Search Results

Search found 9180 results on 368 pages for 'space dust'.

Page 94/368 | < Previous Page | 90 91 92 93 94 95 96 97 98 99 100 101  | Next Page >

  • Flash CS5 font is largest part of the SWF

    - by dev.e.loper
    I'm transferring a project from CS4 to CS5 and (without any changes) my SWF file gets to be 10 times bigger. It was 7kb and now it's 77kb. I generated a size report and it looks like the font is taking up most of the space. I haven't changed settings. I'm not sure why font is taking up so much space. Is there a way around this? Here is my size report: Font Name Bytes Characters ----------------- ---------- ---------- _sans 12 MilkyWell 317 .blsu Calibri-Bold Bold 75960 %.0123456789 As you can see Calibri-Bold is taking up 75kb and I only have 12 characters in it.

    Read the article

  • Oracle Hash Cluster Overflow Blocks

    - by Andrew
    When inserting a large number of rows into a single table hash cluster in Oracle, it will fill up the block with any values that hash to that hash-value and then start using overflow blocks. These overflow blocks are listed as chained off the main block, but I can not find detailed information on the way in which they are allocated or chained. When an overflow block is allocated for a hash value, is that block exclusively allocated to that hash value, or are the overflow blocks used as a pool and different hash values can then start using the same overflow block. How is the free space of the chain monitored - in that, as data is continued to be inserted, does it have to traverse the entire chain to find out if it has some free space in the current overflow chain, and then if it finds none, it then chooses to allocate a new block?

    Read the article

  • Sync GIT and ClearCase

    - by Senthil A Kumar
    I am currently working on ClearCase and now migrating to GIT. But we need this migration in a way that all work will be done in GIT and the data will be synced backed to ClearCase stream. We will have the same branch names and stream names in both GIT and CC, so scripting shouldn't be a problem. The problem here is, Can someone suggest which is the best model to sync CC and GIT Have all the Vobs in CC as single repo in GIT, and have the major stream in CC as various branches in GIT. - Single GIT repo (VOBS) and many branches (CC streams). - This takes up less space as VOBs are kept as single repo with many branches. Have important CC branches as independent GIT repositories and each repository having all the CC VOBs. - Many GIT repo for many CC branch - This will take up lots of space as VOBs will be replicated across. Which do you think is the best way to keep it in sync with ClearCase

    Read the article

  • Enabling full documentation for J2EE in eclipse

    - by maayank
    I'm new to Eclipse and am using it currently to play with J2EE. When using Ctrl+Space for types/functions from the regular Java libraries I get a full description (i.e. general description of the type, what are the arguments of the method for, etc.). However I don't get the same for J2EE types. For example, when using Ctrl+Space on methods of the HttpSession class I get only names like "arg0" or "obj" and no description. Is there some kind of a package I can install to remedy this?

