Search Results

Search found 24719 results on 989 pages for 'ajax form'.

Page 982/989 | < Previous Page | 978 979 980 981 982 983 984 985 986 987 988 989  | Next Page >

  • Help required in adding new methods, properties into existing classes dynamically

    - by Bepenfriends
    Hi All, I am not sure whether it is possible to achieve this kind of implementation in Dot Net. Below are the information Currently we are on an application which is done in COM+, ASP, XSL, XML technologies. It is a multi tier architecture application in which COM+ acts as the BAL. The execution steps for any CRUD operation will be defined using a seperate UI which uses XML to store the information. BAL reads the XML and understands the execution steps which are defined and executes corresponding methods in DLL. Much like EDM we have our custom model (using XML) which determines which property of object is searchable, retrievable etc. Based on this information BAL constructs queries and calls procedures to get the data. In the current application both BAL and DAL are heavily customizable without doing any code change. the results will be transmitted to presentation layer in XML format which constructs the UI based on the data recieved. Now I am creating a migration project which deals with employee information. It is also going to follow the N Tier architecture in which the presentation layer communicates with BAL which connects to DAL to return the Data. Here is the problem, In our existing version we are handling every information as XML in its native form (no converstion of object etc), but in the migration project, Team is really interested in utilizing the OOP model of development where every information which is sent from BAL need to be converted to objects of its respective types (example employeeCollection, Address Collection etc). If we have the static number of data returned from BAL we can have a class which contains those nodes as properties and we can access the same. But in our case the data returned from our BAL need to be customized. How can we handle the customization in presentation layer which is converting the result to an Object. Below is an example of the XML returned <employees> <employee> <firstName>Employee 1 First Name</firstName> <lastName>Employee 1 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>3</addressType> <StreetName>Street name3</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> <employee> <firstName>Employee 2 First Name</firstName> <lastName>Employee 2 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> </employees> If these are the only columns then i can write a class which is like public class Address{ public int AddressType {get;set;}; public string StreetName {get;set;}; public string RegionName {get;set;}; } public class Employee{ public string FirstName {get; set;} public string LastName {get; set;} public string AddressCollection {get; set;} } public class EmployeeCollection : List<Employee>{ public bool Add (Employee Data){ .... } } public class AddressCollection : List<Address>{ public bool Add (Address Data){ .... } } This class will be provided to customers and consultants as DLLs. We will not provide the source code for the same. Now when the consultants or customers does customization(example adding country to address and adding passport information object with employee object) they must be able to access those properties in these classes, but without source code they will not be able to do those modifications.which makes the application useless. Is there is any way to acomplish this in DotNet. I thought of using Anonymous classes but, the problem with Anonymous classes are we can not have methods in it. I am not sure how can i fit the collection objects (which will be inturn an anonymous class) Not sure about datagrid / user control binding etc. I also thought of using CODEDom to create classes runtime but not sure about the meory, performance issues. also the classes must be created only once and must use the same till there is another change. Kindly help me out in this problem. Any kind of help meterial/ cryptic code/ links will be helpful.

    Read the article

  • Why I can't implement this simple CSS

    - by nXqd
    <!DOCTYPE html> <html lang="en"> <head> <title>Enjoy BluePrint</title> <link rel="stylesheet" href="css/blueprint/screen.css" type="text/css" media="screen, projection"> <link rel="stylesheet" href="css/blueprint/print.css" type="text/css" media="print"> <!--[if lt IE 8]><link rel="stylesheet" href="css/blueprint/ie.css" type="text/css" media="screen, projection"><![endif]--> <!-- <link rel="stylesheet" href="global.css" type="text/css" media="screen"> --> <script type="text/css"> h1.logo { width:181px; height:181px; background: url("img/logo.png"); text-indent: -9999px; } </script> </head> <body> <div class="container"> <!-- Header --> <div id="header" class="span-24"> <div id="logo" class="span-6"> <h1 class="logo">This is my site</h1> </div> <div id="script" class="span-10"> <p>Frank Chimero is a graphic designer, illustrator, teac`her, maker, writer, thinker-at-large in Portland, Oregon.</p> </div> <div id="contact" class="span-8 last"> contact </div> </div> <!-- Content --> <div id="main-content" class="span-12"> <h3>DISCOVERY</h3> <p>My fascination with the creative process, curiosity, and visual experience informs all of my work in some way. Each piece is the part of an exploration in finding wit, surprise, honesty, and joy in the world around us, then, trying to document those things with all deliberate speed before they vanish.</p><br/> <p>Our creative output can have a myriad intended outcomes: to inform, to persuade or sell, or delight. There are many other creative people who do well in servicing the needs to inform or persuade, but there are not many out there who have taken up the mantle of delighting people. I’ll try my best.</p><br/> <p>It’s not about pretty; it is about beauty. Beauty in form, sure, but also beauty in the fit of a bespoke idea that transcends not only the tasks outlined, but also fulfilling the objectives that caused the work to be produced in the first place.</p><br/> <p>The best creative work connects us by speaking to what we share. From that, we hope to make things that will last. Work made without staying power and lasting relevance leads to audiences that are fickle, strung along on a diet of crumbs.</p><br/> <p>The work should be nourishing in some way, both while a creative person is making it, but also while someone consumes it. When I think of all my favorite books, movies, art and albums, they all make me a little less alone and a little more sentient. Perhaps that is what making is for: to document the things that make us feel most alive.</p> </div> <!-- Side --> <div id="award" class="span-4"> Awards </div> <div id="right-sidebar" class="span-8 last"> Right sidebar </div> </div> </body> </html> I'm 100% sure the code works, and I can't replace image at h1.logo . I try to use live-editing CSS tool and it works fine . Thanks for reading :)

    Read the article

  • Setting marker title in Google Maps API 3 using jQuery

    - by bateman_ap
    Hi, I am having a couple of problems with Google Maps and jQuery. Wondered if anyone can help with the smaller of the two problems and hopefully it will help me to fixing the bigger one. I am using the below code to populate a google map, basically it uses generated HTML to populate the maps in the form: <div class="item mapSearch" id="map52.48228_-1.9026:800"> <div class="box-prise"><p>(0.62km away)</p><div class="btn-book-now"> <a href="/venue/800.htm">BOOK NOW</a> </div> </div><img src="http://media.toptable.com/images/thumb/13152.jpg" alt="Metro Bar and Grill" width="60" height="60" /> <div class="info"> <h2><a href="/venue/800.htm">Metro Bar and Grill</a></h2> <p class="address">73 Cornwall Street, Birmingham, B3 2DF</p><strong class="proposal">2 courses £14.50</strong> <dl> <dt>Diner Rating: </dt> <dd>7.8</dd> </dl></div></div> <div class="item mapSearch" id="map52.4754_-1.8999:3195"> <div class="box-prise"><p>(0.97km away)</p><div class="btn-book-now"> <a href="/venue/3195.htm">BOOK NOW</a> </div> </div><img src="http://media.toptable.com/images/thumb/34998.jpg" alt="Filini Restaurant - Birmingham" width="60" height="60" /> <div class="info"> <h2><a href="/venue/3195.htm">Filini Restaurant - Birmingham</a></h2> <p class="address">Radisson Blu Hotel, 12 Holloway Circus, Queensway, Birmingham, B1 1BT</p><strong class="proposal">2 for 1: main courses </strong> <dl> <dt>Diner Rating: </dt> <dd>7.8</dd> </dl></div></div> <div class="item mapSearch" id="map52.47775_-1.90619:10657"> <div class="box-prise"><p>(1.05km away)</p><div class="btn-book-now"> <a href="/venue/10657.htm">BOOK NOW</a> </div> </div><img src="http://media.toptable.com/images/thumb/34963.jpg" alt="B1 " width="60" height="60" /> <div class="info"> <h2><a href="/venue/10657.htm">B1 </a></h2> <p class="address">Central Square , Birmingham, B1 1HH</p><strong class="proposal">25% off food</strong> <dl> <dt>Diner Rating: </dt> <dd>7.9</dd> </dl></div></div> The JavaScript loops though all the divs with class mapSearch and uses this to plot markers using the div ID to get the lat/lon and ID of the venue: var locations = $(".mapSearch"); for (var i=0;i<locations.length;i++) { var id = locations[i].id; if (id) { var jsLonLat = id.substring(3).split(":")[0]; var jsId = id.substring(3).split(":")[1]; var jsLat = jsLonLat.split("_")[0]; var jsLon = jsLonLat.split("_")[1]; var jsName = $("h2").text(); var jsAddress = $("p.address").text(); var latlng = new google.maps.LatLng(jsLat,jsLon); var marker = new google.maps.Marker({ position: latlng, map:map, icon: greenRestaurantImage, title: jsName }); google.maps.event.addListener(marker, 'click', function() { //Check to see if info window already exists if (!infowindow) { //if doesn't exist then create a empty InfoWindow object infowindow = new google.maps.InfoWindow(); } //Set the content of InfoWindow infowindow.setContent(jsAddress); //Tie the InfoWindow to the market infowindow.open(map,marker); }); bounds.extend(latlng); map.fitBounds(bounds); } } The markers all plot OK on the map, however I am having probs with the infoWindow bit. I want to display info about each venue when clicked, however using my code above it just puts all info in one box when clicked, not individually. Hoping it is a simple fix! Hoping once I fix this I can work out a way to get the info window displaying if I hover over the div in the html.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Problem with jQuery and ASP.Net MVC 2

