Search Results

Search found 5619 results on 225 pages for 'starts'.

Page 91/225 | < Previous Page | 87 88 89 90 91 92 93 94 95 96 97 98  | Next Page >

• Fullscreen Photo/Video Slideshow App?

  - by Michael Stum

  I have a folder that contains a lot of subfolders which include photos and/or videos. Is there any free application that would display them in a random slideshow? It's something I want to run on a PC mounted on a wall. I point it to that folder and it starts displaying it, with some random/nice transitions. No need for anything more fancy, except maybe Previous/Next controls. Edit: Just a quick clarification. Those pictures change all the time, and there are many of them. It's supposed to be in a store to display product pictures, so it's not like someone is actively watching the whole show. Currently, there are around 150,000 pictures or videos.

  Read the article

• Internet connection issues after installing Windows Phone 8 SDK

  - by Mosquito

  first of all I must admit, that I'm not good in all this network stuff. I am using Windows 8 OS. On my laptop (Lenovo G570) I have installed Windows Phone 8 SDK and shortly after this I started having weird issues with internet connection. When I start my laptop, internet usually works fine, but after a few minutes it starts slowing down so much, that I'm not able to open a single page. Rebooting doesn't work, after several disabling and enabling network adapter, it usually works again for a few minutes and then again it stops. I'm sure it has something to do with Windows Phone 8 SDK, because problems started with this. With SDK there was also installed "vEthernet (Internal Ethernet Port Windows Phone Emulator Internal Switch)" network adapter. It is worth to note that problems occur mostly in my school network, not at home. Both at home and school I am using Wi-Fi connection. I hope the information given are enough to help me. Thanks in advance for any answers!

  Read the article

• searchd under runit continues writing to the runit's log

  - by Eugene

  searchd (Sphinx) run file: #!/bin/sh set -e APP_PATH=/srv/application TARGET_USER=user exec chpst -u $TARGET_USER /usr/bin/searchd --pidfile --nodetach --config $APP_PATH/current/config/production.sphinx.conf tail /var/log/sphinx/current 2014-06-07_18:13:56.87885 precached 9 indexes in 0.497 sec 2014-06-07_18:13:57.13740 precached 9 indexes in 0.497 sec 2014-06-07_18:13:57.88113 precached 9 indexes in 0.497 sec 2014-06-07_18:13:57.89167 precached 9 indexes in 0.497 sec 2014-06-07_18:13:59.75555 precached 9 indexes in 0.497 sec 2014-06-07_18:13:59.81554 precached 9 indexes in 0.497 sec 2014-06-07_18:14:00.33466 precached 9 indexes in 0.497 sec ... it continues to write the same line until sv stop sphinx ... Everything works fine, seachd starts and responds to the queries. But how to make logs to be less repetitive? When I start Sphinx manually it prints the "precached 9 indexes" just once.

  Read the article

• Set up Ubuntu in Virtualbox to have static ip

  - by Don H

  I frequently work in different locations, and need to have a virtualbox version of Ubuntu server running locally. While I was at home getting it set up, I was able to ssh into the server using the locally allocated IP address. However, now that I'm elsewhere, ifconfig is still showing the old 10.0.x.x ip address, but instead of being in the 10.0.x.x space, my laptop's ip starts with 192.168.x.x With that in mind, if there a straightforward way to set up the virtual box Ubuntu server in such a way that I can just connect using "ssh servername" regardless of it's ip address?

  Read the article

• Hidden bootloader

  - by Jack

  I need a bootloader that will work as described: I want my computer to boot Windows, that is my main OS installed on a primary bootable partition. However, I'd like to have a 2-3 second span with blinking cursor, before Windows starts. If I press any key in that period it should launch Ubuntu from a small Truecrypt-encoded partition, upon providing a correct password. In other words I'm looking for a hidden bootloader that would expose itself only when a key is pressed during a certain time. Do you happen to know anything like that?

  Read the article

• Terminal Server Spoolsv.exe error

  - by Voyager

  We are having a terminal server ibm x3650 with 8 gb of RAM. On many occasions, at least once in a day, we get the error "The instruction at "0x7c8199b2" refrenced memory at "0x9ddc2ade". The memory could not be "read". Click OK to terminate the program. Click on CANCEL to debug the program. I have surfed very many sites, microsoft included, but none of them have been able to give conclusive solution for ending this problem. When we press on ok or cancel, then our ERP application (VB-MS SQL) starts to work normally. till such time the message is there, all our reports are hanged (Business Objects reports). We have already installed all the drivers of printers on the TS. Can anyone help?

