Does anyone here know how to do a similar trick for services? It is not important what core it is running on, it just needs to be restricted to only one. And preferably it should be something that can be automated, so we do not have to interfere when there is a server restart.

    Read the article

  • perform command substitution in MS-DOS

    - by wiggin200
    I wonder how you can make in MS-DOS a command substitution Command substitution is a very powerful concept of the UNIX shell. It is used to insert the output of one command into a second command. E.g. with an assignment: $ today=$(date) # starts the "date" command, captures its output $ echo "$today" Mon Jul 26 13:16:02 MEST 2004 This can also be used with other commands besides assignments: $ echo "Today is $(date +%A), it's $(date +%H:%M)" Today is Monday, it's 13:21 This calls the date command two times, the first time to print the week-day, the second time for the current time. I need to know to do that in MS-DOS, (I already know that there is a way to perform something like that using as part of the for command, but this way is much more obfuscated and convoluted

    Read the article

  • Vista Home Premium won't upload

    - by longhairedsi
    Hi, I have a sony vaio laptop(VGN-FW31J) running windows Vista Home Premium . I've had it over a year and file upload in a browser has never worked on any website in any browser(IE, Firefox, Chrome). I can select a file and the upload starts running but I always get a timeout. Sometimes it has worked once out of many attempts but only if the file is very small( < 50k). FTP does work. I've tried the following: Disabling anti virus Disabling firewall Can anyone help me here? i'm wondering if this is a vista problem or a vaio problem. Cheers

    Read the article

  • Stopping/Starting windows services

    - by Geek
    I have four windows services which start up automatically when the machine starts. There after, I want to restart those services every 8 hours in a particular order. For eg. Stop s1,s2,s3,s4 and than restart them in some other order like s4,s3,s2,s1. The condition is that I should wait for each service to stop completely before I stop another one. I would want to write a .BAT or some script. Is it possible to define a CRON for 8 hours, this is not there in Advanced tasks ? Can I do it using windows scheduler ? Please suggest. thanks in advance.

    Read the article

  • VirtualBox VRDP server doesn't start on Windows

    - by quanticle
    I've installed VirtualBox 4.1.8 on a Windows 7 Ultimate host system. I've set up an Arch Linux VM that starts just fine from the VirtualBox GUI. However, when I try to start it with VBoxHeadless --startvm <vm_name> it prints the following Oracle VM VirtualBox Headless Interface 4.1.6 (C) 2008-2011 Oracle Corporation All rights reserved. and then it just sits there. I never get the VRDE server is listening on port 3389 message like when I start a headless VM on a Linux machine. Do I have to configure anything else in order to get the VRDE server to run?

    Read the article

  • Reinstall default apps on Galaxy S3 before updating to Jelly Bean [migrated]

    - by Bruno-P
    I want to update my Galaxy S3 to Jelly Bean but after downloading the firmware using Kies, it starts updating, but then it stops with a "dead" Android with a red triangle icon. I think it's because I have removed some default apps like ChatOn and Yahoo widgets. Is there any way to get them back or to install the official Jelly Bean update without a factory reset? I don't want to reinstall my apps again and lose my settings each time I need to update the OS (I also don't want bloatware apps that are pre-installed). Any ideas?

    Read the article

  • Resources started with slash .htaccess redirection

    - by Pawka
    I have moved old version of webpage to some subdirectory: http://www.smth.com/old/. But all resources (images, css, etc.) in HTML are linked with slash symbol at the start. So browser still tries to load them from root path. For example old/test.html contains: <img src="/images/lma_logo.ico" /> <!-- not working !--> <img src="images/lma_logo.ico" /> <!-- working !--> How can I rewrite ulrs to load resources from the "old" dir if urls still starts with "/"?

    Read the article

  • How to automount a Truecrypt volume before login in Windows 7?

    - by nonoitall
    I have an external hard drive containing all my documents, and it is encrypted with a password via Truecrypt. I'd like my desktop computer at home to automatically mount the volume prior to my logging in (so that it can be used as my user folder) without asking me for a password. (Yes, the password can be saved in plain text on my desktop's hard drive - that's okay.) For the life of me, I can't figure out a way to do this that actually works though. Tried using the Task Scheduler to schedule a mount when the computer starts up, and it works, but the volume is only accessible by my user account after I log in. (Haven't tried every combination of users/options for the scheduled task, so maybe there's something else there I need to try.) Also tried adding a startup script for my user account that runs on login, which evidently is too late to set up the user's profile folder. Anybody ever successfully achieve this or something like it?

    Read the article

  • bursty streaming video

    - by broiyan
    What is the cause and solution for the bursty streaming media problem? Example: when streaming from youtube, audio (and video) will pause and start intermittently. When it starts it will be bursty, that is, it will play several seconds of sound in just a fraction of a second. Normal sounds are rendered unrecognizable. Then it may pause and after a few seconds, resume with another burst. The video seems to burst along with the audio. This was observed on Ubuntu 12.04 with Google Chrome.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • MySQL Cluster transaction isolation level - READ_COMMITTED

    - by Doori Bar
    I'm learning by mostly reading the documentation. Unfortunately, http://dev.mysql.com/doc/refman/5.1/en/set-transaction.html#isolevel_read-committed doesn't say anything, while it says everything. Confused? Me too. ndb engine supports only "READ_COMMITTED" transaction isolation level. A. It starts by saying "sets and reads its own fresh snapshot", which I translate to: The transaction is having a separated 'zone' which whatever it stores there - is what it reads back. B. While out-side of the transaction, the old-values are unlocked. C. It continues with: "for locking reads" sentence - No idea what it means. Question: they claim only READ_COMMITTED transaction isolation level is supported, but while handling a BLOB or a TEXT, they say the isolation is now "locked for reading" too. So is it a contradiction? can a transaction LOCK for reading just as well while handling something other than BLOB/TEXT? (such as integers)

    Read the article

< Previous Page | 87 88 89 90 91 92 93 94 95 96 97 98  | Next Page >