    - by robert_d
    I have a problem with jQuery, here is how my web app works Search.aspx web page which contains a form and jQuery script posts data to Search() action in Home controller after user clicks button1 button. Search.aspx: <%@ Page Title="" Language="C#" MasterPageFile="~/Views/Shared/Site.Master" Inherits="System.Web.Mvc.ViewPage<GLSChecker.Models.WebGLSQuery>" %> <asp:Content ID="Content1" ContentPlaceHolderID="TitleContent" runat="server"> Title </asp:Content> <asp:Content ID="Content2" ContentPlaceHolderID="MainContent" runat="server"> <h2>Search</h2> <% Html.EnableClientValidation(); %> <% using (Html.BeginForm()) {%> <fieldset> <div class="editor-label"> <%: Html.LabelFor(model => model.Url) %> </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.Url, new { size = "50" } ) %> <%: Html.ValidationMessageFor(model => model.Url) %> </div> <div class="editor-label"> <%: Html.LabelFor(model => model.Location) %> </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.Location, new { size = "50" } ) %> <%: Html.ValidationMessageFor(model => model.Location) %> </div> <div class="editor-label"> <%: Html.LabelFor(model => model.KeywordLines) %> </div> <div class="editor-field"> <%: Html.TextAreaFor(model => model.KeywordLines, 10, 60, null)%> <%: Html.ValidationMessageFor(model => model.KeywordLines)%> </div> <p> <input id ="button1" type="submit" value="Search" /> </p> </fieldset> <% } %> <script src="../../Scripts/jquery-1.4.1.js" type="text/javascript"></script> <script type="text/javascript"> jQuery("#button1").click(function (e) { window.setInterval(refreshResult, 5000); }); function refreshResult() { jQuery("#divResult").load("/Home/Refresh"); } </script> <div id="divResult"> </div> </asp:Content> [HttpPost] public ActionResult Search(WebGLSQuery queryToCreate) { if (!ModelState.IsValid) return View("Search"); queryToCreate.Remote_Address = HttpContext.Request.ServerVariables["REMOTE_ADDR"]; Session["Result"] = null; SearchKeywordLines(queryToCreate); Thread.Sleep(15000); return View("Search"); }//Search() After button1 button is clicked the above script from Search.aspx web page runs. Search() action in controller runs for longer period of time. I simulate this in testing by putting Thread.Sleep(15000); in Search()action. 5 sec. after Submit button was pressed, the above jQuery script calls Refresh() action in Home controller. public ActionResult Refresh() { ViewData["Result"] = DateTime.Now; return PartialView(); } Refresh() renders this partial <%@ Control Language="C#" Inherits="System.Web.Mvc.ViewUserControl" % <%= ViewData["Result"] % The problem is that in Internet Explorer 8 there is only one request to /Home/Refresh; in Firefox 3.6.3 all requests to /Home/Refresh are made but nothing is displayed on the web page. Another problem with Firefox is that requests to /Home/Refresh are made every second not every 5 seconds. I noticed that after I clear Firefox cache the script works well first time button1 is pressed, but after that it doesn't work. I would be grateful for helpful suggestions.

