Search Results

Search found 5619 results on 225 pages for 'starts'.

Page 91/225 | < Previous Page | 87 88 89 90 91 92 93 94 95 96 97 98  | Next Page >

  • Why is file sharing over internet still working, despite all firewall exceptions for filesharing being disabled?

    - by Triynko
    Every exception in my windows server firewall that starts with "File and Printer Sharing" is disabled (ordered by name, so that includes domain, public (active), and private profiles). The Network and Sharing Center's options for everything except password protected sharing are off. Why would I still be able to access a network share on that server via an address like "\\my.server.com\" over the internet? The firewall is on for all profiles and blocking incoming connections by default. A "netstat -an" command on the server reveals the share connection is occurring over port 445 (SMB). I restarted the client to ensure it was actually re-establishing a new connection successfully. Is the "Password protected sharing: On" option in Network and Sharing Center bypassing the firewall restrictions, or adding some other exception somewhere that I'm missing? EDIT: "Custom" rules are not the problem. It's the "built-in" rules for Terminal Services that was the problem. Can you believe port 445 (File Sharing Port) has to be wide open to the internet to use Terminal Services Licensing?)

    Read the article

  • disappearing emails

    - by Mike
    I have a few users (about 7 of 400) where their emails are disappearing intermittently on outlook, the emails are however still on OWA in the correct folders. After running the following Shell command in exchange and restarting outlook everything works fine again for about a week. [PS] C:\Windows\system32set-mailboxcalendarsettings [email protected] - AutomateProcessing:autoupdate Then for some odd reason AutoUpdate changes to AutoAccept and the problem starts again. They are all using office 2007 with SP3 but I suspect the problem is on exchange and not on the local machine. any help will be appreciated FrustratedMike

    Read the article

  • Newly installed DIR-615 - how to connect to the wireless?

    - by JK123
    I've just installed a D-Link DIR 615, but can't figure out how to connect to the wireless.. When I double click my wireless icon in the tray, it does show the new network. Its starts the "WiFi protected setup wizard" and the first thing it asks for is the "Device Ownership Password". I have no idea what that is - I've tried the PIN and the router password. On the next page it says: SSID: _(name)__ Security type: _wpa2 personal aes ccmp_ Password: _some long key that is not what I entered during router setup_ I change the key to the one I created when setting up the router. I've also tried leaving the key as it is shown in the dialog. But it does not connect either way. All it says is "Configuration failed" So how do I connect to the new wireless network??

    Read the article

  • what's POST code 18 / can I run an ASRock P55 Pro + Core i3 530?

    - by Michael Borgwardt
    When I switch my newly built PC on, the fans start up, but I get nothing on the monitor, and the POST display on the motherboard runs quickly through various codes and then stops at code 18, which does not appear in the manual (the list there seems identical to this one). This lasts about 10 seconds, after which the machine shuts down. After a pause (also about 10 seconds) it starts up again, and this repeats until I cut the power. Interestingly, when I push the reset button, it stops at POST code 16 (which is also not listed in the manual). Does anyone have information about the meaning of those codes? Motherboard: ASRock P55 Pro CPU: Intel Core i3 530 Graphics Card: Sapphire HHD 5750 Does anyone have experience with that Motherboard/CPU combination? It says on the packaging and in the manual that it's only compatible with Core i5 and i7 (no mention of i3), but on the maker's product page, the i3 is listed as compatible as well.

    Read the article

  • Encrypt two drives with Truecrypt with password before boot

    - by Deshroom
    i'm using laptop and PC with single HDD with full disk encryption. I know how works truecrypt on single drive because i use it everyday. My second laptop has 2 HHDs. My question is how to encrypt first 128GB SSD and second 1TB HDD in same way. I have multiple applications installed on second drive so i want to have it accessible during boot in ex. Steam in installed on second drive and it starts with windows. How to do it? can i encrypt two drives in truecrypt and unlock it via password before boot? My main reason is i want to RMA laptop without removing disks or data - my data need to be encrypted. Thank you.