    Read the article

  • Strange error in SpringMVC Application Startup

    - by Euzel Villanueva
    I'm getting a very strange stack trace when trying to load a SpringMVC application and at a lost to why this is occurring. org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'org.springframework.web.servlet.mvc.annotation.AnnotationMethodHandlerAdapter#0': Cannot create inner bean '(inner bean)' of type [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter] while setting bean property 'messageConverters' with key [4]; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name '(inner bean)#6': Instantiation of bean failed; nested exception is org.springframework.beans.BeanInstantiationException: Could not instantiate bean class [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter]: Constructor threw exception; nested exception is java.lang.OutOfMemoryError: Java heap space at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveInnerBean(BeanDefinitionValueResolver.java:281) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveValueIfNecessary(BeanDefinitionValueResolver.java:125) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveManagedList(BeanDefinitionValueResolver.java:353) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveValueIfNecessary(BeanDefinitionValueResolver.java:153) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.applyPropertyValues(AbstractAutowireCapableBeanFactory.java:1325) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.populateBean(AbstractAutowireCapableBeanFactory.java:1086) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:517) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:291) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:222) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:288) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:190) at org.springframework.beans.factory.support.DefaultListableBeanFactory.preInstantiateSingletons(DefaultListableBeanFactory.java:580) at org.springframework.context.support.AbstractApplicationContext.finishBeanFactoryInitialization(AbstractApplicationContext.java:895) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:425) at org.springframework.web.servlet.FrameworkServlet.createWebApplicationContext(FrameworkServlet.java:442) at org.springframework.web.servlet.FrameworkServlet.createWebApplicationContext(FrameworkServlet.java:458) at org.springframework.web.servlet.FrameworkServlet.initWebApplicationContext(FrameworkServlet.java:339) at org.springframework.web.servlet.FrameworkServlet.initServletBean(FrameworkServlet.java:306) at org.springframework.web.servlet.HttpServletBean.init(HttpServletBean.java:127) at javax.servlet.GenericServlet.init(GenericServlet.java:160) at org.apache.catalina.core.StandardWrapper.initServlet(StandardWrapper.java:1133) at org.apache.catalina.core.StandardWrapper.loadServlet(StandardWrapper.java:1087) at org.apache.catalina.core.StandardWrapper.load(StandardWrapper.java:996) at org.apache.catalina.core.StandardContext.loadOnStartup(StandardContext.java:4834) at org.apache.catalina.core.StandardContext$3.call(StandardContext.java:5155) at org.apache.catalina.core.StandardContext$3.call(StandardContext.java:5150) at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:303) at java.util.concurrent.FutureTask.run(FutureTask.java:138) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:619) Caused by: org.springframework.beans.factory.BeanCreationException: Error creating bean with name '(inner bean)#6': Instantiation of bean failed; nested exception is org.springframework.beans.BeanInstantiationException: Could not instantiate bean class [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter]: Constructor threw exception; nested exception is java.lang.OutOfMemoryError: Java heap space at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.instantiateBean(AbstractAutowireCapableBeanFactory.java:965) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBeanInstance(AbstractAutowireCapableBeanFactory.java:911) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:485) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveInnerBean(BeanDefinitionValueResolver.java:270) ... 31 more Caused by: org.springframework.beans.BeanInstantiationException: Could not instantiate bean class [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter]: Constructor threw exception; nested exception is java.lang.OutOfMemoryError: Java heap space at org.springframework.beans.BeanUtils.instantiateClass(BeanUtils.java:141) at org.springframework.beans.factory.support.SimpleInstantiationStrategy.instantiate(SimpleInstantiationStrategy.java:74) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.instantiateBean(AbstractAutowireCapableBeanFactory.java:958) ... 35 more

    Read the article

  • ffmpeg screen capture

    - by Mirai
    I wrote this script for some basic screen capture; it gets the window dimensions then uses the ffmpeg binary to record. I suspect there is a better way (maybe with the ffmpeg library), but scripting is what I know and ffmpeg generally works. Any software (other than recordmydesktop), or improvements to the script are welcome. info=`xwininfo -frame` H=`echo "$info" | grep Height | sed -E "s/^.*: ([[:digit:]]+)$/\1/"` W=`echo "$info" | grep Width | sed -E "s/^.*: ([[:digit:]]+)$/\1/"` offset=:0.0+`echo "$info" | grep Corners | sed -E "s/^.*:[[:space:]]+\+([[:digit:]]+\+[[:digit:]]+)[[:space:]]+.+/\1/" | tr + ,` /usr/local/bin/ffmpeg -f x11grab -s ${W}x${H} -r 45 -i $offset -sameq -f avi ~/videos/`date +%Y-%m-%d-%H%M%s`_vid & echo $! > /tmp/$(basename $0)-$USER

    Read the article

  • How to sort in-place using the merge sort algorithm?

    - by eSKay
    I know the question is too open. All I want is someone to tell me how to convert a normal merge sort into an in-place merge sort (or a merge sort with constant extra space overhead). All I can find (on the net) is pages saying "it is too complex" or "out of scope of this text". "The only known ways to merge in-place (without any extra space) are too complex to be reduced to practical program." (from here) Even if it is too complex, can somebody outline the basic concept of how to make the merge sort in-place?

