Search Results

Search found 8593 results on 344 pages for 'regular expression'.

Page 94/344 | < Previous Page | 90 91 92 93 94 95 96 97 98 99 100 101  | Next Page >

  • How many hours of use before I need to clean a tape drive?

    - by codeape
    I do backups to a HP Ultrium 2 tape drive (HP StorageWorks Ultrium 448). The drive has a 'Clean' LED that supposedly will light up or blink when the drive needs to be cleaned. The drive has been in use since october 2005, and still the 'Clean' light has never been lit. The drive statistics are: Total hours in use: 1603 Total bytes written: 19.7 TB Total bytes read: 19.3 TB My question is: How many hours of use can I expect before I need to clean the drive? Edit: I have not encountered any errors using the drive. I do restore tests every two months, and every backup is verified. Edit 2: The user manual says: "HP StorageWorks Ultrium tape drives do not require regular cleaning. An Ultrium universal cleaning cartridge should only be used when the orange Clean LED is flashing." Update: It is now May 2010 (4.5 years of use), and the LED is still off, I have not cleaned, backups verify and regular restore tests are done.

    Read the article

  • Very different font sizes across browsers

    - by Yang
    Chrome/WebKit and Firefox have different rendering engines which render fonts differently, in particular with differing dimensions. This isn't too surprising, but what's surprising is the magnitude of some of the differences. I can always tweak individual elements on a page to be more similar, but that's tedious, to say the least. I've been searching for more systematic solutions, but many resources (e.g. SO answers) simply say "use a reset package." While I'm sure this fixes a bunch of other things like padding and spacing, it doesn't seem to make any difference for font dimensions. For instance, if I take the reset package from http://html5reset.org/, I can show pretty big differences (note the layout dimensions shown in the inspectors). [The images below are actually higher res than shown/resized in this answer.] <h1 style="font-size:64px; background-color: #eee;">Article Header</h1> With Helvetica, Chrome is has the shorter height instead. <h1 style="font-size:64px; background-color: #eee; font-family: Helvetica">Article Header</h1> Using a different font, Chrome again renders a much taller font, but additionally the letter spacing goes haywire (probably due to the boldification of the font): <style> @font-face { font-family: "MyriadProRegular"; src: url("fonts/myriadpro-regular-webfont.eot"); src: local("?"), url("fonts/myriadpro-regular-webfont.woff") format("woff"), url("fonts/myriadpro-regular-webfont.ttf") format("truetype"), url("fonts/myriadpro-regular-webfont.svg#webfonteknRmz0m") format("svg"); font-weight: normal; font-style: normal; } @font-face { font-family: "MyriadProLight"; src: url("fonts/myriadpro-light-webfont.eot"); src: local("?"), url("fonts/myriadpro-light-webfont.woff") format("woff"), url("fonts/myriadpro-light-webfont.ttf") format("truetype"), url("fonts/myriadpro-light-webfont.svg#webfont2SBUkD9p") format("svg"); font-weight: normal; font-style: normal; } @font-face { font-family: "MyriadProSemibold"; src: url("fonts/myriadpro-semibold-webfont.eot"); src: local("?"), url("fonts/myriadpro-semibold-webfont.woff") format("woff"), url("fonts/myriadpro-semibold-webfont.ttf") format("truetype"), url("fonts/myriadpro-semibold-webfont.svg#webfontM3ufnW4Z") format("svg"); font-weight: normal; font-style: normal; } </style> ... <h1 style="font-size:64px; background-color: #eee; font-family: Helvetica">Article Header</h1> I've tried a few resets/normalize packages to no avail. I just wanted to confirm here that this is indeed a fact of life (even omitting the more glaring offenders like IE and mobile) and I'm not missing some super-awesome solution to this mess.

    Read the article

  • How do I install something from source and make it available to root?

    - by pwny
    I have a CentOS VM and I need to install the latest version of Ruby on it. Unfortunately, yum only makes Ruby 1.8.6 available so I'm trying to install Ruby from source. Here's what I'm using: cd /usr/src sudo -s wget http://ftp.ruby-lang.org/pub/ruby/1.9/ruby-1.9.3-p125.tar.gz tar -xvzf ruby-1.9.3-p125.tar.gz cd ruby-1.9.3-p125 ./configure make && make install The problem is that once that's done, I can only use Ruby as a regular user but I need to use it as root to install some gems. For example, as a regular user I can do ruby -v and it works but sudo ruby -v outputs bash: ruby: command not found. What am I missing to make stuff I install from source available to all users?

