Search Results

Search found 5845 results on 234 pages for 'short'.

Page 92/234 | < Previous Page | 88 89 90 91 92 93 94 95 96 97 98 99  | Next Page >

• How can I display images on a MS Access 2007+ form with a hyperlink source?

  - by Yaaqov

  I am looking improve the efficiency of an Access 2010 database by using a web server with images and only storing the hyperlink source (i.e, http://www.images.com/images/image1.jpg) in the table. I know that one can save images as "attachements", using a "blob" object type, but when you're dealing with thousands of images, queries are bogged down, and performance suffers. So in short, is there are relatively simple way of displaying images on MS Access forms with a source that is a hyperlink address (storing files locally and using filepaths is not preferable). Thanks.

  Read the article

• monitor power and lock screen (Ubuntu Lucid)

  - by xsznix

  Hi, I'm trying to get my screen to turn off whenever I lock my screen. I know that in Power Management, there's an option to turn off the screen after a set amount of time, and I know about xset dpms force off, but the former doesn't allow me to turn off the screen from the logout menu, and the latter only turns the screen off for a short amount of time (1 minute or so. The screen just turns back on by itself). Is there a script I can modify to change what happens when "Lock screen" from the logout menu is selected, or is there a script I can add to the panel to lock the screen and then turn the monitor off (and turning it back on when I shake the mouse or something)? Thanks.

  Read the article

• not able to make entry of ubuntu 10.04 grub.cfg into redhat 5.1 menu.lst file to run 2 linux os and

  - by Deepak Narwal

  Hello friend... In my computer there are three operating systems.. First i installed Windows 7 then i installed ubuntu 10.04 and in last i installed redhat 5.1 NOw i know one thing as i installed redhat then grub installed by ubuntu will be overwritten by redhat grub..and i know that to see all three operating syetm at the startup i have to make entry of /boot/grub/cfg into /boot/grub/menu.lst file.. Now the problem is like this In te previous version it was very easy to play with ubuntu grub file but now this file is modified..NOw i dont know what is to be picked up from ubuntu /grub/grub.cfg file so that i can make entry in redhat /boot/grub/menu.lst file.. In short i am not able to put entry of grub.cfg file into redhat menu.lst file.. will u help me plz i want to work on these thre eOS..

  Read the article

• Re-cased my computer now the power plug keeps shorting

  - by dunc

  I've just re-cased my computer. I got the new case free and thought I'd be able to swap everything over myself but apparently I've done something wrong. I'm OK with components generally but wasn't totally confident about doing this. So, my question is, when setting up a new PC or moving old components into a new case, what could I have done which causes the power cable plug to short/fuse when I plug it in?. Is this likely to be an issue with the cables from my PSU, or could it be the internal case connectors? What steps would you take to diagnose the problem? I'd rather not start again if I don't have to...! Thanks in advance,

  Read the article

• Ubuntu 12.10 sources.list empty after install

  - by Martin Nielsen

  I recently installed the Ubuntu 12.10 server version from a USB stick. The step "Install additional software" or whatever keeps failing, so i though screw it and continued. Everything else worked like a charm. I thought. Turns out, the only two entries in my sources.list are the install CD. This means that i have no way of getting a.. well.. anything installed. Can someone give me a short list of repositories that i need so i can put them in the file? And on a similar note: What is the comment character for the sources list? #?

  Read the article

• Virtual Screen Splitter

  - by dabest1

  I am looking for a utility that will allow my screen to be split into two sections. I would like to do this so that programs can easily fill or get sized properly to one part of the screen. This way I can pretend that I have a separate monitor for working on my stuff, while my kids can watch something on the other side. In addition, this should help prevent any popups covering up their side of the screen. Although Windows 7 comes with ability to drag a program window to a side and it becomes sized to half of the screen automatically, this is insufficient for me. I would like to make sure that any programs I launch or any pop-ups that open up, do not block the other side of the screen, even for a short time. Also, I am not looking for a virtual OS solution, as in VirtualBox.

