Search Results

Search found 5619 results on 225 pages for 'starts'.

Page 91/225 | < Previous Page | 87 88 89 90 91 92 93 94 95 96 97 98  | Next Page >

• Monitor windows startup process

  - by vlad-ardelean

  My win7 starts up pretty slow lately. I think it's some kind of malware, but my antivirus software doesn't pick up anything. How could i monitor the startup processes myself? It seems to me like either something's doing a lot of work, or some important windows process hangs for a while, since there's stuff that i can do while it's starting (like start a console), and stuff that i can't do (like execute the systeminfo command in the console) So if you happen to know how i can monitor my system, that would be great. Thx, you guys rule.

  Read the article

• Starting VMs with an executable with as low overhead as possible

  - by Robert Koritnik

  Is there a solution to create a virtual machine and start it by having an executable file, that will start the machine? If possible to start as quickly as possible. Strange situation? Not at all. Read on... Real life scenario Since we can't have domain controller on a non-server OS it would be nice to have domain controller in an as thin as possible machine (possibly Samba or similar because we'd like to make it startup as quickly as possible - in a matter of a few seconds) packed in a single executable. We could then configure our non-server OS to run the executable when it starts and before user logs in. This would make it possible to login into a domain.

  Read the article

• Is it possible to view Facebook news feeds page by page rather than loading it all as I scroll?

  - by oscilatingcretin

  If you want to scroll through your Facebook news feed (be it on the main feed, your personal feed, or in groups) to older parts, you have to scroll to the bottom, wait for the ajax load of the next part of the feed, and repeat. The problem with this is that, if you're scrolling down very far, the HTML document just gets bigger and bigger until your browser starts to die due to the overload of resources brought on by added HTML, text, and even images. This pretty much sets a limit to how far back you can scroll. Clicking on months and years on your personal feed has the same effect of cumulatively adding feed segments to the HTML document. I notice that this month/year feature is not available on the main feed and for groups. If there were a way to literally page through the feed so that only a single page's worth of feed data is loaded at a time, that would make scrolling through it much more doable.

  Read the article

• Firefox: How to get my home page in new tabs, instead of the recent sites 'tiles' thing :(

  - by Sheldon Pinkman

  In Firefox 25 (running on Windows 7), I have the following Startup settings: When Firefox starts = 'Show my home page' Home Page = (URL of the site I want) So when I click on the Home button, I get the right page. That's all good. However, when I open a new tab, I get the 'recently visited websites tiles' screen, i.e. this: Screenshot. How do I get Firefox to show my Home Page in new tabs as well?? Note: when I open a new Window, it works OK. I'm getting the Home Page there. The problem is just with New Tab!

  Read the article

• Why is file sharing over internet still working, despite all firewall exceptions for filesharing being disabled?

  - by Triynko

  Every exception in my windows server firewall that starts with "File and Printer Sharing" is disabled (ordered by name, so that includes domain, public (active), and private profiles). The Network and Sharing Center's options for everything except password protected sharing are off. Why would I still be able to access a network share on that server via an address like "\\my.server.com\" over the internet? The firewall is on for all profiles and blocking incoming connections by default. A "netstat -an" command on the server reveals the share connection is occurring over port 445 (SMB). I restarted the client to ensure it was actually re-establishing a new connection successfully. Is the "Password protected sharing: On" option in Network and Sharing Center bypassing the firewall restrictions, or adding some other exception somewhere that I'm missing? EDIT: "Custom" rules are not the problem. It's the "built-in" rules for Terminal Services that was the problem. Can you believe port 445 (File Sharing Port) has to be wide open to the internet to use Terminal Services Licensing?)

  Read the article

• Remote viewing on a Linux server?

  - by Zeno

  I have a Slackware Linux server that doesn't have a monitor. It doesn't run any GUIs. Is there a way to remotely access the screen? I always use SSH, but there are times where the SSH services fails and I can't do anything (nor even tell what the problem is). I use Teamviewer from my Windows computer to other PCs, but is there anything I can use to remotely view this from a Windows machine? I also want to see what it's doing at boot, before the SSH service starts.