    Read the article

  • Doubts in System call mechanism in linux

    - by bala1486
    We transit from ring3 to ring0 using 'int' or the new 'syscall/sysenter' instruction. Does that mean that the page tables and other stuffs that needs to be modified for the kernel is automatically done by the 'int' instruction or the interrupt handler for the 'int 0x80' will do the required stuff and jump to the respective system call. Also when returning from a system call, we again need to go to user space. For this we need to know the instruction address in the user space to continue the user application. Where is that address stored. Does the 'ret' instruction automatically changes the ring from ring3 to ring0 or where/how this ring changing mechanism takes place? Then, i read that changing from ring3 to ring0 is not as costly as changing from ring0 to ring3. Why is this so?? Thanks, Bala

    Read the article

  • Regex-expression with danish characters

    - by timkl
    I'm currently trying to wrap my head around regex, I have a validation snippet that tests an input box against a regex-expression: $.validator.addMethod("customerName", function(value, element){ return (/^[a-zA-Z]*$/).test(value); }, "Some text"); That works well, but when I try to add a space and some special danish characters, it doesn't filter the danish characters, only the space. $.validator.addMethod("customerName", function(value, element){ return (/^[a-zA-Z æøåÆØÅ]*$/).test(value); }, "Some text"); Any ideas to what could be wrong?

    Read the article

  • parsing string off a configuration using strtok in C

    - by Jessica
    in the configuration file i have entries similar to this one: filepath = c:\Program Files\some value Where the path can contain spaces and there are no quotes on that string. I tried parsing this with strtok like: char *option; char *value; value = strtok(line, " ="); strcpy(option, value); value = strtok(NULL, " ="); where line is the line I am reading from the file, option will contain the left side of the equal (filepath) and value will contain the right side (c:\program files\some value). I know, it's poor coding, but I haven't found something better. sorry... In any case, for those options where there's no space in the right side it works great, but in those containing spaces it only return the string until the 1st space: c:\Program. Is there any other way to do this? Code is appreciated. Jessica

    Read the article

  • Pros and cons of ways of storing an unsigned int without an unsigned int data type

    - by fields
    I have values that are 64-bit unsigned ints, and I need to store them in mongodb, which has no unsigned int type. I see three main possibilities for storing them in other field types, and converting on going in and out: Using a signed int is probably easiest and most space efficient, but has the disadvantage that they're not human readable and if someone forgets to do the conversion, some of them will work, which may obscure errors. Raw binary is probably most difficult for inexperienced programmers to deal with, and also suffers from non-human-readability. A string representation is the least space efficient (~40 bytes in unicode vs 8 bytes per field), but then at least all of the possible values will map properly, and for querying only a conversion to string is required instead of a more complicated conversion. I need these values to be available from different platforms, so a single driver-specific solution isn't an option. Any major pros and cons I've missed? Which one would you use?

    Read the article

  • Fixed footer with 960.gs

    - by Oguz
    I want to create fixed footer but , is it possible with 960 gs , because I am having trouble with height of container div . I can no set it to %100. <div class="container_12" > <div class="grid_3" id="side-space"></div> <div class="grid_6"> <div id="content-box"></div> </div> <div class="grid_3" id="side-space"></div> </div>

    Read the article

  • ack (perl?) regexp matching lines where if is the first word

    - by Gauthier
    Hey. I'm finally learning regexps, training with ack. I believe this uses perl regexp. I want to match all lines where the first non-blank characters are if (<word> !, with any number of spaces in between the elements. This is what I came up with: ^[ \t]*if *\(\w+ *! It only nearly worked. ^[ \t]* is wrong, since it matches one or none [space or tab]. What I want is to match anything that may contain only space or tab (or nothing). For example these should not match: // if (asdf != 0) else if (asdf != 1) How can I modify my regexp for that?

    Read the article

  • Variable length Blob in hibernate?

    - by Seth
    I have a byte[] member in one of my persistable classes. Normally, I'd just annotate it with @Lob and @Column(name="foo", size=). In this particular case, however, the length of the byte[] can vary a lot (from ~10KB all the way up to ~100MB). If I annotate the column with a size of 128MB, I feel like I'll be wasting a lot of space for the small and mid-sized objects. Is there a variable length blob type I can use? Will hibernate take care of all of this for me behind the scenes without wasting space? What's the best way to go about this? Thanks!