    Read the article

  • asp.net mvc 3 iis 7.5 404 error

    - by dm80
    Well works fine on my dev machine. Deploys fine from visual studio 2010 using msdeploy to IIS 7.5 with a site named apps.mydomain.com/myapp. So essentially I want to browse to http://apps.mydomain.com/myapp but when I do I get 404 error. I have Windows authentication enabled only on the site everything else is disabled. I have installed hotfix http://support.microsoft.com/kb/980368. App pool .NET 4 integrated pipeline. I have tried classic pipeline also but doesn't work. Edit 2 executed %windir%\Microsoft.NET\Framework64\v4.0.30319\aspnet_regiis.exe -ir still doesn't work What am I doing wrong or do I need to do anything else? Global.asax public class MvcApplication : System.Web.HttpApplication { public static void RegisterGlobalFilters(GlobalFilterCollection filters) { filters.Add(new AuthorizeAttribute()); filters.Add(new HandleErrorAttribute()); } public static void RegisterRoutes(RouteCollection routes) { routes.IgnoreRoute("{resource}.axd/{*pathInfo}"); routes.IgnoreRoute("{*favicon}", new { favicon = @"(.*/)?favicon.ico(/.*)?" }); routes.MapRoute( "Default", // Route name "{controller}/{action}/{id}", // URL with parameters new { controller = "Home", action = "Index", id = UrlParameter.Optional } // Parameter defaults ); } protected void Application_Start() { AreaRegistration.RegisterAllAreas(); RegisterGlobalFilters(GlobalFilters.Filters); RegisterRoutes(RouteTable.Routes); } } Web.config <?xml version="1.0" encoding="utf-8"?> <configuration> <configSections> <section name="entityFramework" type="System.Data.Entity.Internal.ConfigFile.EntityFrameworkSection, EntityFramework, Version=4.4.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089" requirePermission="false" /> <sectionGroup name="elmah"> <section name="security" requirePermission="false" type="Elmah.SecuritySectionHandler, Elmah" /> <section name="errorLog" requirePermission="false" type="Elmah.ErrorLogSectionHandler, Elmah" /> <section name="errorMail" requirePermission="false" type="Elmah.ErrorMailSectionHandler, Elmah" /> <section name="errorFilter" requirePermission="false" type="Elmah.ErrorFilterSectionHandler, Elmah" /> </sectionGroup> </configSections> <appSettings> <add key="webpages:Version" value="1.0.0.0" /> <add key="ClientValidationEnabled" value="true" /> <add key="UnobtrusiveJavaScriptEnabled" value="true" /> <add key="elmah.mvc.disableHandler" value="false" /> <add key="elmah.mvc.disableHandleErrorFilter" value="false" /> <add key="elmah.mvc.requiresAuthentication" value="false" /> <add key="elmah.mvc.allowedRoles" value="*" /> <add key="elmah.mvc.route" value="elmah" /> <add key="autoFormsAuthentication" value="false" /> <add key="enableSimpleMembership" value="false" /> </appSettings> <system.web> <customErrors mode="On" defaultRedirect="~/error"> <error statusCode="404" redirect="~/error/notfound"></error> </customErrors> <compilation debug="true" targetFramework="4.0"> <assemblies> <add assembly="System.Web.Abstractions, Version=4.0.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" /> <add assembly="System.Web.Helpers, Version=1.0.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" /> <add assembly="System.Web.Routing, Version=4.0.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" /> <add assembly="System.Web.Mvc, Version=3.0.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" /> <add assembly="System.Web.WebPages, Version=1.0.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" /> <add assembly="System.Data.Entity, Version=4.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089" /> </assemblies> </compilation> <authentication mode="Windows" /> <pages> <namespaces> <add namespace="System.Web.Helpers" /> <add namespace="System.Web.Mvc" /> <add namespace="System.Web.Mvc.Ajax" /> <add namespace="System.Web.Mvc.Html" /> <add namespace="System.Web.Routing" /> <add namespace="System.Web.WebPages" /> </namespaces> </pages> <httpModules> <add name="ErrorLog" type="Elmah.ErrorLogModule, Elmah" /> <add name="ErrorMail" type="Elmah.ErrorMailModule, Elmah" /> <add name="ErrorFilter" type="Elmah.ErrorFilterModule, Elmah" /> </httpModules> </system.web> <system.webServer> <httpErrors errorMode="Custom" existingResponse="Replace"> <remove statusCode="404" /> <error statusCode="404" responseMode="ExecuteURL" path="~/error/notfound" /> <remove statusCode="500" /> <error statusCode="500" responseMode="ExecuteURL" path="~/error" /> </httpErrors> <validation validateIntegratedModeConfiguration="false" /> <modules runAllManagedModulesForAllRequests="true"> <add name="ErrorLog" type="Elmah.ErrorLogModule, Elmah" preCondition="managedHandler" /> <add name="ErrorMail" type="Elmah.ErrorMailModule, Elmah" preCondition="managedHandler" /> <add name="ErrorFilter" type="Elmah.ErrorFilterModule, Elmah" preCondition="managedHandler" /> </modules> </system.webServer> <runtime> <assemblyBinding xmlns="urn:schemas-microsoft-com:asm.v1"> <dependentAssembly> <assemblyIdentity name="System.Web.Mvc" publicKeyToken="31bf3856ad364e35" /> <bindingRedirect oldVersion="1.0.0.0-2.0.0.0" newVersion="3.0.0.0" /> </dependentAssembly> </assemblyBinding> </runtime> <entityFramework> <defaultConnectionFactory type="System.Data.Entity.Infrastructure.SqlConnectionFactory, EntityFramework" /> </entityFramework> <connectionStrings> </connectionStrings> <elmah> <errorLog type="Elmah.SqlErrorLog, Elmah" connectionStringName="Elmah.Sql" /> <security allowRemoteAccess="true" /> </elmah> <location path="elmah.axd" inheritInChildApplications="false"> <system.web> <httpHandlers> <add verb="POST,GET,HEAD" path="elmah.axd" type="Elmah.ErrorLogPageFactory, Elmah" /> </httpHandlers> <authorization> <allow roles="admin" /> <deny users="*" /> </authorization> --> </system.web> <system.webServer> <handlers> <add name="ELMAH" verb="POST,GET,HEAD" path="elmah.axd" type="Elmah.ErrorLogPageFactory, Elmah" preCondition="integratedMode" /> </handlers> </system.webServer> </location> </configuration>

    Read the article

  • How to implement an EventHandler to update controls

    - by Bill
    May I ask for help with the following? I am attempting to connect and control three pieces of household electronic equipment by computer through a GlobalCache GC-100 and iTach. As you will see in the following code, I created a class-instance of GlobalCacheAdapter that communicates with each piece of equipment. Although the code seems to work well in controlling the equipment, I am having trouble updating controls with the feedback from the equipment. The procedure "ReaderThreadProc" captures the feedback; however I don't know how to update the associated TextBox with the feedback. I believe that I need to create an EventHandler to notify the TextBox of the available update; however I am uncertain as to how an EventHandler like this would be implemented. Any help wold be greatly appreciated. using System; using System.IO; using System.Net; using System.Net.Sockets; using System.Threading; using System.Windows.Forms; namespace WindowsFormsApplication1 { public partial class Form1 : Form { // Create three new instances of GlobalCacheAdaptor and connect. // GC-100 (Elan) 192.168.1.70 4998 // GC-100 (TuneSuite) 192.168.1.70 5000 // GC iTach (Lighting) 192.168.1.71 4999 private GlobalCacheAdaptor elanGlobalCacheAdaptor; private GlobalCacheAdaptor tuneSuiteGlobalCacheAdaptor; private GlobalCacheAdaptor lutronGlobalCacheAdaptor; public Form1() { InitializeComponent(); elanGlobalCacheAdaptor = new GlobalCacheAdaptor(); elanGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.70"), 4998); tuneSuiteGlobalCacheAdaptor = new GlobalCacheAdaptor(); tuneSuiteGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.70"), 5000); lutronGlobalCacheAdaptor = new GlobalCacheAdaptor(); lutronGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.71"), 4999); elanTextBox.Text = elanGlobalCacheAdaptor._line; tuneSuiteTextBox.Text = tuneSuiteGlobalCacheAdaptor._line; lutronTextBox.Text = lutronGlobalCacheAdaptor._line; } private void btnZoneOnOff_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,4,1,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,800" + Environment.NewLine); } private void btnSourceInput1_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,1,1,20,179,20,179,20,179,20,179,20,179,20,179,20,179,20,278,20,179,20,179,20,179,20,780" + Environment.NewLine); } private void btnSystemOff_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,1,1,20,184,20,184,20,184,20,184,20,184,20,286,20,286,20,286,20,184,20,184,20,184,20,820" + Environment.NewLine); } private void btnLightOff_Click(object sender, EventArgs e) { lutronGlobalCacheAdaptor.SendMessage("sdl,14,0,0,S2\x0d"); } private void btnLightOn_Click(object sender, EventArgs e) { lutronGlobalCacheAdaptor.SendMessage("sdl,14,100,0,S2\x0d"); } private void btnChannel31_Click(object sender, EventArgs e) { tuneSuiteGlobalCacheAdaptor.SendMessage("\xB8\x4D\xB5\x33\x31\x00\x30\x21\xB8\x0D"); } private void btnChannel30_Click(object sender, EventArgs e) { tuneSuiteGlobalCacheAdaptor.SendMessage("\xB8\x4D\xB5\x33\x30\x00\x30\x21\xB8\x0D"); } } } public class GlobalCacheAdaptor { public Socket _multicastListener; public string _preferredDeviceID; public IPAddress _deviceAddress; public Socket _deviceSocket; public StreamWriter _deviceWriter; public bool _isConnected; public int _port; public IPAddress _address; public string _line; public GlobalCacheAdaptor() { } public static readonly GlobalCacheAdaptor Instance = new GlobalCacheAdaptor(); public bool IsListening { get { return _multicastListener != null; } } public GlobalCacheAdaptor ConnectToDevice(IPAddress address, int port) { if (_deviceSocket != null) _deviceSocket.Close(); try { _port = port; _address = address; _deviceSocket = new Socket(AddressFamily.InterNetwork, SocketType.Stream, ProtocolType.Tcp); _deviceSocket.Connect(new IPEndPoint(address, port)); ; _deviceAddress = address; var stream = new NetworkStream(_deviceSocket); var reader = new StreamReader(stream); var writer = new StreamWriter(stream) { NewLine = "\r", AutoFlush = true }; _deviceWriter = writer; writer.WriteLine("getdevices"); var readerThread = new Thread(ReaderThreadProc) { IsBackground = true }; readerThread.Start(reader); _isConnected = true; return Instance; } catch { DisconnectFromDevice(); MessageBox.Show("ConnectToDevice Error."); throw; } } public void SendMessage(string message) { try { var stream = new NetworkStream(_deviceSocket); var reader = new StreamReader(stream); var writer = new StreamWriter(stream) { NewLine = "\r", AutoFlush = true }; _deviceWriter = writer; writer.WriteLine(message); var readerThread = new Thread(ReaderThreadProc) { IsBackground = true }; readerThread.Start(reader); } catch { MessageBox.Show("SendMessage() Error."); } } public void DisconnectFromDevice() { if (_deviceSocket != null) { try { _deviceSocket.Close(); _isConnected = false; } catch { MessageBox.Show("DisconnectFromDevice Error."); } _deviceSocket = null; } _deviceWriter = null; _deviceAddress = null; } private void ReaderThreadProc(object state) { var reader = (StreamReader)state; try { while (true) { var line = reader.ReadLine(); if (line == null) break; _line = _line + line + Environment.NewLine; } // Need to create EventHandler to notify the TextBoxes to update with _line } catch { MessageBox.Show("ReaderThreadProc Error."); } } }