    Read the article

  • Is it possible to view Facebook news feeds page by page rather than loading it all as I scroll?

    - by oscilatingcretin
    If you want to scroll through your Facebook news feed (be it on the main feed, your personal feed, or in groups) to older parts, you have to scroll to the bottom, wait for the ajax load of the next part of the feed, and repeat. The problem with this is that, if you're scrolling down very far, the HTML document just gets bigger and bigger until your browser starts to die due to the overload of resources brought on by added HTML, text, and even images. This pretty much sets a limit to how far back you can scroll. Clicking on months and years on your personal feed has the same effect of cumulatively adding feed segments to the HTML document. I notice that this month/year feature is not available on the main feed and for groups. If there were a way to literally page through the feed so that only a single page's worth of feed data is loaded at a time, that would make scrolling through it much more doable.

    Read the article

  • Windows 2008 R2 on ESXi 4.1 cpu utilization kernel high

    - by MK.
    I have a Win2k8 guest running on ESXi 4.1. The host has 12 cores and the problem happens even if the guest is the only VM on the host. We have 4 cores dedicated to the guest. We noticed that network starts chocking when the CPU load goes up. After some testing we noticed that when running a simple CPU hogging tool set up to run 3 threads at 100% the regular CPU load goes to 75% like it should and the "kernel times" graph in task manager goes up to 25%. My intuition tells me that the network problem and kernel times problem are the same. This is confirmed by another similar VM we created on the same host which doesn't have either of the problems. VMWare tools are obviously installed. The nic is e1000. What else can we do to troubleshoot this?

    Read the article

  • How to scrub a document of all text between brackets with find and replace

    - by sam
    I have a log file and I need to find all instances of <password> hash here </password> and remove the hash and replace it with some dummy text like aaa-aaa-aaa-aaaa. The recurring search argument is anything that matches a bracket that starts with <password> and ends with </password>. All the hashes being replaced will be different. What's the easiest way to go a bout this? The log is on a windows machine. Probably easiest would be to use MS word for me, unless it's achievable with wordpad, notepad, or some other light weight editor like textpad. thanks

    Read the article

  • preloading RSS contents in thunderbird, before actually reading them

    - by Berry Tsakala
    i have thunderbird 3.x, and i'm subscribed to several RSS feeds. How can I tell thunderbird to load/download any new RSS items in the background? The usual behavior with RSS feeds is that it download the headrs, or few introductory lines from the contents, but only when i'm clicking a feed item it starts loading "for real". I really want to receive the feeds and not to wait for them to load, the same way i receive emails in any email client - all messages are fully downloaded at once. there could be several reasons, BTW. - e.g. if i have short connection time, i'd rather connect, sync everything at once, and read it later. - or if i have a slow wifi connection, it's annoying to wait for each and every message, but the computer is idle while reading.. thanks

    Read the article

  • Internet connection issues after installing Windows Phone 8 SDK

    - by Mosquito
    first of all I must admit, that I'm not good in all this network stuff. I am using Windows 8 OS. On my laptop (Lenovo G570) I have installed Windows Phone 8 SDK and shortly after this I started having weird issues with internet connection. When I start my laptop, internet usually works fine, but after a few minutes it starts slowing down so much, that I'm not able to open a single page. Rebooting doesn't work, after several disabling and enabling network adapter, it usually works again for a few minutes and then again it stops. I'm sure it has something to do with Windows Phone 8 SDK, because problems started with this. With SDK there was also installed "vEthernet (Internal Ethernet Port Windows Phone Emulator Internal Switch)" network adapter. It is worth to note that problems occur mostly in my school network, not at home. Both at home and school I am using Wi-Fi connection. I hope the information given are enough to help me. Thanks in advance for any answers!