    Read the article

  • Use an audio/video file from a Linux laptop via USB to be played by Magic Sing ET-23H

    - by AisIceEyes
    I am one of the technical directors of a regular karaoke contest event. For the karaoke contest itself, due to tight budget, we are using what one of the sponsors are providing - Magic Sing ET-23H . The video output of the Magic Sing ET-23H are broadcasted at two big screens that are being shown to the audience and event attendees. When a karaoke contestant provides his / her karaoke video, the video itself is in a readable USB flashdrive and is attached to the USB input of Magic Sing ET-23H. What really bugs me is that the interface of Magic Sing ET-23H are also being broadcasted at the big screen video feeds. The interface of choosing the video file is being seen in the Magic Sing ET-23H - also to the big video screens that are seen by the audience and event goers. I will post in the comments ( if my less than 10 reputation would allow me) the picture of Magic Sing ET-23KH USB input of the device. I always bring my laptop, Acer AS5742-7653, during the regular karaoke event. I'm using my laptop also for tallying of scores from the judges, and also playing audio files from contestants that did not provide a karaoke video. I personally am using different Linux distros, but I next to all the time use my Ubuntu Studio 12.04.3 64bit partition during the regular karaoke contest event. My question is this: Is there a way I can share a temporary video/audio file directly from the laptop I'm using, going to the Magic Sing ET-23H that can broadcast both the video/audio file? Just like how in Window's Avisynth AVS files, or VirtualDub's temporary avi file, or like using ffplay (of ffmpeg), etc. I have researched somewhat the matter and found links in SuperUser.com. Though I can only provide the links at the comments section of this post if my reputation of less than 10 would allow me. I have a hunch it is possible, but I have not fully understood the device being used at the event, Magic Sing ET-23H, if there are other ways for it to broadcast video and audio files besides its USB input. Any help to my current predicament is highly appreciated. Thank you. PS: Since I need at least 10 reputation to post more than 2 links and also post images, I will try to post the image & links at the comments (if my below 10 reputation would allow me).

    Read the article

  • Advanced Regex: Smart auto detect and replace URLs with anchor tags

    - by Robert Koritnik
    I've written a regular expression that automatically detects URLs in free text that users enter. This is not such a simple task as it may seem at first. Jeff Atwood writes about it in his post. His regular expression works, but needs extra code after detection is done. I've managed to write a regular expression that does everything in a single go. This is how it looks like (I've broken it down into separate lines to make it more understandable what it does): 1 (?<outer>\()? 2 (?<scheme>http(?<secure>s)?://)? 3 (?<url> 4 (?(scheme) 5 (?:www\.)? 6 | 7 www\. 8 ) 9 [a-z0-9] 10 (?(outer) 11 [-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+(?=\)) 12 | 13 [-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+ 14 ) 15 ) 16 (?<ending>(?(outer)\))) As you may see, I'm using named capture groups (used later in Regex.Replace()) and I've also included some local characters (cšžcd), that allow our localised URLs to be parsed as well. You can easily omit them if you'd like. Anyway. Here's what it does (referring to line numbers): 1 - detects if URL starts with open braces (is contained inside braces) and stores it in "outer" named capture group 2 - checks if it starts with URL scheme also detecting whether scheme is SSL or not 3 - start parsing URL itself (will store it in "url" named capture group) 4-8 - if statement that says: if "sheme" was present then www. part is optional, otherwise mandatory for a string to be a link (so this regular expression detects all strings that start with either http or www) 9 - first character after http:// or www. should be either a letter or a number (this can be extended if you'd like to cover even more links, but I've decided not to because I can't think of a link that would start with some obscure character) 10-14 - if statement that says: if "outer" (braces) was present capture everything up to the last closing braces otherwise capture all 15 - closes the named capture group for URL 16 - if open braces were present, capture closing braces as well and store it in "ending" named capture group First and last line used to have \s* in them as well, so user could also write open braces and put a space inside before pasting link. Anyway. My code that does link replacement with actual anchor HTML elements looks exactly like this: value = Regex.Replace( value, @"(?<outer>\()?(?<scheme>http(?<secure>s)?://)?(?<url>(?(scheme)(?:www\.)?|www\.)[a-z0-9](?(outer)[-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+(?=\))|[-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+))(?<ending>(?(outer)\)))", "${outer}<a href=\"http${secure}://${url}\">http${secure}://${url}</a>${ending}", RegexOptions.Compiled | RegexOptions.CultureInvariant | RegexOptions.IgnoreCase); As you can see I'm using named capture groups to replace link with an Anchor tag: "${outer}<a href=\"http${secure}://${url}\">http${secure}://${url}</a>${ending}" I could as well omit the http(s) part in anchor display to make links look friendlier, but for now I decided not to. Question I would like my links to be replaced with shortenings as well. So when user copies a very long link (for instance if they would copy a link from google maps that usually generates long links) I would like to shorten the visible part of the anchor tag. Link would work, but visible part of an anchor tag would be shortened to some number of characters. I could as well append ellipsis at the end of at all possible (and make things even more perfect). Does Regex.Replace() method support replacement notations so that I can still use a single call? Something similar as string.Format() method does when you'd like to format values in string format (decimals, dates etc...).