  Read the article

• get text from a certain <tr> tag

  - by WideBlade

  Is there a way to get the text in a dynamic way from a certain <tr> tag in the page? e.g. I've a page with a <tr> with the value "a1". I'd like to get only the text from this <tr> tag, and echo it into the page. is this possible? here is the HTML: <html><tr id='ieconn2' > <td><table width='100%'><tr><td valign='top'><table width='100%'><tr><td><script type="text/javascript"><!-- google_ad_client = "pub-4503439170693445"; /* 300x250, created 7/21/10 */ google_ad_slot = "7608120147"; google_ad_width = 300; google_ad_height = 250; //--> </script> <script type="text/javascript" src="http://pagead2.googlesyndication.com/pagead/show_ads.js"> </script><br>When Marshall and Lily fear they will never get pregnant, they see a specialist who can hopefully help move the process along. Meanwhile, Robin starts her new job.<br><br><b>Source: </b>CBS <br>&nbsp;</td></tr><tr><td><b>There are no foreign summaries for this episode:</b> <a href='/edit/shows/3918/episode_foreign_summary/?eid=1065002553&season=6'>Contribute</a></td></tr><tr><td><b>English Recap Available: </b> <a href='/How_I_Met_Your_Mother/episodes/1065002553?show_recap=1'>View Here</a></td></tr></table></td><td valign='top' width='250'><div align='left'> <img alt='How I Met Your Mother season 6 episode 13' src="http://images.tvrage.com/screencaps/20/3918/1065002553.jpg" width="248" border='0' > </div><div align='center'><a href='/How_I_Met_Your_Mother/episodes/1065002553?gallery=1'>6 gallery images</a></div></td></tr></table></td></tr><tr> <td background='/_layout_v3/buttons/title.jpg' height='39' width='631' align='center'> <table width='100%' cellpadding='0' cellspacing='0' style='margin: 1px 1px 1px 1px;'> <tr> <td align='left' style='cursor: pointer;' onclick="SwitchHeader('ieconn3','iehide3','26')" width='90'>&nbsp;<span style='font-size: 15px; font-weight: bold; color: black; padding-left: 8px;' id='iehide3'><img src='/_layout_v3/misc/minus.gif' width='26'></span></td> <td align='center' style='cursor: pointer;' onclick="SwitchHeader('ieconn3','iehide3','26')" ><h5 class='nospace'>Sponsored Links</h5><a name=''></a></td> <td align='left' width='90' >&nbsp;</td></tr></table></td> </tr></html> All I want to get is this text: "When Marshall and Lily fear they will never get pregnant, they see a specialist who can hopefully help move the process along. Meanwhile, Robin starts her new job. "

  Read the article

• How to restrict windows service to X cores?

  - by Martinnj

  I'm currently trying ot figure out a decent/nice way of determening what core(s) a single service should run on, in Windows Server 2008. I'm aware that for procceses there is two ways to do it: set affinity through task manager after proccess is launched. use "start /AFFINITY 0x1" or similar bitmask However this does not seem to work very well with services. When i try to launch the exe that the service will also run (the one that needs restriction) it just spawns a new commandline (and starts the process) but the process terminates shortly after. Does anyone here know how to do a similar trick for services? It is not important what core it is running on, it just needs to be restricted to only one. And preferably it should be something that can be automated, so we do not have to interfere when there is a server restart.

  Read the article

• perform command substitution in MS-DOS

  - by wiggin200

  I wonder how you can make in MS-DOS a command substitution Command substitution is a very powerful concept of the UNIX shell. It is used to insert the output of one command into a second command. E.g. with an assignment: $ today=$(date) # starts the "date" command, captures its output $ echo "$today" Mon Jul 26 13:16:02 MEST 2004 This can also be used with other commands besides assignments: $ echo "Today is $(date +%A), it's $(date +%H:%M)" Today is Monday, it's 13:21 This calls the date command two times, the first time to print the week-day, the second time for the current time. I need to know to do that in MS-DOS, (I already know that there is a way to perform something like that using as part of the for command, but this way is much more obfuscated and convoluted

  Read the article

• Windows 2008 R2 on ESXi 4.1 cpu utilization kernel high

  - by MK.

  I have a Win2k8 guest running on ESXi 4.1. The host has 12 cores and the problem happens even if the guest is the only VM on the host. We have 4 cores dedicated to the guest. We noticed that network starts chocking when the CPU load goes up. After some testing we noticed that when running a simple CPU hogging tool set up to run 3 threads at 100% the regular CPU load goes to 75% like it should and the "kernel times" graph in task manager goes up to 25%. My intuition tells me that the network problem and kernel times problem are the same. This is confirmed by another similar VM we created on the same host which doesn't have either of the problems. VMWare tools are obviously installed. The nic is e1000. What else can we do to troubleshoot this?

  Read the article

• Stopping/Starting windows services

  - by Geek

  I have four windows services which start up automatically when the machine starts. There after, I want to restart those services every 8 hours in a particular order. For eg. Stop s1,s2,s3,s4 and than restart them in some other order like s4,s3,s2,s1. The condition is that I should wait for each service to stop completely before I stop another one. I would want to write a .BAT or some script. Is it possible to define a CRON for 8 hours, this is not there in Advanced tasks ? Can I do it using windows scheduler ? Please suggest. thanks in advance.