  Read the article

• bursty streaming video

  - by broiyan

  What is the cause and solution for the bursty streaming media problem? Example: when streaming from youtube, audio (and video) will pause and start intermittently. When it starts it will be bursty, that is, it will play several seconds of sound in just a fraction of a second. Normal sounds are rendered unrecognizable. Then it may pause and after a few seconds, resume with another burst. The video seems to burst along with the audio. This was observed on Ubuntu 12.04 with Google Chrome.

  Read the article

• Reinstall default apps on Galaxy S3 before updating to Jelly Bean [migrated]

  - by Bruno-P

  I want to update my Galaxy S3 to Jelly Bean but after downloading the firmware using Kies, it starts updating, but then it stops with a "dead" Android with a red triangle icon. I think it's because I have removed some default apps like ChatOn and Yahoo widgets. Is there any way to get them back or to install the official Jelly Bean update without a factory reset? I don't want to reinstall my apps again and lose my settings each time I need to update the OS (I also don't want bloatware apps that are pre-installed). Any ideas?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• What is making iTunes stop playing when my computer idles?

  - by OwenP

  I've got a rare weekend with nothing to do, so I'm getting some housework done. I have iTunes playing for some background noise. Every 20 minutes or so, it just stops playing; if I move the mouse it starts again. I'm on Windows 7 64-bit. My power settings have my monitor turning off at 10 minutes and hard drives at 20. Both sleep and hibernate are disabled. "Aha!", you say, "Clearly when the hard drive is turned off iTunes is stopping!" Not so. I fiddled with the settings and changed them to make the hard drive sleep in 5 minutes, and iTunes kept playing for the 7 minutes I watched it. I'm currently trying to see what happens if I set the hard drive to never turn off, but I'd prefer to leave it at 20 minutes to save minor amounts of energy. What other settings could be the culprit?

  Read the article

• Stopping/Starting windows services

  - by Geek

  I have four windows services which start up automatically when the machine starts. There after, I want to restart those services every 8 hours in a particular order. For eg. Stop s1,s2,s3,s4 and than restart them in some other order like s4,s3,s2,s1. The condition is that I should wait for each service to stop completely before I stop another one. I would want to write a .BAT or some script. Is it possible to define a CRON for 8 hours, this is not there in Advanced tasks ? Can I do it using windows scheduler ? Please suggest. thanks in advance.

  Read the article

• Sound leaks from speaker even when headphones are inserted

  - by instantsetsuna

  I've a Dell Optiplex 960 (which I presume has a speaker inside the tower). This speaker is normally in use whenever I play music (lets call this "tower speaker"), and when I insert my headphones in the 3.5mm jack (of the tower), the tower speaker stops and the music is played through the headphones (an obvious thing to happen). But sometimes, the tower speaker starts playing the music even when the headphones are inserted! So, the music is played through both of them! This gets quite embarrassing. So, my question is - Is there a way to turn off this "tower speaker"? EDIT : I'm using Windows XP

  Read the article

• Is Joerg Schilling’s “sdd” a full replacement for “dd”

  - by fishtoprecords

  I was directed to post here, I started on Stackoverflow.... I'm trying to use 'sdd' on my Debian system, and can't get one set of options to work. They do work in 'dd' so I am wondering if I am specifying them incorrectly, or if sdd didn't implement them, or something else. What I want to do is sdd if=/dev/hdh1 of=/bay5/imagebay1 bs=4096 conv=sync,noerror if I leave out the "conv=..." option, it works, or at least starts copying data. sdd if=/dev/hdh1 of=/bay5/imagebay1 bs=4096 Can you shed a bit of light?

  Read the article

• Internet connection issues after installing Windows Phone 8 SDK

  - by Mosquito

  first of all I must admit, that I'm not good in all this network stuff. I am using Windows 8 OS. On my laptop (Lenovo G570) I have installed Windows Phone 8 SDK and shortly after this I started having weird issues with internet connection. When I start my laptop, internet usually works fine, but after a few minutes it starts slowing down so much, that I'm not able to open a single page. Rebooting doesn't work, after several disabling and enabling network adapter, it usually works again for a few minutes and then again it stops. I'm sure it has something to do with Windows Phone 8 SDK, because problems started with this. With SDK there was also installed "vEthernet (Internal Ethernet Port Windows Phone Emulator Internal Switch)" network adapter. It is worth to note that problems occur mostly in my school network, not at home. Both at home and school I am using Wi-Fi connection. I hope the information given are enough to help me. Thanks in advance for any answers!