    Read the article

  • Long string insertion with sed

    - by Luis Varca
    I am trying to use this expression to insert the contents of one text file into another after a give string. This is a simple bash script: TEXT=`cat file1.txt` sed -i "/teststring/a \ $TEXT" file2.txt This returns an error, "sed: -e expression #1, char 37: unknown command: `M'" The issue is in the fact that the contents of file1.txt are actually a private certificate so it's a large amount of text and unusual characters which seems to be causing an issue. If I replace $TEXT with a simple ASCII value it works but when it reads the large content of file1.txt it fails with that error. Is there some way to carry out this action? Is my syntax off with sed or my quote placement wrong?

    Read the article

  • Changing Windows 'hosts' file in guest OS under Parallels Desktop 6

    - by Jan
    Hi all, I am running Win7 in a Parallels Desktop 6 on Mac. I would like to modify my Windows hosts file. When doing this through notepad it says "You don't have permission to save in this location..." I am logged on as a regular windows user - not as 'local admin'. How can I edit the file? How can I grant my regular user 'local admin' rights? How can change the Windows user to 'admin' ... this option seems to be missing in my windows install... Does anybody recognize the issue? Thank you! J.

    Read the article

  • Norton Ghost usage, Linux? ISO? Server? MBR?

    - by OverTheRainbow
    Before evaluating Symantec/Norton Ghost to image partitions, I have a couple of questions about using this tool: In the product page, it only mentions Windows: Can Norton image Linux partitions as well? Can I burn an ISO to create/recover images? The ISO's I found seem only able to restore an image but not create one. Does it mean that images can only be created from within a running Windows? For Windows partitions: Does it support both regular and Server versions? Acronis doesn't image Server partitions in the regular version When restoring an image, does Norton give the option of including/excluding the MBR? Thank you.