    Read the article

  • Exception Error in c#

    - by Kumu
    using System; using System.Collections.Generic; using System.ComponentModel; using System.Data; using System.Drawing; using System.Linq; using System.Text; using System.Windows.Forms; using System.IO; using System.Runtime.Serialization.Formatters.Binary; namespace FoolballLeague { public partial class MainMenu : Form { FootballLeagueDatabase footballLeagueDatabase; Game game; Login login; public MainMenu() { InitializeComponent(); changePanel(1); } public MainMenu(FootballLeagueDatabase footballLeagueDatabaseIn) { InitializeComponent(); footballLeagueDatabase = footballLeagueDatabaseIn; } private void Form_Loaded(object sender, EventArgs e) { } private void gameButton_Click(object sender, EventArgs e) { int option = 0; changePanel(option); } private void scoreboardButton_Click(object sender, EventArgs e) { int option = 1; changePanel(option); } private void changePanel(int optionIn) { gamePanel.Hide(); scoreboardPanel.Hide(); string title = "Football League System"; switch (optionIn) { case 0: gamePanel.Show(); this.Text = title + " - Game Menu"; break; case 1: scoreboardPanel.Show(); this.Text = title + " - Display Menu"; break; } } private void logoutButton_Click(object sender, EventArgs e) { login = new Login(); login.Show(); this.Hide(); } private void addGameButton_Click(object sender, EventArgs e) { if ((homeTeamTxt.Text.Length) == 0) MessageBox.Show("You must enter a Home Team"); else if (homeScoreUpDown.Value > 9 || homeScoreUpDown.Minimum < 0) MessageBox.Show("You must enter one digit between 0 and 9"); else if ((awayTeamTxt.Text.Length) == 0) MessageBox.Show("You must enter a Away Team"); else if (homeScoreUpDown.Value > 9 || homeScoreUpDown.Value < 0) MessageBox.Show("You must enter one digit between 0 to 9"); else { //checkGameInputFields(); game = new Game(homeTeamTxt.Text, int.Parse(homeScoreUpDown.Value.ToString()), awayTeamTxt.Text, int.Parse(awayScoreUpDown.Value.ToString())); MessageBox.Show("Home Team -" + '\t' + homeTeamTxt.Text + '\t' + "and" + '\r' + "Away Team -" + '\t' + awayTeamTxt.Text + '\t' + "created"); footballLeagueDatabase.AddGame(game); //clearCreateStudentInputFields(); } } private void timer1_Tick(object sender, EventArgs e) { displayDateAndTime(); } private void displayDateAndTime() { dateLabel.Text = DateTime.Today.ToLongDateString(); timeLabel.Text = DateTime.Now.ToShortTimeString(); } private void displayResultsButton_Click(object sender, EventArgs e) { Game game = new Game(homeTeamTxt.Text, int.Parse(homeScoreUpDown.Value.ToString()), awayTeamTxt.Text, int.Parse(awayScoreUpDown.Value.ToString())); gameResultsListView.Items.Clear(); gameResultsListView.View = View.Details; ListViewItem row = new ListViewItem(); row.SubItems.Add(game.HomeTeam.ToString()); row.SubItems.Add(game.HomeScore.ToString()); row.SubItems.Add(game.AwayTeam.ToString()); row.SubItems.Add(game.AwayScore.ToString()); gameResultsListView.Items.Add(row); } private void displayGamesButton_Click(object sender, EventArgs e) { Game game = new Game("Home", 2, "Away", 4);//homeTeamTxt.Text, int.Parse(homeScoreUpDown.Value.ToString()), awayTeamTxt.Text, int.Parse(awayScoreUpDown.Value.ToString())); modifyGamesListView.Items.Clear(); modifyGamesListView.View = View.Details; ListViewItem row = new ListViewItem(); row.SubItems.Add(game.HomeTeam.ToString()); row.SubItems.Add(game.HomeScore.ToString()); row.SubItems.Add(game.AwayTeam.ToString()); row.SubItems.Add(game.AwayScore.ToString()); modifyGamesListView.Items.Add(row); } } } This is the whole code and I got same error like previous question. Unhandled Exception has occurred in you application.If you click...............click Quit.the application will close immediately. Object reference not set to an instance of an object. And the following details are in the error message. ***** Exception Text ******* System.NullReferenceException: Object reference not set to an instance of an object. at FoolballLeague.MainMenu.addGameButton_Click(Object sender, EventArgs e) in C:\Users\achini\Desktop\FootballLeague\FootballLeague\MainMenu.cs:line 91 at System.Windows.Forms.Control.OnClick(EventArgs e) at System.Windows.Forms.Button.OnMouseUp(MouseEventArgs mevent) at System.Windows.Forms.Control.WmMouseUp(Message& m, MouseButtons button, Int32 clicks) at System.Windows.Forms.Control.WndProc(Message& m) at System.Windows.Forms.ButtonBase.WndProc(Message& m) at System.Windows.Forms.Button.WndProc(Message& m) at System.Windows.Forms.Control.ControlNativeWindow.WndProc(Message& m) at System.Windows.Forms.NativeWindow.Callback(IntPtr hWnd, Int32 msg, IntPtr wparam, IntPtr lparam) I need to add the games to using the addGameButton and the save those added games and display them in the list view (gameResultsListView). Now I can add a game and display in the list view.But when I pressed the button addGameButton I got the above error message. If you can please give me a solution to this problem.