  Read the article

• User and Key Press Issues with Putty

  - by DizzyDoo

  Ubuntu Server newbie here, got some annoying issues with remote accessing my box with Putty. When I create a user and then login as that user, the terminal always starts with just '#' and not 'user@hostname:~#' which isn't useful where I want to see where I've changed directory too, like I can normally. Also, when logged in as a user, I can't press the cursor keys to move the caret (blinking thing) around, or press up to see previously executed commands. Instead it gives me this representation of the button pressed: ^[[D ^[[A ^[[B ^[[C. Pressing Delete, too, gives me ^[[3~. This is all strange to me, because when logged in as root, it all works fine. I'm hoping this is just something I've accidentally changed in Putty, or added the user wrongly, or perhaps just got caps lock on. Thanks.

  Read the article

• How to automount a Truecrypt volume before login in Windows 7?

  - by nonoitall

  I have an external hard drive containing all my documents, and it is encrypted with a password via Truecrypt. I'd like my desktop computer at home to automatically mount the volume prior to my logging in (so that it can be used as my user folder) without asking me for a password. (Yes, the password can be saved in plain text on my desktop's hard drive - that's okay.) For the life of me, I can't figure out a way to do this that actually works though. Tried using the Task Scheduler to schedule a mount when the computer starts up, and it works, but the volume is only accessible by my user account after I log in. (Haven't tried every combination of users/options for the scheduled task, so maybe there's something else there I need to try.) Also tried adding a startup script for my user account that runs on login, which evidently is too late to set up the user's profile folder. Anybody ever successfully achieve this or something like it?

  Read the article

• MySQL Cluster transaction isolation level - READ_COMMITTED

  - by Doori Bar

  I'm learning by mostly reading the documentation. Unfortunately, http://dev.mysql.com/doc/refman/5.1/en/set-transaction.html#isolevel_read-committed doesn't say anything, while it says everything. Confused? Me too. ndb engine supports only "READ_COMMITTED" transaction isolation level. A. It starts by saying "sets and reads its own fresh snapshot", which I translate to: The transaction is having a separated 'zone' which whatever it stores there - is what it reads back. B. While out-side of the transaction, the old-values are unlocked. C. It continues with: "for locking reads" sentence - No idea what it means. Question: they claim only READ_COMMITTED transaction isolation level is supported, but while handling a BLOB or a TEXT, they say the isolation is now "locked for reading" too. So is it a contradiction? can a transaction LOCK for reading just as well while handling something other than BLOB/TEXT? (such as integers)

  Read the article

• Vista Home Premium won't upload

  - by longhairedsi

  Hi, I have a sony vaio laptop(VGN-FW31J) running windows Vista Home Premium . I've had it over a year and file upload in a browser has never worked on any website in any browser(IE, Firefox, Chrome). I can select a file and the upload starts running but I always get a timeout. Sometimes it has worked once out of many attempts but only if the file is very small( < 50k). FTP does work. I've tried the following: Disabling anti virus Disabling firewall Can anyone help me here? i'm wondering if this is a vista problem or a vaio problem. Cheers

  Read the article

• Ditto (clipboard manager): can't set shortcut of Win+<num>. Get “Error Registering Position 1”

  - by Jeff Kang

  Somone made a Youtube video on Ditto, and that person uses Win+Num to paste items from the list. He put a screenshot of his settings on Google Plus: When I try to do the same, which is to put “1” in the text field of Position 1, and check the “Win” box to add the Windows key as the sole modifier for the shortcut, which will be Win + 1, I get an error in that says “Error Registering Position 1” in a window titled CP_Main: Could it be because Win+Num conflicts with the natural Win+Num shortcut (starts the application pinned to the taskbar in that position, or switches to that program) of Windows 7? Thanks.

  Read the article

• Starting VM as an executable with as low overhead as possible

  - by Robert Koritnik

  Is there a solution to create a virtual machine and start it by having an executable file, that will start the machine? If possible to start as quickly as possible. Strange situation? Not at all. Read on... Real life scenario Since we can't have domain controller on a non-server OS it would be nice to have domain controller in an as thin as possible machine (possibly Samba or similar because we'd like to make it startup as quickly as possible - in a matter of a few seconds) packed in a single executable. We could then configure our non-server OS to run the executable when it starts and before user logs in. This would make it possible to login into a domain.