    Read the article

  • rsync osx to linux

    - by Nick
    I did a backup to a remote nfs folder with rsync, from a MAC to a Remote Debian. The final backup is 58GB less than the original. Rsync says that everything was OK, and nothing to update. Macintosh:/Volumes/Data1 root# du -sh Produccion/ 319G Produccion/ root@Disketera:/mnt/soho_storage/samba/shares# du -sh Produccion/ 260G Produccion/ can I trust in rsync? I'm using rsync -av --stats /Volumes/Data1/Produccion/ /mnt/red/ (/mnt/red is my samba mountpoint) Some differents folders root@Disketera:/mnt/soho_storage/samba/shares/Produccion/tiposok# du -sh * 0 IndoSanBol 0 IndoSans-Bold 0 IndoSans-Italic 0 IndoSans-Light 0 IndoSans-Regular 40K PalatinoLTStd-Black.otf 40K PalatinoLTStd-BlackItalic.otf 40K PalatinoLTStd-Bold.otf 44K PalatinoLTStd-BoldItalic.otf 44K PalatinoLTStd-Italic.otf 40K PalatinoLTStd-Light.otf 40K PalatinoLTStd-LightItalic.otf 40K PalatinoLTStd-Medium.otf 40K PalatinoLTStd-MediumItalic.otf 56K PalatinoLTStd-Roman.otf 12K TCL IndoSans_mac Macintosh:/Volumes/Data1/Produccion/tiposok root# du -sh * 36K IndoSanBol 40K IndoSans-Bold 36K IndoSans-Italic 36K IndoSans-Light 36K IndoSans-Regular 40K PalatinoLTStd-Black.otf 40K PalatinoLTStd-BlackItalic.otf 40K PalatinoLTStd-Bold.otf 44K PalatinoLTStd-BoldItalic.otf 44K PalatinoLTStd-Italic.otf 40K PalatinoLTStd-Light.otf 40K PalatinoLTStd-LightItalic.otf 40K PalatinoLTStd-Medium.otf 40K PalatinoLTStd-MediumItalic.otf 56K PalatinoLTStd-Roman.otf 160K TCL IndoSans_mac

    Read the article

  • trie reg exp parse step over char and continue

    - by forest.peterson
    Setup: 1) a string trie database formed from linked nodes and a vector array linking to the next node terminating in a leaf, 2) a recursive regular expression function that if A) char '*' continues down all paths until string length limit is reached, then continues down remaining string paths if valid, and B) char '?' continues down all paths for 1 char and then continues down remaining string paths if valid. 3) after reg expression the candidate strings are measured for edit distance against the 'try' string. Problem: the reg expression works fine for adding chars or swapping ? for a char but if the remaining string has an error then there is not a valid path to a terminating leaf; making the matching function redundant. I tried adding a 'step-over' ? char if the end of the node vector was reached and then followed every path of that node - allowing this step-over only once; resulted in a memory exception; I cannot find logically why it is accessing the vector out of range - bactracking? Questions: 1) how can the regular expression step over an invalid char and continue with the path? 2) why is swapping the 'sticking' char for '?' resulting in an overflow? Function: void Ontology::matchRegExpHelper(nodeT *w, string inWild, Set<string> &matchSet, string out, int level, int pos, int stepover) { if (inWild=="") { matchSet.add(out); } else { if (w->alpha.size() == pos) { int testLength = out.length() + inWild.length(); if (stepover == 0 && matchSet.size() == 0 && out.length() > 8 && testLength == tokenLength) {//candidate generator inWild[0] = '?'; matchRegExpHelper(w, inWild, matchSet, out, level, 0, stepover+1); } else return; //giveup on this path } if (inWild[0] == '?' || (inWild[0] == '*' && (out.length() + inWild.length() ) == level ) ) { //wild matchRegExpHelper(w->alpha[pos].next, inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover);//follow path -> if ontology is full, treat '*' like a '?' } else if (inWild[0] == '*') matchRegExpHelper(w->alpha[pos].next, '*'+inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover); //keep adding chars if (inWild[0] == w->alpha[pos].letter) //follow self matchRegExpHelper(w->alpha[pos].next, inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover); //follow char matchRegExpHelper(w, inWild, matchSet, out, level, pos+1, stepover);//check next path } } Error Message: +str "Attempt to access index 1 in a vector of size 1." std::basic_string<char,std::char_traits<char>,std::allocator<char> > +err {msg="Attempt to access index 1 in a vector of size 1." } ErrorException Note: this function works fine for hundreds of test strings with '*' wilds if the extra stepover gate is not used Semi-Solved: I place a pos < w->alpha.size() condition on each path that calls w->alpha[pos]... - this prevented the backtrack calls from attempting to access the vector with an out of bounds index value. Still have other issues to work out - it loops infinitely adding the ? and backtracking to remove it, then repeat. But, moving forward now. Revised question: why during backtracking is the position index accumulating and/or not deincrementing - so at somepoint it calls w->alpha[pos]... with an invalid position that is either remaining from the next node or somehow incremented pos+1 when passing upward?