    Read the article

  • Network tries to reindentify itself now and then

    - by Don Young
    When the computer starts up it connects itself to the router (ZTE 4G router) automatically, but after I have surfed the web for a while, it tries to identify itself, meaning you get that little blue circle next to the little screen at the corner. When browsing it does not cause any problems, but if I'm streaming a video the video will then stop, I'll have to refresh the page to make the video start again. And if I'm playing a game, LoL for example, the game will freeze for about 2 seconds then continue again (due to lost connection to the internet). I have no virus on my computer, although I had before. I have reset my router, restarted my computer, updated my ethernet driver, checked so that the IPv4 is set on automatic and tried different router channels. I have had this router for a few months and the problem just started recently. Here is the ipconfig screen:

    Read the article

  • Stopping/Starting windows services

    - by Geek
    I have four windows services which start up automatically when the machine starts. There after, I want to restart those services every 8 hours in a particular order. For eg. Stop s1,s2,s3,s4 and than restart them in some other order like s4,s3,s2,s1. The condition is that I should wait for each service to stop completely before I stop another one. I would want to write a .BAT or some script. Is it possible to define a CRON for 8 hours, this is not there in Advanced tasks ? Can I do it using windows scheduler ? Please suggest. thanks in advance.

    Read the article

  • Starting VM as an executable with as low overhead as possible

    - by Robert Koritnik
    Is there a solution to create a virtual machine and start it by having an executable file, that will start the machine? If possible to start as quickly as possible. Strange situation? Not at all. Read on... Real life scenario Since we can't have domain controller on a non-server OS it would be nice to have domain controller in an as thin as possible machine (possibly Samba or similar because we'd like to make it startup as quickly as possible - in a matter of a few seconds) packed in a single executable. We could then configure our non-server OS to run the executable when it starts and before user logs in. This would make it possible to login into a domain.

    Read the article

  • Nagios service active only when other service is failing

    - by Laimoncijus
    Is is possible to define service to be active only the times while other service is failing? Consider following example: 2 hosts available: HostA (primary) and HostB (backup). Nagios service, which monitors amount of active connections to the host: gives OK when amount of connections to host 0 gives FAILURE when amount of connections to host = 0 If setup nagios service to monitor both hosts: HostA and HostB - it will give me OK for HostA (while it is primary and all connections normally goes to it) and FAIL for HostB (while it is backup and will receive no connections while HostA is alive). Can I make the nagios service for HostB somehow depend on sevice of HostA and give no failures (or maybe be inactive) up to the moment the service of HostA starts failing?

    Read the article

  • bursty streaming video

    - by broiyan
    What is the cause and solution for the bursty streaming media problem? Example: when streaming from youtube, audio (and video) will pause and start intermittently. When it starts it will be bursty, that is, it will play several seconds of sound in just a fraction of a second. Normal sounds are rendered unrecognizable. Then it may pause and after a few seconds, resume with another burst. The video seems to burst along with the audio. This was observed on Ubuntu 12.04 with Google Chrome.

    Read the article

  • Ubuntu 9.10 Dowload Speed Very Slow

    - by Don
    I'm running Ubuntu 9.10 desktop and I'm new to the Linux world, so bear with me. I'm on a corporate network of 3 T1s shared across 50-60 users. I typically get about 300 KB/sec for downloads, but for whatever reason, the Linux box will start out in that range, then drop to less than 1KB/Sec sometimes. Doesn't seen to matter where I'm downloading from. Right now I'm trying to get Eclipse for PHP and it's running at 3-6KB/sec. Getting the updates for the system will also drop to very slow rates. Our IT person has set up the machine to get the same 10.0.0.x address when it starts, and moved this IP to bypass our Proxy/Firewall going out, so that shouldn't be the issue. Can anyone recommend something I can try to better diagnose the problem. Again, I'm new to the Linux world and the hardware/OS setup side in general (coming form more of a coding background). Thanks for any advice.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • get text from a certain <tr> tag