    Read the article

  • Rails validation count limit on has_many :through

    - by Jeremy
    I've got the following models: Team, Member, Assignment, Role The Team model has_many Members. Each Member has_many roles through assignments. Role assignments are Captain and Runner. I have also installed devise and CanCan using the Member model. What I need to do is limit each Team to have a max of 1 captain and 5 runners. I found this example, and it seemed to work after some customization, but on update ('teams/1/members/4/edit'). It doesn't work on create ('teams/1/members/new'). But my other validation (validates :role_ids, :presence = true ) does work on both update and create. Any help would be appreciated. Update: I've found this example that would seem to be similar to my problem but I can't seem to make it work for my app. It seems that the root of the problem lies with how the count (or size) is performed before and during validation. For Example: When updating a record... It checks to see how many runners there are on a team and returns a count. (i.e. 5) Then when I select a role(s) to add to the member it takes the known count from the database (i.e. 5) and adds the proposed changes (i.e. 1), and then runs the validation check. (Team.find(self.team_id).members.runner.count 5) This works fine because it returns a value of 6 and 6 5 so the proposed update fails without saving and an error is given. But when I try to create a new member on the team... It checks to see how many runners there are on a team and returns a count. (i.e. 5) Then when I select a role(s) to add to the member it takes the known count from the database (i.e. 5) and then runs the validation check WITHOUT factoring in the proposed changes. This doesn't work because it returns a value of 5 known runner and 5 = 5 so the proposed update passes and the new member and role is saved to the database with no error. Member Model: class Member < ActiveRecord::Base devise :database_authenticatable, :registerable, :recoverable, :rememberable, :trackable, :validatable attr_accessible :password, :password_confirmation, :remember_me attr_accessible :age, :email, :first_name, :last_name, :sex, :shirt_size, :team_id, :assignments_attributes, :role_ids belongs_to :team has_many :assignments, :dependent => :destroy has_many :roles, through: :assignments accepts_nested_attributes_for :assignments scope :runner, joins(:roles).where('roles.title = ?', "Runner") scope :captain, joins(:roles).where('roles.title = ?', "Captain") validate :validate_runner_count validate :validate_captain_count validates :role_ids, :presence => true def validate_runner_count if Team.find(self.team_id).members.runner.count > 5 errors.add(:role_id, 'Error - Max runner limit reached') end end def validate_captain_count if Team.find(self.team_id).members.captain.count > 1 errors.add(:role_id, 'Error - Max captain limit reached') end end def has_role?(role_sym) roles.any? { |r| r.title.underscore.to_sym == role_sym } end end Member Controller: class MembersController < ApplicationController load_and_authorize_resource :team load_and_authorize_resource :member, :through => :team before_filter :get_team before_filter :initialize_check_boxes, :only => [:create, :update] def get_team @team = Team.find(params[:team_id]) end def index respond_to do |format| format.html # index.html.erb format.json { render json: @members } end end def show respond_to do |format| format.html # show.html.erb format.json { render json: @member } end end def new respond_to do |format| format.html # new.html.erb format.json { render json: @member } end end def edit end def create respond_to do |format| if @member.save format.html { redirect_to [@team, @member], notice: 'Member was successfully created.' } format.json { render json: [@team, @member], status: :created, location: [@team, @member] } else format.html { render action: "new" } format.json { render json: @member.errors, status: :unprocessable_entity } end end end def update respond_to do |format| if @member.update_attributes(params[:member]) format.html { redirect_to [@team, @member], notice: 'Member was successfully updated.' } format.json { head :no_content } else format.html { render action: "edit" } format.json { render json: @member.errors, status: :unprocessable_entity } end end end def destroy @member.destroy respond_to do |format| format.html { redirect_to team_members_url } format.json { head :no_content } end end # Allow empty checkboxes # http://railscasts.com/episodes/17-habtm-checkboxes def initialize_check_boxes params[:member][:role_ids] ||= [] end end _Form Partial <%= form_for [@team, @member], :html => { :class => 'form-horizontal' } do |f| %> #... # testing the count... <ul> <li>Captain - <%= Team.find(@member.team_id).members.captain.size %></li> <li>Runner - <%= Team.find(@member.team_id).members.runner.size %></li> <li>Driver - <%= Team.find(@member.team_id).members.driver.size %></li> </ul> <div class="control-group"> <div class="controls"> <%= f.fields_for :roles do %> <%= hidden_field_tag "member[role_ids][]", nil %> <% Role.all.each do |role| %> <%= check_box_tag "member[role_ids][]", role.id, @member.role_ids.include?(role.id), id: dom_id(role) %> <%= label_tag dom_id(role), role.title %> <% end %> <% end %> </div> </div> #... <% end %>

    Read the article

  • problems calling webservices through the https connection

    - by shivaji123
    i have done an application in BlackBerry which takes username & password with url link which is a link of server here i am calling some webservices but it is doing the connection in https so when i take the username password & url link & hit the login button it basically calls a webservice but then the application connecting to the webservice for ever & after some time i get the error massage something "unreported exception the application is not responding" .& then the application crashes out.Also i am using the SOAP client library . this is the piece of code synchronized (this) { try { _httpconn = (HttpConnection) Connector.open(url,Connector.READ_WRITE);//Connector.READ_WRITE //_httpconn =(StreamConnection)Connector.open(url); //System.out.println("-----------httpsconnection() PART--------------------"); _httpconn.setRequestMethod(HttpConnection.POST); //_httpconn.setRequestProperty("Content-Type", "application/x-www-form-urlencoded"); //System.out.println("-----------httpsconnection() PART- **-------------------"); _httpconn.setRequestProperty("SOAPAction", Constants.EXIST_STR); //System.out.println("-----------httpsconnection() PART-REQUEST -------------------"); _httpconn.setRequestProperty("Content-Type", "text/soap+xml"); //System.out.println("-----------httpsconnection() PART- CONTENT-------------------"); _httpconn.setRequestProperty("User-Agent", "kSOAP/1.0"); //System.out.println("-----------httpsconnection() PART-USER Agent-------------------"); String clen = Integer.toBinaryString(input.length()); _httpconn.setRequestProperty("Content-Length", clen); //System.out.println("-----------httpsconnection() Content-Length--------------------"); _out = _httpconn.openDataOutputStream(); //System.out.println(input+"-----------input--------------------"+url); _out.write(input.getBytes()); _out.flush(); // may or may not be needed. //int rc = _httpconn.getResponseCode(); int rc = _httpconn.getResponseCode(); if(rc == HttpConnection.HTTP_OK) { isComplete = true; _in = _httpconn.openInputStream(); msg = new StringBuffer(); byte[] data = new byte[1024]; int len = 0; int size = 0; while ( -1 != (len = _in.read(data)) ) { msg.append(new String(data, 0, len)); size += len; } responsData = msg.toString(); System.out.println("-----------responsData "+responsData); } if(responsData!=null) isSuccessful = true; stop(); } catch (InterruptedIOException interrIO) { //errStr = "Network Connection hasn't succedded. "+ //"Please check APN setting."; UiApplication.getUiApplication().invokeLater(new Runnable() { public void run() { Status.show("Network Connection hasn't succedded. "+ "Please try again later."); } }); isComplete = true; System.out.println(interrIO); stop(); } catch (IOException interrIO) { System.out.println("-----------IO EXCEPTION--------- "+interrIO); //errStr = "Network Connection hasn't succedded. "+ //"Please check APN setting." ; UiApplication.getUiApplication().invokeLater(new Runnable() { public void run() { Status.show("Network Connection hasn't succedded. "+ "Please try again later." ); } }); isComplete = true; System.out.println(interrIO); stop(); } catch (Exception e) { System.out.println(e); //errStr = "Unable to connect to the internet at this time. "+ //"Please try again later."; UiApplication.getUiApplication().invokeLater(new Runnable() { public void run() { Status.show("Unable to connect to the internet at this time. "+ "Please try again later." ); } }); isComplete = true; stop(); } finally { try { if(_httpconn != null) { _httpconn.close(); _httpconn = null; } if(_in != null) { _in.close(); _in = null; } if(_out != null) { _out.close(); _out = null; } } catch(Exception e) { System.out.println(e); UiApplication.getUiApplication().invokeLater(new Runnable() { public void run() { Status.show("Unable to connect to the internet at this time. "+ "Please try again later." ); } }); } } } } can anybody help me out. Thanks in advance

    Read the article

  • Compiler error: Variable or field declared void [closed]