    Read the article

  • Windows 7 blocks network access to network-installed apps

    - by VokinLoksar
    Windows 2008 R2 domain. Users, running Windows 7 Enterprise, are trying to run some software from a network share. Specifically, I've tested this with MATLAB and PuTTY. When starting, MATLAB has to contact a licensing server to get its license. This action fails for regular users when they start MATLAB from the network share. However, if they copy the installation directory to a local disk everything works fine. Running MATLAB as an admin user from the network share also works. Same story with PuTTY. If the executable is launched from the share, regular users cannot connect to any servers. Something is blocking network communications for programs that are launched from a network drive. Here's the only other mention I could find of the same problem: https://social.technet.microsoft.com/Forums/en-US/w7itpronetworking/thread/4504b192-0bc0-4402-8e00-a936ea7e6dff It's not the Windows firewall or the IE security settings. Does anyone have any clue as to what this is?

    Read the article

  • Font display issue (Mac OS X)?

    - by avenas8808
    I used a font manager on Mac OS X, for additional fonts in my graphic design projects without installing them to the fonts folder (I think that's how it works) - using Font Book and Font Explorer X Version 1.2.3 on OS X 10.6. Most fonts work fine, but Interstate has a problem: Interstate Regular is installed, but for some reason it's probably not seeing it; it's seeing all the Bold and Condensed versions fine. In the above image, it displays the second font as Interstate Regular, but it isn't that font... why? Also, how do I reset the system fonts folder back to the default-installed fonts (I think it's in the library folder) if worst comes to worst, and is using a font manager on Mac or Windows a good idea? I don't want to wreck my system, fairly new to using Mac, especially OS X, so any help would be gratefully accepted.

    Read the article

  • ESXi with non-headless VM

    - by Mike
    I'm going to receive a Xeon Server/Workstation soon and I was thinking about installing ESXi to host some server applications that I want (ex: SVN server, Web server, media server, etc). Most of these will be headless VM's. My question is: on top of all these headless VM's, is it possible for ESXi to have another VM that would be non-headless (so that it will output video through the VGA/DVI port)? Or are all VM's within ESXi only accessible through remote connections? I'll be using this non-headless VM like a regular workstation: browsing, development, media, gaming maybe. The other alternative I was thinking about is to install a very lightweight operating system and have the headless VM's running in Virtualbox. If it is possible to have have a non-headless VM, what would be the performance compared to a regular workstation? Noticeable or not when gaming?

    Read the article

  • Yahoo toolbar and local sites (e.g. Intranet)

    - by Klaptrap
    We have local sites running on IIS in regular MS Windows network. User base has IE, FireFox and Chrome. Local sites are isolated by host headers and DNS record created for the common IP accordingly. This is a regular set-up. Users without Yahoo Toolbar type http://intranet and the sites resolves. Users with Yahoo toolbar type http://intranet and the toolbar goes off to search for this site in public domain. This is irrespective to whether the address is typed into the browser address bar or the toolbar. All versions of toolbar and IE are affected. I cannot see a setting on the toolbar to switch this "irritating" behaviour off and simply un-installing the toolbar is not an option. Any ideas?

    Read the article

  • How do I remove Windows Update uninstall files on Windows Server 2008?

    - by Robert Koritnik
    I'm running Windows Server 2008 Standard running in VMware. It has 2 disks: system disk: 16 GB data disk: 500 MB I installed Visual Studio 2008 SP1 + MSDN and some small tools and libraries that don't take much space. Over time the system disk's free space has been going down (I suspect because of regular system updates - NetFx (.NET), service packs, and regular updates). Questions 1 How do you remove Windows Update uninstall files from Windows Server 2008? Question 2 I also found lots of files in C:/Windows/Installer folder. Is it possible to determine which .msp file goes with which patch? I would like to delete some of them, because they do take a lot of space.

    Read the article

  • Case in-sensitivity for Apache httpd Location directive

    - by user57178
    I am working with a solution that requires the usage of mod_proxy_balancer and an application server that both ignores case and mixes different case combinations in URLs found in generated content. The configuration works, however I have now a new requirement that causes problems. I should be able to create a location directive (as per http://httpd.apache.org/docs/current/mod/core.html#location ) and have the URL-path interpret in case insensitive mode. This requirement comes from the need to add authentication directives to the location. As you might guess, users (or the application in question) changing one letter to capital circumvents the protection instantly. The httpd runs on Unix platform so every configuration directive is apparently case sensitive by default. Should the regular expressions in the Location directive work in this case? Could someone please show me an example of such configuration that should work? In case a regular expression can not be forced to work case insensitively, what part of httpd's source code should I go around modifying?