    - by WideBlade
    Is there a way to get the text in a dynamic way from a certain <tr> tag in the page? e.g. I've a page with a <tr> with the value "a1". I'd like to get only the text from this <tr> tag, and echo it into the page. is this possible? here is the HTML: <html><tr id='ieconn2' > <td><table width='100%'><tr><td valign='top'><table width='100%'><tr><td><script type="text/javascript"><!-- google_ad_client = "pub-4503439170693445"; /* 300x250, created 7/21/10 */ google_ad_slot = "7608120147"; google_ad_width = 300; google_ad_height = 250; //--> </script> <script type="text/javascript" src="http://pagead2.googlesyndication.com/pagead/show_ads.js"> </script><br>When Marshall and Lily fear they will never get pregnant, they see a specialist who can hopefully help move the process along. Meanwhile, Robin starts her new job.<br><br><b>Source: </b>CBS <br>&nbsp;</td></tr><tr><td><b>There are no foreign summaries for this episode:</b> <a href='/edit/shows/3918/episode_foreign_summary/?eid=1065002553&season=6'>Contribute</a></td></tr><tr><td><b>English Recap Available: </b> <a href='/How_I_Met_Your_Mother/episodes/1065002553?show_recap=1'>View Here</a></td></tr></table></td><td valign='top' width='250'><div align='left'> <img alt='How I Met Your Mother season 6 episode 13' src="http://images.tvrage.com/screencaps/20/3918/1065002553.jpg" width="248" border='0' > </div><div align='center'><a href='/How_I_Met_Your_Mother/episodes/1065002553?gallery=1'>6 gallery images</a></div></td></tr></table></td></tr><tr> <td background='/_layout_v3/buttons/title.jpg' height='39' width='631' align='center'> <table width='100%' cellpadding='0' cellspacing='0' style='margin: 1px 1px 1px 1px;'> <tr> <td align='left' style='cursor: pointer;' onclick="SwitchHeader('ieconn3','iehide3','26')" width='90'>&nbsp;<span style='font-size: 15px; font-weight: bold; color: black; padding-left: 8px;' id='iehide3'><img src='/_layout_v3/misc/minus.gif' width='26'></span></td> <td align='center' style='cursor: pointer;' onclick="SwitchHeader('ieconn3','iehide3','26')" ><h5 class='nospace'>Sponsored Links</h5><a name=''></a></td> <td align='left' width='90' >&nbsp;</td></tr></table></td> </tr></html> All I want to get is this text: "When Marshall and Lily fear they will never get pregnant, they see a specialist who can hopefully help move the process along. Meanwhile, Robin starts her new job. "

    Read the article

  • ionice idle is ignored

    - by Ferran Basora
    I have been testing the ionice command for a while and the idle (3) mode seems to be ignored in most cases. My test is to run both command at the same time: du <big folder> ionice -c 3 du <another big folder> If I check both process in iotop I see no difference in the percentage of io utilization for each process. To provide more information about the CFQ scheduler I'm using a 3.5.0 linux kernel. I started doing this test because I'm experimenting a system lag each time a daily cron job updatedb.mlocate is executed in my Ubuntu 12.10 machine. If you check the /etc/cron.daily/mlocate file you realize that the command is executed like: /usr/bin/ionice -c3 /usr/bin/updatedb.mlocate Also, the funny thing is that whenever my system for some reason starts using swap memory, the updatedb.mlocate io process is been scheduled faster than kswapd0 process, and then my system gets stuck. Some suggestion? References: http://ubuntuforums.org/showthread.php?t=1243951&page=2 https://bugs.launchpad.net/ubuntu/+source/findutils/+bug/332790

    Read the article

  • finder restore window error

    - by corne
    my mac with lion starts up with the finder dispaying the message to "restore window" and keep on cycling thru it but never opening the finder window. other sites say that file/s in my desktop folder is corupt and i must delete them fith terminal. there is no way to open the terminal app in my normal user profile. i have created a test user profile with administative rights and that works fine but the problem is my normal desktop folder is locked and not accesiable in my test user account. how do is delete those files in my normal desktop folder with the terminal app?