    - by ?? ?
    i get some error when i try to run this, could someone please tell me the mistakes, thank you! [error: C:\Users\Ethan\Desktop\Untitled1.cpp In function `int main()': 25 C:\Users\Ethan\Desktop\Untitled1.cpp variable or field `findfactors' declared void 25 C:\Users\Ethan\Desktop\Untitled1.cpp initializer expression list treated as compound expression] #include<iostream> #include<cmath> using namespace std; void prompt(int&, int&, int&); int gcd(int , int , int );//3 input, 3 output void findfactors(int , int , int, int, int&, int&);//3 input, 2 output void display(int, int, int, int, int);//5 inputs int main() { int a, b, c; //The coefficients of the quadratic polynomial int ag, bg, cg;//value of a, b, c after factor out gcd int f1, f2; //The two factors of a*c which add to be b int g; //The gcd of a, b, c prompt(a, b, c);//Call the prompt function g=gcd(a, b, c);//Calculation of g void findfactors(a, b, c, f1, f2);//Call findFactors on factored polynomial display(g, f1, f2, a, c);//Call display function to display the factored polynomial system("PAUSE"); return 0; } void prompt(int& num1, int& num2, int& num3) //gets 3 ints from the user { cout << "This program factors polynomials of the form ax^2+bx+c."<<endl; while(num1==0) { cout << "Enter a value for a: "; cin >> num1; if(num1==0) { cout<< "a must be non-zero."<<endl; } } while(num2==0 && num3==0) { cout << "Enter a value for b: "; cin >> num2; cout << "Enter a value for c: "; cin >> num3; if(num2==0 && num3==0) { cout<< "b and c cannot both be 0."<<endl; } } } int gcd(int num1, int num2, int num3) { int k=2, gcd=1; while (k<=num1 && k<=num2 && k<=num3) { if (num1%k==0 && num2%k==0 && num3%k==0) gcd=k; k++; } return gcd; } void findFactors(int Ag, int Bg, int Cg,int& F1, int& F2) { int y=Ag*Cg; int z=sqrt(abs(y)); for(int i=-z; i<=z; i++) //from -sqrt(|y|) to sqrt(|y|) { if(i==0)i++; //skips 0 if(y%i==0) //if i is a factor of y { if(i+y/i==Bg) //if i and its partner add to be b F1=i, F2=y/i; else F1=0, F2=0; } } } void display(int G, int factor1, int factor2, int A, int C) { int k=2, gcd1=1; while (k<=A && k<=factor1) { if (A%k==0 && factor1%k==0) gcd1=k; k++; } int t=2, gcd2=1; while (t<=factor2 && t<=C) { if (C%t==0 && factor2%t==0) gcd2=t; t++; } cout<<showpos<<G<<"*("<<gcd1<<"x"<<gcd2<<")("<<A/gcd1<<"x"<<C/gcd2<<")"<<endl; }

    Read the article

  • C++0x rvalue references - lvalues-rvalue binding

    - by Doug
    This is a follow-on question to http://stackoverflow.com/questions/2748866/c0x-rvalue-references-and-temporaries In the previous question, I asked how this code should work: void f(const std::string &); //less efficient void f(std::string &&); //more efficient void g(const char * arg) { f(arg); } It seems that the move overload should probably be called because of the implicit temporary, and this happens in GCC but not MSVC (or the EDG front-end used in MSVC's Intellisense). What about this code? void f(std::string &&); //NB: No const string & overload supplied void g1(const char * arg) { f(arg); } void g2(const std::string & arg) { f(arg); } It seems that, based on the answers to my previous question that function g1 is legal (and is accepted by GCC 4.3-4.5, but not by MSVC). However, GCC and MSVC both reject g2 because of clause 13.3.3.1.4/3, which prohibits lvalues from binding to rvalue ref arguments. I understand the rationale behind this - it is explained in N2831 "Fixing a safety problem with rvalue references". I also think that GCC is probably implementing this clause as intended by the authors of that paper, because the original patch to GCC was written by one of the authors (Doug Gregor). However, I don't this is quite intuitive. To me, (a) a const string & is conceptually closer to a string && than a const char *, and (b) the compiler could create a temporary string in g2, as if it were written like this: void g2(const std::string & arg) { f(std::string(arg)); } Indeed, sometimes the copy constructor is considered to be an implicit conversion operator. Syntactically, this is suggested by the form of a copy constructor, and the standard even mentions this specifically in clause 13.3.3.1.2/4, where the copy constructor for derived-base conversions is given a higher conversion rank than other implicit conversions: A conversion of an expression of class type to the same class type is given Exact Match rank, and a conversion of an expression of class type to a base class of that type is given Conversion rank, in spite of the fact that a copy/move constructor (i.e., a user-defined conversion function) is called for those cases. (I assume this is used when passing a derived class to a function like void h(Base), which takes a base class by value.) Motivation My motivation for asking this is something like the question asked in http://stackoverflow.com/questions/2696156/how-to-reduce-redundant-code-when-adding-new-c0x-rvalue-reference-operator-over ("How to reduce redundant code when adding new c++0x rvalue reference operator overloads"). If you have a function that accepts a number of potentially-moveable arguments, and would move them if it can (e.g. a factory function/constructor: Object create_object(string, vector<string>, string) or the like), and want to move or copy each argument as appropriate, you quickly start writing a lot of code. If the argument types are movable, then one could just write one version that accepts the arguments by value, as above. But if the arguments are (legacy) non-movable-but-swappable classes a la C++03, and you can't change them, then writing rvalue reference overloads is more efficient. So if lvalues did bind to rvalues via an implicit copy, then you could write just one overload like create_object(legacy_string &&, legacy_vector<legacy_string> &&, legacy_string &&) and it would more or less work like providing all the combinations of rvalue/lvalue reference overloads - actual arguments that were lvalues would get copied and then bound to the arguments, actual arguments that were rvalues would get directly bound. Questions My questions are then: Is this a valid interpretation of the standard? It seems that it's not the conventional or intended one, at any rate. Does it make intuitive sense? Is there a problem with this idea that I"m not seeing? It seems like you could get copies being quietly created when that's not exactly expected, but that's the status quo in places in C++03 anyway. Also, it would make some overloads viable when they're currently not, but I don't see it being a problem in practice. Is this a significant enough improvement that it would be worth making e.g. an experimental patch for GCC?

    Read the article

  • How do I remove the time from printpreview dialog?