  Read the article

• Help with Corrupt version of IE8 on WinXPsp3

  - by Anon

  I've upgrade from IE6 to 7 to 8 and back down and back up, but still have critical issues in IE such as * cannot see any version info in "about internet explorer" * cannot run windows update * cannot load SharePoint pages (and other pages using ActiveX or IE-specific dhtml) I've also re-installed sp3, but still no luck. Also, also - I've changed security settings to be most permissive. Next step is blowing it all away and starting with windows7. Short of that, any suggestions are welcome. Thanks in advance.

  Read the article

• Redirect traffic to local address so iOS speedtest app measures LAN speed

  - by ivan_sig

  I have mounted a Speedtest Mini server on a local LAMP, so I can test my LAN speeds effortlessly just by opening the URL with a Flash enabled web browser, the thing is, I want my iOS and Android devices to test with the LAN server too, not with the WAN, as I'm trying to measure LAN-Only performance. Is there a way so I can redirect the traffic intended to an specific external IP (The one of the real server) to my local server?. I know the servers IP as a short Wireshark analysis gave me the data, but still searching for a way to make that redirect. I have Jailbreak and root on my devices, so playing with system files is not a problem. I've tried mounting a proxy and making redirects by the hosts file and domain names, but it looks like Ookla's app relies on IP address only.

  Read the article

• Java login through LDAP

  - by Salda

  I am starting to write an application for our office and the first step is authentication through LDAP where all users already exist. Everything I need is a code in Java to check if the pair <nick,password> is right. Google found me many links, but I think that I will find here the most sofisticate, short and up to date solution (I don't want to read all articles like 2 whole days to do something so simple). I have written many dkBs of code in C++, but in Java I am total noob and I haven't coded anything with LDAP yet so try to be simple if speaking in Java and LDAP terms if possible.

  Read the article

• Why is the System process listening on Port 443?

  - by ClearsTheScreen

  I am having problems starting my apache server, because port 443 is already in use. It turns out, the system process (PID 4) uses the port 443. I don't have IIS installed, the services.msc shows (predicatbly) no Exchange server running, nor WWW-Services, nor IIS. I have no idea how to find out what service uses that port short of just disabling each service one after the other, and I am not even sure that would help. I would be grateful if someone could point me towards how I can get my SSL port back, thank you :) P.S.: Of course "just switch apache to another port for SSL" would solve the problem of not being able to start apache. But I'd still like to know what is so insistent about hogging port 443. :)

  Read the article

• Debian 6 or CentOS 6 - which one is easiest for latest versions of Ruby and Postgres?

  - by A4J

  I am getting a new server as I've messed up my current box, while trying to install Postgres 9 (on my CentOS 5.8 box). To cut a long story short, I removed postgres but yum decided to remove virtualmin-base as well, which broke my virtualmin install (postfix/dovcot stopped working). Virtualmin advise a fresh install once virtualmin-base has been removed/reinstalled. So I'll probably make a decision based on this simple criteria: which distro out of the two makes it easiest for installing the latest versions of Ruby and Postgres? They are both equally respected as web servers, so I really don't mind either way - I just want to use the one that will work best with the software I need.

  Read the article

• virtual machines: optimal host os to run Windows XP guest os?

  - by user61132

  My department doesn't have the budget to upgrade my ailing Dell D620 laptop. However, I do have the option to buy my own personal computer, then use my company-issued ISO image to run Windows XP as my guest os using virtualbox or vmware. Therefore, last month, I bought an Acer AX3910-U3012 desktop that had Windows 7 as the host os (and 8G RAM). In short, I was disappointed with the performance while trying to run WinXP as the guest os. (It didn't perform much better than my laptop.) Just wondering what the optimal host os would be for running Windows XP as the guest os? (No, I can't use my company-issued ISO image to build the os for my personal computer.) FWIW, I'm willing to spend up to $2k if it's REALLY worth it, but would prefer to spend no more than $1k. Also, in an effort to cut costs, I'd prefer buy a desktop instead of a laptop. Thanks for any/all feedback.