  Read the article

• Set up Ubuntu in Virtualbox to have static ip

  - by Don H

  I frequently work in different locations, and need to have a virtualbox version of Ubuntu server running locally. While I was at home getting it set up, I was able to ssh into the server using the locally allocated IP address. However, now that I'm elsewhere, ifconfig is still showing the old 10.0.x.x ip address, but instead of being in the 10.0.x.x space, my laptop's ip starts with 192.168.x.x With that in mind, if there a straightforward way to set up the virtual box Ubuntu server in such a way that I can just connect using "ssh servername" regardless of it's ip address?

  Read the article

• MySQL Cluster transaction isolation level - READ_COMMITTED

  - by Doori Bar

  I'm learning by mostly reading the documentation. Unfortunately, http://dev.mysql.com/doc/refman/5.1/en/set-transaction.html#isolevel_read-committed doesn't say anything, while it says everything. Confused? Me too. ndb engine supports only "READ_COMMITTED" transaction isolation level. A. It starts by saying "sets and reads its own fresh snapshot", which I translate to: The transaction is having a separated 'zone' which whatever it stores there - is what it reads back. B. While out-side of the transaction, the old-values are unlocked. C. It continues with: "for locking reads" sentence - No idea what it means. Question: they claim only READ_COMMITTED transaction isolation level is supported, but while handling a BLOB or a TEXT, they say the isolation is now "locked for reading" too. So is it a contradiction? can a transaction LOCK for reading just as well while handling something other than BLOB/TEXT? (such as integers)

  Read the article

• Resources started with slash .htaccess redirection

  - by Pawka

  I have moved old version of webpage to some subdirectory: http://www.smth.com/old/. But all resources (images, css, etc.) in HTML are linked with slash symbol at the start. So browser still tries to load them from root path. For example old/test.html contains: <img src="/images/lma_logo.ico" /> <!-- not working !--> <img src="images/lma_logo.ico" /> <!-- working !--> How can I rewrite ulrs to load resources from the "old" dir if urls still starts with "/"?

  Read the article

• Terminal Server Spoolsv.exe error

  - by Voyager

  We are having a terminal server ibm x3650 with 8 gb of RAM. On many occasions, at least once in a day, we get the error "The instruction at "0x7c8199b2" refrenced memory at "0x9ddc2ade". The memory could not be "read". Click OK to terminate the program. Click on CANCEL to debug the program. I have surfed very many sites, microsoft included, but none of them have been able to give conclusive solution for ending this problem. When we press on ok or cancel, then our ERP application (VB-MS SQL) starts to work normally. till such time the message is there, all our reports are hanged (Business Objects reports). We have already installed all the drivers of printers on the TS. Can anyone help?

  Read the article

• How to automount a Truecrypt volume before login in Windows 7?

  - by nonoitall

  I have an external hard drive containing all my documents, and it is encrypted with a password via Truecrypt. I'd like my desktop computer at home to automatically mount the volume prior to my logging in (so that it can be used as my user folder) without asking me for a password. (Yes, the password can be saved in plain text on my desktop's hard drive - that's okay.) For the life of me, I can't figure out a way to do this that actually works though. Tried using the Task Scheduler to schedule a mount when the computer starts up, and it works, but the volume is only accessible by my user account after I log in. (Haven't tried every combination of users/options for the scheduled task, so maybe there's something else there I need to try.) Also tried adding a startup script for my user account that runs on login, which evidently is too late to set up the user's profile folder. Anybody ever successfully achieve this or something like it?

  Read the article

• How to make sure clients update their browser cache when my website is updated?