    - by Albo Best
    Here is my code: Imports System.Data.OleDb Imports System.Drawing.Printing Namespace Print Public Class Form1 Inherits System.Windows.Forms.Form Dim PrintC As PrinterClass Dim conn As OleDb.OleDbConnection Dim connectionString As String = "Provider=Microsoft.Jet.OLEDB.4.0;Data Source=..\\db1.mdb" Dim sql As String = String.Empty Dim ds As DataSet Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load FillDataGrid() '//create printerclass object PrintC = New PrinterClass(PrintDocument1, dataGrid) End Sub Private Sub FillDataGrid() Try Dim dt As New DataTable Dim ds As New DataSet ds.Tables.Add(dt) Dim da As New OleDbDataAdapter con.Open() da = New OleDbDataAdapter("SELECT * from klient ", con) da.Fill(dt) con.Close() dataGrid.DataSource = dt.DefaultView Dim dTable As DataTable For Each dTable In ds.Tables Dim dgStyle As DataGridTableStyle = New DataGridTableStyle dgStyle.MappingName = dTable.TableName dataGrid.TableStyles.Add(dgStyle) Next ' DataGrid settings dataGrid.CaptionText = "TE GJITHE KLIENTET" dataGrid.HeaderFont = New Font("Verdana", 12) dataGrid.TableStyles(0).GridColumnStyles(0).Width = 60 dataGrid.TableStyles(0).GridColumnStyles(1).Width = 140 dataGrid.TableStyles(0).GridColumnStyles(2).Width = 140 dataGrid.TableStyles(0).GridColumnStyles(3).Width = 140 dataGrid.TableStyles(0).GridColumnStyles(4).Width = 140 dataGrid.TableStyles(0).GridColumnStyles(5).HeaderText = "" dataGrid.TableStyles(0).GridColumnStyles(5).Width = -1 Catch ex As Exception MessageBox.Show(ex.Message) End Try End Sub Private Sub btnPrint_Click(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles btnPrint.Click 'create printerclass object PrintC = New PrinterClass(PrintDocument1, dataGrid) PrintDocument1.Print() End Sub Private Sub btnPreview_Click(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles btnPreview.Click 'create printerclass object PrintC = New PrinterClass(PrintDocument1, dataGrid) ''preview Dim ps As New PaperSize("A4", 840, 1150) ps.PaperName = PaperKind.A4 PrintDocument1.DefaultPageSettings.PaperSize = ps PrintPreviewDialog1.WindowState = FormWindowState.Normal PrintPreviewDialog1.StartPosition = FormStartPosition.CenterScreen PrintPreviewDialog1.ClientSize = New Size(600, 600) PrintPreviewDialog1.ShowDialog() End Sub Private Sub PrintDocument1_PrintPage(ByVal sender As System.Object, ByVal e As System.Drawing.Printing.PrintPageEventArgs) Handles PrintDocument1.PrintPage 'print grid Dim morepages As Boolean = PrintC.Print(e.Graphics) If (morepages) Then e.HasMorePages = True End If End Sub End Class End Namespace This is how data looks in DataGrid (that's perfect)... and here is how it looks when I click PrintPreview. (I don't want the time to appear there, the "12:00:00" part. in database the date is stored as Short Date (10-Dec-12) Can somebody suggest a way around that? Imports System Imports System.Windows.Forms Imports System.Drawing Imports System.Drawing.Printing Imports System.Collections Imports System.Data Namespace Print Public Class PrinterClass '//clone of Datagrid Dim PrintGrid As Grid '//printdocument for initial printer settings Private PrintDoc As PrintDocument '//defines whether the grid is ordered right to left Private bRightToLeft As Boolean '//Current Top Private CurrentY As Single = 0 '//Current Left Private CurrentX As Single = 0 '//CurrentRow to print Private CurrentRow As Integer = 0 '//Page Counter Public PageCounter As Integer = 0 '/// <summary> '/// Constructor Class '/// </summary> '/// <param name="pdocument"></param> '/// <param name="dgrid"></param> Public Sub New(ByVal pdocument As PrintDocument, ByVal dgrid As DataGrid) 'MyBase.new() PrintGrid = New Grid(dgrid) PrintDoc = pdocument '//The grid columns are right to left bRightToLeft = dgrid.RightToLeft = RightToLeft.Yes '//init CurrentX and CurrentY CurrentY = pdocument.DefaultPageSettings.Margins.Top CurrentX = pdocument.DefaultPageSettings.Margins.Left End Sub Public Function Print(ByVal g As Graphics, ByRef currentX As Single, ByRef currentY As Single) As Boolean '//use predefined area currentX = currentX currentY = currentY PrintHeaders(g) Dim Morepages As Boolean = PrintDataGrid(g) currentY = currentY currentX = currentX Return Morepages End Function Public Function Print(ByVal g As Graphics) As Boolean CurrentX = PrintDoc.DefaultPageSettings.Margins.Left CurrentY = PrintDoc.DefaultPageSettings.Margins.Top PrintHeaders(g) Return PrintDataGrid(g) End Function '/// <summary> '/// Print the Grid Headers '/// </summary> '/// <param name="g"></param> Private Sub PrintHeaders(ByVal g As Graphics) Dim sf As StringFormat = New StringFormat '//if we want to print the grid right to left If (bRightToLeft) Then CurrentX = PrintDoc.DefaultPageSettings.PaperSize.Width - PrintDoc.DefaultPageSettings.Margins.Right sf.FormatFlags = StringFormatFlags.DirectionRightToLeft Else CurrentX = PrintDoc.DefaultPageSettings.Margins.Left End If Dim i As Integer For i = 0 To PrintGrid.Columns - 1 '//set header alignment Select Case (CType(PrintGrid.Headers.GetValue(i), Header).Alignment) Case HorizontalAlignment.Left 'left sf.Alignment = StringAlignment.Near Case HorizontalAlignment.Center sf.Alignment = StringAlignment.Center Case HorizontalAlignment.Right sf.Alignment = StringAlignment.Far End Select '//advance X according to order If (bRightToLeft) Then '//draw the cell bounds (lines) and back color g.FillRectangle(New SolidBrush(PrintGrid.HeaderBackColor), CurrentX - PrintGrid.Headers(i).Width, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height) g.DrawRectangle(New Pen(PrintGrid.LineColor), CurrentX - PrintGrid.Headers(i).Width, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height) '//draw the cell text g.DrawString(PrintGrid.Headers(i).CText, PrintGrid.Headers(i).Font, New SolidBrush(PrintGrid.HeaderForeColor), New RectangleF(CurrentX - PrintGrid.Headers(i).Width, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height), sf) '//next cell CurrentX -= PrintGrid.Headers(i).Width Else '//draw the cell bounds (lines) and back color g.FillRectangle(New SolidBrush(PrintGrid.HeaderBackColor), CurrentX, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height) g.DrawRectangle(New Pen(PrintGrid.LineColor), CurrentX, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height) '//draw the cell text g.DrawString(PrintGrid.Headers(i).CText, PrintGrid.Headers(i).Font, New SolidBrush(PrintGrid.HeaderForeColor), New RectangleF(CurrentX, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height), sf) '//next cell CurrentX += PrintGrid.Headers(i).Width End If Next '//reset to beginning If (bRightToLeft) Then '//right align CurrentX = PrintDoc.DefaultPageSettings.PaperSize.Width - PrintDoc.DefaultPageSettings.Margins.Right Else '//left align CurrentX = PrintDoc.DefaultPageSettings.Margins.Left End If '//advance to next row CurrentY = CurrentY + CType(PrintGrid.Headers.GetValue(0), Header).Height End Sub Private Function PrintDataGrid(ByVal g As Graphics) As Boolean Dim sf As StringFormat = New StringFormat PageCounter = PageCounter + 1 '//if we want to print the grid right to left If (bRightToLeft) Then CurrentX = PrintDoc.DefaultPageSettings.PaperSize.Width - PrintDoc.DefaultPageSettings.Margins.Right sf.FormatFlags = StringFormatFlags.DirectionRightToLeft Else CurrentX = PrintDoc.DefaultPageSettings.Margins.Left End If Dim i As Integer For i = CurrentRow To PrintGrid.Rows - 1 Dim j As Integer For j = 0 To PrintGrid.Columns - 1 '//set cell alignment Select Case (PrintGrid.Cell(i, j).Alignment) '//left Case HorizontalAlignment.Left sf.Alignment = StringAlignment.Near Case HorizontalAlignment.Center sf.Alignment = StringAlignment.Center '//right Case HorizontalAlignment.Right sf.Alignment = StringAlignment.Far End Select '//advance X according to order If (bRightToLeft) Then '//draw the cell bounds (lines) and back color g.FillRectangle(New SolidBrush(PrintGrid.BackColor), CurrentX - PrintGrid.Cell(i, j).Width, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height) g.DrawRectangle(New Pen(PrintGrid.LineColor), CurrentX - PrintGrid.Cell(i, j).Width, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height) '//draw the cell text g.DrawString(PrintGrid.Cell(i, j).CText, PrintGrid.Cell(i, j).Font, New SolidBrush(PrintGrid.ForeColor), New RectangleF(CurrentX - PrintGrid.Cell(i, j).Width, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height), sf) '//next cell CurrentX -= PrintGrid.Cell(i, j).Width Else '//draw the cell bounds (lines) and back color g.FillRectangle(New SolidBrush(PrintGrid.BackColor), CurrentX, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height) g.DrawRectangle(New Pen(PrintGrid.LineColor), CurrentX, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height) '//draw the cell text '//Draw text by alignment g.DrawString(PrintGrid.Cell(i, j).CText, PrintGrid.Cell(i, j).Font, New SolidBrush(PrintGrid.ForeColor), New RectangleF(CurrentX, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height), sf) '//next cell CurrentX += PrintGrid.Cell(i, j).Width End If Next '//reset to beginning If (bRightToLeft) Then '//right align CurrentX = PrintDoc.DefaultPageSettings.PaperSize.Width - PrintDoc.DefaultPageSettings.Margins.Right Else '//left align CurrentX = PrintDoc.DefaultPageSettings.Margins.Left End If '//advance to next row CurrentY += PrintGrid.Cell(i, 0).Height CurrentRow += 1 '//if we are beyond the page margin (bottom) then we need another page, '//return true If (CurrentY > PrintDoc.DefaultPageSettings.PaperSize.Height - PrintDoc.DefaultPageSettings.Margins.Bottom) Then Return True End If Next Return False End Function End Class End Namespace

    Read the article

  • Why is str_replace not replacing this string?