  Read the article

• preloading RSS contents in thunderbird, before actually reading them

  - by Berry Tsakala

  i have thunderbird 3.x, and i'm subscribed to several RSS feeds. How can I tell thunderbird to load/download any new RSS items in the background? The usual behavior with RSS feeds is that it download the headrs, or few introductory lines from the contents, but only when i'm clicking a feed item it starts loading "for real". I really want to receive the feeds and not to wait for them to load, the same way i receive emails in any email client - all messages are fully downloaded at once. there could be several reasons, BTW. - e.g. if i have short connection time, i'd rather connect, sync everything at once, and read it later. - or if i have a slow wifi connection, it's annoying to wait for each and every message, but the computer is idle while reading.. thanks

  Read the article

• How to force Windows XP to rename a file with a special character?

  - by codeLes

  I have a song that Windows can't play because there is a question mark in the name of the file. "Where Have All the Cowboys Gone?.ogg" // as an example So I try to rename it and Windows complains whether I try it in Explorer or from command prompt. Error I get when trying to copy, rename, or move is: The Filename, directory name, or volume label syntax is incorrect Is there a Windows way to force a rename in this case? Update I'll keep an eye on this question, but after 13 answers and many attempts (aside form 3rd party solutions) it seems that Windows can't do this (or at least my windows can't, no short names). So I'm accepting the answer which was my original solution anyway of using Linux. It would be nice to see Windows handle this somehow, so don't stop just because I've accepted this answer, the question still stands!

  Read the article

• How to explain DRM cannot work?

  - by jerryjvl

  I am looking for the shortest comprehensive way to explain to people that are trying to use DRM as a technology to prevent users from using their data in some fashion deemed undesirable, why their solution cannot work by definition. Ideally I'd like something that: Covers why technically it is impossible to have people access local data, but only in such-and-such a way Imparts an understanding of why this is, to avoid follow-on "But what if" rebuttals Is intuitive enough and short enough that even a politician (j/k) could grasp it When faced with this situation I try to be clear and concise, but I usually end up failing at least on one of these points. I'd really like to have a 'stock' answer that I can use in the future.

  Read the article

• Migrating users and IIS settings from a workgroup win2k3 machine to a new win2k8r2

  - by amber

  I am retiring my old Windows Server 2003 Standard 32bit machine to a new machine with Windows Server 2008 R2 Standard. The two sticking points are migrating user accounts (and there are a lot of them) and IIS settings/websites (again, there are a lot). The new machine has not been provisioned yet. I'm at that point where I'm about install the OS on it. The old machibe is configured with a mirrored set for its OS and data partitions. I have broken the mirror set, replicated all of the data to an external drive, and then rebuilt the mirror set. In short, I have an image of the old machine to play with while safely leaving it up and running. Thanks!

  Read the article

• Shortcut for enabling / disabling Greasemonkey (or specific script)

  - by ldigas

  talking about firefox here ... I don't use Greasemonkey on any other browser, but if you know, do add info for those as well I use Greasemonkey daily ... having some 20 scripts loaded all the time which save me a ton of grief. But, some of them I sometimes don't need ... few examples: - I use Google Image Status Reporter & Direct Images (links you directly to image file) ... but sometimes I want to go to the page where the image is ... - GReader Minimalist Style ... until I actually need to check the trends and some stuff it hides - there are other examples but these two first sprang to mind, since I just were thinking about that ... To put the long story short ... sometimes I would like a shortcut to disable Greasemonkey, so I don't have to go into the menubar and so on (which I also have half hidden for space) ... anyone knows of any, or how one could create one ?

  Read the article

• Make the recycle bin of the SSD on a RAID0 drive?

  - by Rolnik

  I don't know about you folks, but I hate the idea of junk sitting on my tiny 30GB SSD. Any way to designate another drive to be the host of the Recycle Bin for items formerly on the SSD? Basically, I need to know how to make a lower-priority drive receive the recycled materials from the 'main' drive, which happens to be short on space. The best thing I can think of is a batch file that a) syncs 'recycle' to another drive; and b) empties the recycle bin. ... but that's too much work for me.

  Read the article

• WD Elements Desktop External - Not recognised on a single computer

  - by Aelexe

  My WD Elements Desktop External is no longer recognised on my main computer. It has worked fine in the past, but now all of a sudden is not detected. It does not prompt when plugged in, nor does it show up in the disc management interface or the device manager. It appears to be aware that it is plugged in however as the light on the external blinks rapidly for a short while after being plugged in. The strangest thing however is that it works fine on other computers, including my family computers and my laptop. I have attempted to troubleshoot the issue by trying various USB devices in multiple ports on each system to see if there is any correlation with the issue, but have come up with nothing that gives me an idea of what is going on. I have also attempted to format the external using my laptop, but that has not helped either. If anyone has had a similar issue, or knows of any potential solutions, please post your advice. Thanks for your time.