  - by user64204

  I am using the HTTP 1.1 Cache-Control header to implement client-side caching. Since I update my website only once a month I would like the CSS and JS files to be cached for 30 days with Cache-Control: max-age=2592000. The problem is that the 30-day period defined by Cache-Control doesn't coincide with the website update cycle, it starts from the moment the users visit the site and ends 30 days later, which means an update could occur in the meantime and users would be running with outdated content for a while, which could break the rendering of the website if for instance the HTML and CSS no longer match. How can I perform client-side caching of content for periods of several days but somehow get users to refresh their CSS/JS files after the website has been updated? One solution I could think of is that if website updates can be schedule, the max-age returned by the server could be decreased every day accordingly so that no matter when people visit the website, the end of caching period would coincide with the update of the website, but changing the server configuration every day goes against one of my sysadmin principles (once it's running, don't touch it).

  Read the article

• Vista Home Premium won't upload

  - by longhairedsi

  Hi, I have a sony vaio laptop(VGN-FW31J) running windows Vista Home Premium . I've had it over a year and file upload in a browser has never worked on any website in any browser(IE, Firefox, Chrome). I can select a file and the upload starts running but I always get a timeout. Sometimes it has worked once out of many attempts but only if the file is very small( < 50k). FTP does work. I've tried the following: Disabling anti virus Disabling firewall Can anyone help me here? i'm wondering if this is a vista problem or a vaio problem. Cheers

  Read the article

• App Pool crashes before loading mscorsvr. How to troubleshoot?

  - by codepoke

  I have an app pool that recycles every 29 hours, per default. It recycles smoothly 9 times out of 10, and I'm pretty sure the recycle itself is good for the app. Once every couple weeks the recycle does not work. The old worker process dies cleanly and the new worker process starts, but will not serve up content. Recycling the app pool again manually works like a charm. The failed worker process stops and dies cleanly and a second new worker process fires up and serves content perfectly. I took a crash dump against the failed worker process prior to recycling it, and DebugDiag found nothing to complain about. I tried to dig a little deeper using WinDBG, but mscorsvr/mscorwks is not loaded yet 15 minutes after the new process started. There are 14 threads running (4 async) and 20 pending client connections, but .NET is not even loaded into the process yet. Any suggestions where to poke and prod to find a root cause on this?

  Read the article

• Windows 2008 R2 on ESXi 4.1 cpu utilization kernel high

  - by MK.

  I have a Win2k8 guest running on ESXi 4.1. The host has 12 cores and the problem happens even if the guest is the only VM on the host. We have 4 cores dedicated to the guest. We noticed that network starts chocking when the CPU load goes up. After some testing we noticed that when running a simple CPU hogging tool set up to run 3 threads at 100% the regular CPU load goes to 75% like it should and the "kernel times" graph in task manager goes up to 25%. My intuition tells me that the network problem and kernel times problem are the same. This is confirmed by another similar VM we created on the same host which doesn't have either of the problems. VMWare tools are obviously installed. The nic is e1000. What else can we do to troubleshoot this?

  Read the article

• perform command substitution in MS-DOS

  - by wiggin200

  I wonder how you can make in MS-DOS a command substitution Command substitution is a very powerful concept of the UNIX shell. It is used to insert the output of one command into a second command. E.g. with an assignment: $ today=$(date) # starts the "date" command, captures its output $ echo "$today" Mon Jul 26 13:16:02 MEST 2004 This can also be used with other commands besides assignments: $ echo "Today is $(date +%A), it's $(date +%H:%M)" Today is Monday, it's 13:21 This calls the date command two times, the first time to print the week-day, the second time for the current time. I need to know to do that in MS-DOS, (I already know that there is a way to perform something like that using as part of the for command, but this way is much more obfuscated and convoluted

  Read the article

• USB Mouse doesn't work after turning on Laptop

  - by Barry

  I have a USB mouse attached to my laptop which does not work when I switch my laptop on. I have to unplug it and plug it back in before it works. When I do this no driver installation occurs (presumably because it has already done this) the usual beep sound does occur and the mouse starts working again. If my laptop goes to sleep I can move the mouse and the laptop comes back to life. In fact it works perfectly apart from this annoying niggle on startup. Can anyone shed any light as to why I have to keep unplugging and plugging my mouse back on startup? I am running Windows 7 Home Premium Service Pack 1 (64 bit) on a Toshiba Satellite L755-1LL Laptop.

  Read the article

< Previous Page | 87 88 89 90 91 92 93 94 95 96 97 98  | Next Page >