    Read the article

  • Frequent connection drops when playing online games (StarCraft 2, Battlefield 3) and behind NAT - how to diagnose? [migrated]

    - by Moshev
    I am having some trouble with (I suspect) my wireless router. It's connected to the internet with a regular lan cable and has a static, public IP address. Our two home PCs connect to the router with regular lan cables, plus there's a laptop which connects over wifi. diagram: Internet | | <- isp-supplied cat5 ethernet cable | D-Link D300 ...wifi... laptop / \ / <- cable -> \ PC1 PC2 The PCs and laptop are behind NAT and share the router's public IP. The router is a D-Link D300. PC1 is used for online gaming and I'm experiencing frequent "connection dropped" errors when playing Battlefield 3, StarCraft 2 and the Diablo 3 beta; but not with TeamFortress 2 or the Tribes Ascend beta. The issue goes away when I remove the router and connect PC1 directly to the ISP's cable. I have also tried disconnecting PC2 and the laptop, leaving PC1 as the only machine connected to the router - doesn't help. How can I diagnose what precisely the issue is?

    Read the article

  • How many hours of use before I need to clean a tape drive?

    - by codeape
    I do backups to a HP Ultrium 2 tape drive (HP StorageWorks Ultrium 448). The drive has a 'Clean' LED that supposedly will light up or blink when the drive needs to be cleaned. The drive has been in use since october 2005, and still the 'Clean' light has never been lit. The drive statistics are: Total hours in use: 1603 Total bytes written: 19.7 TB Total bytes read: 19.3 TB My question is: How many hours of use can I expect before I need to clean the drive? Edit: I have not encountered any errors using the drive. I do restore tests every two months, and every backup is verified. Edit 2: The user manual says: "HP StorageWorks Ultrium tape drives do not require regular cleaning. An Ultrium universal cleaning cartridge should only be used when the orange Clean LED is flashing." Update: It is now May 2010 (4.5 years of use), and the LED is still off, I have not cleaned, backups verify and regular restore tests are done.

    Read the article

  • Do you think Microsoft is finally on the right track with its Windows 7?

    - by Saif Bechan
    It has been a while now since Windows 7 has been released. So far I didn't hear of many major complaints about it. I can remember the time that Windows Vista hist the shelves. There were major complaints from both experts and just regular users. I do a lot of OS installs for just regular users. These are mostly family and friends, and sometimes there are some customers. Up till now I mostly still use Windows XP SP3, because it is stable and most people are familiar with it. I did Vista for some users but they always call me back with all sorts of questions and in the end I had to downgrade them to XP. Do you think it is safe now to recommend Windows 7 as a good operating system? Offcourse their hardware has to support it, but let's say that is the case. If you install Windows 7 a lot for people, what are the complaints about if you get them?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Frequent connection drops when playing online games (StarCraft 2, Battlefield 3) and behind NAT - how to diagnose?

    - by Moshev
    I am having some trouble with (I suspect) my wireless router. It's connected to the internet with a regular lan cable and has a static, public IP address. Our two home PCs connect to the router with regular lan cables, plus there's a laptop which connects over wifi. diagram: Internet | | <- isp-supplied cat5 ethernet cable | D-Link D300 ...wifi... laptop / \ / <- cable -> \ PC1 PC2 The PCs and laptop are behind NAT and share the router's public IP. The router is a D-Link D300. PC1 is used for online gaming and I'm experiencing frequent "connection dropped" errors when playing Battlefield 3, StarCraft 2 and the Diablo 3 beta; but not with TeamFortress 2 or the Tribes Ascend beta. The issue goes away when I remove the router and connect PC1 directly to the ISP's cable. I have also tried disconnecting PC2 and the laptop, leaving PC1 as the only machine connected to the router - doesn't help. How can I diagnose what precisely the issue is?

    Read the article

  • Can someone help me compare using F# over C# in this specific example (IP Address expressions)?