    Read the article

  • VirtualBox VRDP server doesn't start on Windows

    - by quanticle
    I've installed VirtualBox 4.1.8 on a Windows 7 Ultimate host system. I've set up an Arch Linux VM that starts just fine from the VirtualBox GUI. However, when I try to start it with VBoxHeadless --startvm <vm_name> it prints the following Oracle VM VirtualBox Headless Interface 4.1.6 (C) 2008-2011 Oracle Corporation All rights reserved. and then it just sits there. I never get the VRDE server is listening on port 3389 message like when I start a headless VM on a Linux machine. Do I have to configure anything else in order to get the VRDE server to run?

    Read the article

  • Add folder name to beginning of filename - getting multiple renames

    - by Flibble Wibble
    I've used dbenham's excellent response to the question of how to add the folder name to the beginning of a filename in a cmd script. @echo off pushd "Folder" for /d %%D in (*) do ( for %%F in ("%%~D\*") do ( for %%P in ("%%F\..") do ( ren "%%F" "%%~nxP_%%~nxF" ) ) ) popd What I'm finding is that seemingly randomly (though it probably isn't) sometimes the script will run through several child folders and rename correctly but then it gets to a folder where it gets stuck in a loop and starts adding the folder name repeatedly to the file inside. I have 90,000 files in 300 folders to rename this weekend. Any chance you can guess the cause? PS: Is there a maximum number of files that are acceptable in each folder?

    Read the article

  • Fullscreen Photo/Video Slideshow App?

    - by Michael Stum
    I have a folder that contains a lot of subfolders which include photos and/or videos. Is there any free application that would display them in a random slideshow? It's something I want to run on a PC mounted on a wall. I point it to that folder and it starts displaying it, with some random/nice transitions. No need for anything more fancy, except maybe Previous/Next controls. Edit: Just a quick clarification. Those pictures change all the time, and there are many of them. It's supposed to be in a store to display product pictures, so it's not like someone is actively watching the whole show. Currently, there are around 150,000 pictures or videos.

    Read the article

  • searchd under runit continues writing to the runit's log

    - by Eugene
    searchd (Sphinx) run file: #!/bin/sh set -e APP_PATH=/srv/application TARGET_USER=user exec chpst -u $TARGET_USER /usr/bin/searchd --pidfile --nodetach --config $APP_PATH/current/config/production.sphinx.conf tail /var/log/sphinx/current 2014-06-07_18:13:56.87885 precached 9 indexes in 0.497 sec 2014-06-07_18:13:57.13740 precached 9 indexes in 0.497 sec 2014-06-07_18:13:57.88113 precached 9 indexes in 0.497 sec 2014-06-07_18:13:57.89167 precached 9 indexes in 0.497 sec 2014-06-07_18:13:59.75555 precached 9 indexes in 0.497 sec 2014-06-07_18:13:59.81554 precached 9 indexes in 0.497 sec 2014-06-07_18:14:00.33466 precached 9 indexes in 0.497 sec ... it continues to write the same line until sv stop sphinx ... Everything works fine, seachd starts and responds to the queries. But how to make logs to be less repetitive? When I start Sphinx manually it prints the "precached 9 indexes" just once.

    Read the article

  • Pc not booting, no video output, hard drive noises

    - by bullettime
    My computer suddenly stopped booting up. I just came back from a week long trip, and it was working fine before I left. When I power up the computer now, it seems to power up just fine (leds on, fans working), but then there's no output on the screen at all, and there's a noise that seems to be coming from the HD, like it is trying to read something. After the noise starts, it does 6 cycles and then stops. I'm not sure but I don't think it did this noise when the pc was still working. I tried using the onboard video card instead but it made no difference. What could be wrong with my computer?

    Read the article

< Previous Page | 87 88 89 90 91 92 93 94 95 96 97 98  | Next Page >