  Read the article

• Add folder name to beginning of filename - getting multiple renames

  - by Flibble Wibble

  I've used dbenham's excellent response to the question of how to add the folder name to the beginning of a filename in a cmd script. @echo off pushd "Folder" for /d %%D in (*) do ( for %%F in ("%%~D\*") do ( for %%P in ("%%F\..") do ( ren "%%F" "%%~nxP_%%~nxF" ) ) ) popd What I'm finding is that seemingly randomly (though it probably isn't) sometimes the script will run through several child folders and rename correctly but then it gets to a folder where it gets stuck in a loop and starts adding the folder name repeatedly to the file inside. I have 90,000 files in 300 folders to rename this weekend. Any chance you can guess the cause? PS: Is there a maximum number of files that are acceptable in each folder?

  Read the article

• My 386sx refuses to start in cold days

  - by Armadillo

  My old computer refuses to start in cold days. So, in really hot days (about 40ºC / 104ºF ) or even hotter, this PC usually starts, but in cold days, it wont. When the temperature is not in the "sweet-spot" the power light turns on for an half a second and then the computer turns off. But when it's really cold, not even the power light turns on, nor even a blink. Sometimes I use an Hair dryer, pointed directly to the PSU and that works great. 5 to 10 minutes is enough, depending on the ambient temperature. I think something is going wrong in my AT power supply. I can't replace this PSU for another because it has a non-standard size and connectors to power the motherboard. Does anybody have a clue about what it's failing in my PSU, so I can change that component (resistor, capacitor, ??, etc) and rock on with my 80386? Thanks

  Read the article

• USB Mouse doesn't work after turning on Laptop

  - by Barry

  I have a USB mouse attached to my laptop which does not work when I switch my laptop on. I have to unplug it and plug it back in before it works. When I do this no driver installation occurs (presumably because it has already done this) the usual beep sound does occur and the mouse starts working again. If my laptop goes to sleep I can move the mouse and the laptop comes back to life. In fact it works perfectly apart from this annoying niggle on startup. Can anyone shed any light as to why I have to keep unplugging and plugging my mouse back on startup? I am running Windows 7 Home Premium Service Pack 1 (64 bit) on a Toshiba Satellite L755-1LL Laptop.

  Read the article

• VirtualBox VRDP server doesn't start on Windows

  - by quanticle

  I've installed VirtualBox 4.1.8 on a Windows 7 Ultimate host system. I've set up an Arch Linux VM that starts just fine from the VirtualBox GUI. However, when I try to start it with VBoxHeadless --startvm <vm_name> it prints the following Oracle VM VirtualBox Headless Interface 4.1.6 (C) 2008-2011 Oracle Corporation All rights reserved. and then it just sits there. I never get the VRDE server is listening on port 3389 message like when I start a headless VM on a Linux machine. Do I have to configure anything else in order to get the VRDE server to run?

  Read the article

• What is making iTunes stop playing when my computer idles?

  - by OwenP

  I've got a rare weekend with nothing to do, so I'm getting some housework done. I have iTunes playing for some background noise. Every 20 minutes or so, it just stops playing; if I move the mouse it starts again. I'm on Windows 7 64-bit. My power settings have my monitor turning off at 10 minutes and hard drives at 20. Both sleep and hibernate are disabled. "Aha!", you say, "Clearly when the hard drive is turned off iTunes is stopping!" Not so. I fiddled with the settings and changed them to make the hard drive sleep in 5 minutes, and iTunes kept playing for the 7 minutes I watched it. I'm currently trying to see what happens if I set the hard drive to never turn off, but I'd prefer to leave it at 20 minutes to save minor amounts of energy. What other settings could be the culprit?

  Read the article

• Bootcamp: setup of Windows 7 (64 bit) hanging at "disk.sys"

  - by Skade

  I am having trouble getting Windows 7 Professional (64bit) to install on a Macbook Pro (late 2010 model). The installer hangs when loading the setup from disk. When restarting, I get an option to boot Windows from disk. The installer then starts loading files from disk and suddenly hangs. Using "Safe Mode" (from the advanced menu), it tells me that the installer hangs when loading "disk.sys". The installation is made on a fresh Bootcamp partition, the disk uses GPT. Has anyone seen this before and maybe found a solution?

  Read the article

• Network tries to reindentify itself now and then

  - by Don Young

  When the computer starts up it connects itself to the router (ZTE 4G router) automatically, but after I have surfed the web for a while, it tries to identify itself, meaning you get that little blue circle next to the little screen at the corner. When browsing it does not cause any problems, but if I'm streaming a video the video will then stop, I'll have to refresh the page to make the video start again. And if I'm playing a game, LoL for example, the game will freeze for about 2 seconds then continue again (due to lost connection to the internet). I have no virus on my computer, although I had before. I have reset my router, restarted my computer, updated my ethernet driver, checked so that the IPv4 is set on automatic and tried different router channels. I have had this router for a few months and the problem just started recently. Here is the ipconfig screen:

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

< Previous Page | 87 88 89 90 91 92 93 94 95 96 97 98  | Next Page >