    - by Phobis
    So, I am writing code to parse and IP Address expression and turn it into a regular expression that could be run against and IP Address string and return a boolean response. I wrote the code in C# (OO) and it was 110 lines of code. I am trying to compare the amount of code and the expressiveness of C# to F# (I am a C# programmer and a noob at F#). I don't want to post both the C# and F#, just because I don't want to clutter the post. If needed, I will do so. Anyway, I will give an example. Here is an expression: 192.168.0.250,244-248,108,51,7;127.0.0.1 I would like to take that and turn it into this regular expression: ((192.168.0.(250|244|245|246|247|248|108|51|7))|(127.0.0.1)) Here are some steps I am following: Operations: Break by ";" 192.168.0.250,244-248,108,51,7 127.0.0.1 Break by "." 192 168 0 250,244-248,108,51,7 Break by "," 250 244-248 108 51 7 Break by "-" 244 248 I came up with F# that produces the output. I am trying to forward-pipe through my operations listed above, as I think that would be more expressive. Can anyone make this code better? Teach me something :) open System let createItemArray (group:bool) (y:char) (items:string[]) = [| let indexes = items.Length - 1 let group = indexes > 0 && group if group then yield "(" for i in 0 .. indexes do yield items.[i].ToString() if i < indexes then yield y.ToString() if group then yield ")" |] let breakBy (group:bool) (x:string) (y:char): string[] = x.Split(y) |> createItemArray group y let breakItem (x:string) (y:char): string[] = breakBy false x y let breakGroup (x:string) (y:char): string[] = breakBy true x y let AddressExpression address:string = let builder = new System.Text.StringBuilder "(" breakGroup address ';' |> Array.collect (fun octet -> breakItem octet '.') |> Array.collect (fun options -> breakGroup options ',') |> Array.collect (fun (ranges : string) -> match (breakGroup ranges '-') with | x when x.Length > 3 -> match (Int32.TryParse(x.[1]), Int32.TryParse(x.[3])) with | ((true, a) ,(true, b)) -> [|a .. b|] |> Array.map (int >> string) |> createItemArray false '-' | _ -> [|ranges|] | _ -> [|ranges|] ) |> Array.iter (fun item -> match item with | ";" -> builder.Append ")|(" | "." -> builder.Append "\." | "," | "-" -> builder.Append "|" | _ -> builder.Append item |> ignore ) builder.Append(")").ToString() let address = "192.168.0.250,244-248,108,51,7;127.0.0.1" AddressExpression address

    Read the article

  • How to specify Multiple Secure Webpages with .htaccess RewriteCond

    - by Patrick Ndille
    I have 3 pages that I want to make secure on my website using .htaccess -login.php -checkout.php -account.php I know how to make just one work page at a time using .htaccess RewriteEngine On RewriteCond %{HTTPS} off RewriteCond %{REQUEST_URI} /login.php RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] I and trying to figure out how to include the other 2 specific pages to make them also secure and used the expression below but it didn't work RewriteEngine On RewriteCond %{HTTPS} off RewriteCond %{REQUEST_URI} /login.php RewriteCond %{REQUEST_URI} /checkout.php RewriteCond %{REQUEST_URI} /account.php RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] Can someone help me the right expression that will work with multiple pages? The second part of the code is that, if https is already on and a user move to a page that Is not any of the pages i specified about, I want that it should get back to http. how should I write the statement for it to redirect back to http if its not any of the pages above? I have my statement like this but its not working RewriteCond %{HTTPS} on RewriteRule !(checkout|login|account|payment)\.php http://%{HTTP_HOST}%{REQUEST_URI} [L,R] Any thoughts?

    Read the article

  • How to stop windows from adding additional keyboards to languages

    - by MMavipc
    I have the English language setup with the normal en-us layout, and only this layout. I have the Spanish language setup with united states - international layout. When I switch to English it gives me the option to select the regular keyboard or the international version. Only the regular version is listed under EN in my language settings. How do I get it to remove the international keyboard from English? Sometimes it switches to international while I'm on English mode and screws up my typing, which is a pain in the ass.

    Read the article

< Previous Page | 90 91 92 93 94 95 96 97 98 99 100 101  | Next Page >