    Read the article

  • increasing amazon root volume size

    - by OCD
    I have a default amazon ec2 instance with 8GB root volume size. I am running out of space. I have: Detach the current EBS volume in AWS Management Console (Web). Create snapshot of this volume. Created a new Volume with 50G space with my snapshot. Attach the new volume back to the instance to /dev/sda1 However, when I reconnect to the account with: > df -h I can see from the management console that my new Filesystem 1K-blocks Used Available Use% Mounted on /dev/xvda1 8256952 8173624 0 100% / tmpfs 308508 40 308468 1% /dev/shm It's still not using my new volume's size, how to make this work?

    Read the article

  • Way to get VS 2008 to stop forcing indentation on namespaces?

    - by Earlz
    I've never really been a big fan of the way most editors handle namespaces. They always force you to add an extra pointless level of indentation. For instance, I have a lot of code in a page that I would much rather prefer formatted as namespace mycode{ class myclass{ void function(){ foo(); } void foo(){ bar(); } void bar(){ //code.. } } } and not something like namespace mycode{ class myclass{ void function(){ foo(); } void foo(){ bar(); } void bar(){ //code.. } } } Honestly, I don't really even like the class thing being indented most of the time because I usually only have 1 class per file. And it doesn't look as bad here, but when you get a ton of code and lot of scopes, you can easily have indentation that forces you off the screen, and plus here I just used 2-space tabs and not 4-space as is used by us. Anyway, is there some way to get Visual Studio to stop trying to indent namespaces for me like that?

    Read the article

  • jquery ui modal dialog problems in IE

    - by JohnM2
    I use jquery ui dialog widget. Everything works fine in FF, Opera etc., except IE. The problem is that when dialog is opened in Internet Explorer, some space (not covered with that "modal gray layer") is added at the bottom of the document, and page is scrolled to the bottom. So I don't even see the dialog, I have to scroll up, to see it fully. Anyone had that problems? Any solutions? EDIT: now I see, that this "bottom space" is also added in FireFox, but it doesn't scroll to it like in IE.

    Read the article

  • What Regex can strip e.g. "note:" and "firstName: " from the left of a string?

    - by Edward Tanguay
    I need to strip the "label" off the front of strings, e.g. note: this is a note needs to return: note and this is a note I've produced the following code example but am having trouble with the regexes. What code do I need in the two ???????? areas below so that I get the desired results shown in the comments? using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Text.RegularExpressions; namespace TestRegex8822 { class Program { static void Main(string[] args) { List<string> lines = new List<string>(); lines.Add("note: this is a note"); lines.Add("test: just a test"); lines.Add("test:\t\t\tjust a test"); lines.Add("firstName: Jim"); //"firstName" IS a label because it does NOT contain a space lines.Add("She said this to him: follow me."); //this is NOT a label since there is a space before the colon lines.Add("description: this is the first description"); lines.Add("description:this is the second description"); //no space after colon lines.Add("this is a line with no label"); foreach (var line in lines) { Console.WriteLine(StringHelpers.GetLabelFromLine(line)); Console.WriteLine(StringHelpers.StripLabelFromLine(line)); Console.WriteLine("--"); //note //this is a note //-- //test //just a test //-- //test //just a test //-- //firstName //Jim //-- // //She said this to him: follow me. //-- //description //this is the first description //-- //description //this is the first description //-- // //this is a line with no label //-- } Console.ReadLine(); } } public static class StringHelpers { public static string GetLabelFromLine(this string line) { string label = line.GetMatch(@"^?:(\s)"); //??????????????? if (!label.IsNullOrEmpty()) return label; else return ""; } public static string StripLabelFromLine(this string line) { return ...//??????????????? } public static bool IsNullOrEmpty(this string line) { return String.IsNullOrEmpty(line); } } public static class RegexHelpers { public static string GetMatch(this string text, string regex) { Match match = Regex.Match(text, regex); if (match.Success) { string theMatch = match.Groups[0].Value; return theMatch; } else { return null; } } } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Portable way of finding total disk size in Java (pre java 6)

    - by Wouter Lievens
    I need to find the total size of a drive in Java 5 (or 1.5, whatever). I know that Java 6 has a new method in java.io.File, but I need it to work in Java 5. Apache Commons IO has org.apache.commons.io.FileSystemUtils to provide the free disk space, but not the total disk space. I realize this is OS dependant and will need to depend on messy command line invocation. I'm fine with it working on "most" systems, i.e. windows/linux/macosx. Preferably I'd like to use an existing library rather than write my own variants. Any thoughts? Thanks.