  Read the article

• Link two or more text boxes in Visio

  - by Dan

  I am working on creating a template in Visio 2007 (Professional). Each page should reflect a document number and a revision number (two text boxes). I would like to make the template such that entering or changing text in one of these boxes on one page will automatically update the equivalent text boxes on all other pages. Is there an easy way to link two (or more) text boxes to show the same data (mirror each other)? I've looked into creating a ShapeData set and then using the ShapeData field in place of each box, but this will require training others to access and adjust the ShapeData field. In short - I want the issue that was attempting to be solved in Changing Text in Visio Org Chart Shape Changes Multiple Shapes' Text .

  Read the article

• Apache+FastCGI Timeout Error: "has failed to remain running for 30 seconds given 3 attempts, its restart interval has been backed off to 600 seconds"

  - by Sadjad Fouladi

  I've recently installed mod_fastcgi and Apache 2.2. I have a simple cgi script as below (test.fcgi): #!/bin/sh echo sadjad But when I invoke 'mysite.com/test.fcgi' I see "Internal Server Error" after a short period of time. The error.log file shows this error message: [Tue Jan 31 22:23:57 2006] [warn] FastCGI: (dynamic) server "~/public_html/oaduluth/dispatch.fcgi" has failed to remain running for 30 seconds given 3 attempts, its restart interval has been backed off to 600 seconds This is my .htaccess file: AddHandler fastcgi-script .fcgi RewriteEngine On RewriteCond %{REQUEST_FILENAME} !-f RewriteRule ^(.*)$ django.fcgi/$1 [QSA,L] What could the problem be? Is it my .htaccess file?

  Read the article

• Computer freezes, wireless network icon disappears

  - by Heidi

  As you can see I have two problems. I have a Toshiba Tecra A3 computer. It is 5-6 years old and it is connected to a D-link router. For a period now it has not been working correctly. The computer freezes either when i try turning it on or when I have been using the computer for a short period of time. The times the computer works normally I have a problem with a disappearing wireless network icon, and so I have no internet. Can this be fixed or do I have to buy a new computer? I only use the computer for internet surfing and easy tasks like word etc, so I would like to keep it as long as possible.

  Read the article

• Apache web server: "proxying" a webapp from another server?

  - by Riddler

  Sorry for the lame terminology - I'm no way a sysadmin... So here's the deal. I have two Linux boxes in the same network, let's refer to those boxes by their IPs, a.b.c.d and e.f.g.h. Each box runs some webapp, normally available like http://a.b.c.d/ and http://e.f.g.h/. What I want to accomplish is this: with some Apache web server (which by the way lives on both boxes) configuration voodoo, the first app would be available via http://a.b.c.d/whatever1/, and the 2nd app would be available as http://a.b.c.d/whatever2/ - but would still reside on another server (e.f.g.h). Long story short - is it at all possible to do this with Apache configuration magic and without touching the webapps and their configuration? If so - how? :) Thanks in advance!

  Read the article

• HP Pavillion dv6 laptop - 15 beeps on startup and a black screen?

  - by dunc

  Usual story - girlfriend's step-brother's laptop is broken. I don't know a huge amount about what occurred before it broke, but I do know the following: When you try to turn the laptop on, it beeps 15 times exactly. The screen remains black. The LED on the Caps Lock key flashes continuously. If left on, the laptop never boots - as far as I can see. If left on, on a stable surface with decent ventilation for a relatively short period of time, the laptop (below keyboard, but not where the RAM/HDD are) gets very hot. I've tried doing what most websites appear to recommend for similar problems, which is to disconnect AC and battery then hold the power button down for a minute before reconnecting the AC and trying to turn the laptop on - no difference. EDIT I've also tried re-seating the RAM, to no avail. Any ideas? Thanks in advance,

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

< Previous Page | 88 89 90 91 92 93 94 95 96 97 98 99  | Next Page >