    Read the article

  • how Can we get the output format to CSV instead of HTML in Alfresco using webscripts?

    - by pavan123
    how Can we change the output format to CSV instead of HTML in Alfresco using webscripts? below are the my corresponding FTL and Webscript files recursive.get.html.ftl <#macro recurse_macro node depth> <#if node.isContainer> <tr> <td> ${node.properties.name} </td> <td></td> </tr> <#list node.children as child> <#if child.isContainer> <@recurse_macro node=child depth=depth+1/> <#list child.children as child2> <#if child2.isDocument> <tr><td></td><td>${child2.properties.name}</td></tr> </#if> </#list> </#if> </#list> </#if> </#macro> Recursive Listing of Spaces & Documents: Space Document recursive.get.desc.xml <webscript> <shortname>recurcive</shortname> <description>Recursive</description> <url>/sample/recursive/{recursive}</url> <format default="html">extension</format> <authentication>guest</authentication> </webscript> and html output is Recursive Listing of Spaces & Documents: Space Document Company Home Data Dictionary Space Templates Software Engineering Project Documentation Drafts Pending Approval Published Samples system-overview.html Discussions UI Design Presentations Quality Assurance Presentation Templates doc_info.ftl localizable.ftl my_docs.ftl my_spaces.ftl my_summary.ftl translatable.ftl recent_docs.ftl general_example.ftl my_docs_inline.ftl show_audit.ftl readme.ftl Email Templates notify_user_email.ftl invite_user_email.ftl RSS Templates RSS_2.0_recent_docs.ftl Saved Searches admin Scripts backup.js example test script.js backup and log.js append copyright.js alfresco docs.js test return value.js Web Scripts org alfresco sample blogsearch.get.js blogsearch.get.atom.ftl blogsearch.get.desc.xml blogsearch.get.html.ftl blogsearch.get.html.400.ftl blogsearch.get.atom.400.ftl categorysearch.get.js categorysearch.get.atom.ftl categorysearch.get.desc.xml categorysearch.get.html.ftl categorysearch.get.html.404.ftl categorysearch.get.atom.404.ftl folder.get.js folder.get.atom.ftl folder.get.desc.xml folder.get.html.ftl avmstores.get.desc.xml avmstores.get.html.ftl avmbrowse.get.js avmbrowse.get.desc.xml avmbrowse.get.html.ftl recursive.get.desc.xml recursive.get.html.ftl sgs.get.desc.xml sgs.get.csv.ftl sample1.get.desc.xml sample1.get.csv.ftl first.get.desc.xml first.get.text.ftl rag.get.html.ftl rag.get.desc.xml new1.get.desc.xml new1.get.html.ftl excel.get.html.ftl excel.get.desc.xml sgs1.get.desc.xml one.get.html.ftl one.get.desc.xml one.get.js readme.html Web Scripts Extensions readme.html Guest Home Alfresco-Tutorial.pdf User Homes isabel Users Home

    Read the article

  • HTML list wrapping problem

    - by Daniel
    I have a HTML list with this style: font-weight: bold; padding: 0px; margin: 0px; list-style-type: none; display: block; width:700px; font-size: 14px; white-space: pre-wrap; and the cells have this style: display: inline; and I have spacer cells between each cell with this style: padding-right: 20px; display: inline; My problem is that when the list is too long for its 700 pixels, it wraps. I want this, but I dont want the objects to be on two separate lines. I have tried the CSS white-space property, but nothing seems to work. Any ideas?

    Read the article

< Previous Page | 90 91 92 93 94 95 96 97 98 99 100 101  | Next Page >