    - by Niall
    I have the following PHP code which should load the data from a CSS file into a variable, search for the old body background colour, replace it with the colour from a submitted form, resave the CSS file and finally update the colour in the database. The problem is, str_replace does not appear to be replacing anything. Here is my PHP code (stored in "processors/save_program_settings.php"): <?php require("../security.php"); $institution_name = mysql_real_escape_string($_POST['institution_name']); $staff_role_title = mysql_real_escape_string($_POST['staff_role_title']); $program_location = mysql_real_escape_string($_POST['program_location']); $background_colour = mysql_real_escape_string($_POST['background_colour']); $bar_border_colour = mysql_real_escape_string($_POST['bar_border_colour']); $title_colour = mysql_real_escape_string($_POST['title_colour']); $url = $global_variables['program_location']; $data_background = mysql_query("SELECT * FROM sents_global_variables WHERE name='background_colour'") or die(mysql_error()); $background_output = mysql_fetch_array($data_background); $css = file_get_contents($url.'/default.css'); $str = "body { background-color: #".$background_output['data']."; }"; $str2 = "body { background-color: #".$background_colour."; }"; $css2 = str_replace($str, $str2, $css); unlink('../default.css'); file_put_contents('../default.css', $css2); mysql_query("UPDATE sents_global_variables SET data='{$institution_name}' WHERE name='institution_name'") or die(mysql_error()); mysql_query("UPDATE sents_global_variables SET data='{$staff_role_title}' WHERE name='role_title'") or die(mysql_error()); mysql_query("UPDATE sents_global_variables SET data='{$program_location}' WHERE name='program_location'") or die(mysql_error()); mysql_query("UPDATE sents_global_variables SET data='{$background_colour}' WHERE name='background_colour'") or die(mysql_error()); mysql_query("UPDATE sents_global_variables SET data='{$bar_border_colour}' WHERE name='bar_border_colour'") or die(mysql_error()); mysql_query("UPDATE sents_global_variables SET data='{$title_colour}' WHERE name='title_colour'") or die(mysql_error()); header('Location: '.$url.'/pages/start.php?message=program_settings_saved'); ?> Here is my CSS (stored in "default.css"): @charset "utf-8"; /* CSS Document */ body,td,th { font-family: Arial, Helvetica, sans-serif; font-size: 14px; color: #000; } body { background-color: #CCCCFF; } .main_table th { background:#003399; font-size:24px; color:#FFFFFF; } .main_table { background:#FFF; border:#003399 solid 1px; } .subtitle { font-size:20px; } input#login_username, input#login_password { height:30px; width:300px; font-size:24px; } input#login_submit { height:30px; width:150px; font-size:16px; } .timetable_cell_lesson { width:100px; font-size:10px; } .timetable_cell_tutorial_a, .timetable_cell_tutorial_b, .timetable_cell_break, .timetable_cell_lunch { width:100px; background:#999; font-size:10px; } I've run some checks using the following code in the PHP file: echo $css . "<br><br>" . $str . "<br><br>" . $str2 . "<br><br>" . $css2; exit; And it outputs (as you can see it's not changing anything in the CSS): @charset "utf-8"; /* CSS Document */ body,td,th { font-family: Arial, Helvetica, sans-serif; font-size: 14px; color: #000; } body { background-color: #CCCCFF; } .main_table th { background:#003399; font-size:24px; color:#FFFFFF; } .main_table { background:#FFF; border:#003399 solid 1px; } .subtitle { font-size:20px; } input#login_username, input#login_password { height:30px; width:300px; font-size:24px; } input#login_submit { height:30px; width:150px; font-size:16px; } .timetable_cell_lesson { width:100px; font-size:10px; } .timetable_cell_tutorial_a, .timetable_cell_tutorial_b, .timetable_cell_break, .timetable_cell_lunch { width:100px; background:#999; font-size:10px; } body { background-color: #CCCCFF; } body { background-color: #FF5719; } @charset "utf-8"; /* CSS Document */ body,td,th { font-family: Arial, Helvetica, sans-serif; font-size: 14px; color: #000; } body { background-color: #CCCCFF; } .main_table th { background:#003399; font-size:24px; color:#FFFFFF; } .main_table { background:#FFF; border:#003399 solid 1px; } .subtitle { font-size:20px; } input#login_username, input#login_password { height:30px; width:300px; font-size:24px; } input#login_submit { height:30px; width:150px; font-size:16px; } .timetable_cell_lesson { width:100px; font-size:10px; } .timetable_cell_tutorial_a, .timetable_cell_tutorial_b, .timetable_cell_break, .timetable_cell_lunch { width:100px; background:#999; font-size:10px; }

    Read the article

  • Good coding style to do case-select in XSLT

    - by Scud
    I want to have a page display A,B,C,D depending on the return value from XML value (1,2,3,4). My approaches are by javascript or XSLT:choose. I want to know which way is better, and why? Can I do this case-select in .cs code (good or bad)? Should I javascript code in XSLT? Can the community please advise? Thanks. Below are the code. Javascript way (this one works): <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform" xmlns:msxsl="urn:schemas-microsoft-com:xslt" xmlns:js="urn:custom-javascript"> <xsl:template match="page"> <msxsl:script language="JavaScript" implements-prefix="js"> <![CDATA[ function translateSkillLevel(level) { switch (level) { case 0: return "Level 1"; case 1: return "Level 2"; case 2: return "Level 3"; } return "unknown"; } ]]> </msxsl:script> <div id="skill"> <table border="0" cellpadding="1" cellspacing="1"> <tr> <th>Level</th> </tr> <xsl:for-each select="/page/Skill"> <tr> <td> <!-- difference here --> <script type="text/javascript"> document.write(translateSkillLevel(<xsl:value-of select="@level"/>)); </script> </td> </tr> </xsl:for-each> </table> </div> </xsl:template> </xsl:stylesheet> Javascript way (this one doesn't work, getting undefined js tag): <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform" xmlns:msxsl="urn:schemas-microsoft-com:xslt" xmlns:js="urn:custom-javascript"> <xsl:template match="page"> <msxsl:script language="JavaScript" implements-prefix="js"> <![CDATA[ function translateSkillLevel(level) { switch (level) { case 0: return "Level 1"; case 1: return "Level 2"; case 2: return "Level 3"; } return "unknown"; } ]]> </msxsl:script> <div id="skill"> <table border="0" cellpadding="1" cellspacing="1"> <tr> <th>Level</th> </tr> <xsl:for-each select="/page/Skill"> <tr> <td> <!-- difference here --> <xsl:value-of select="js:translateSkillLevel(string(@level))"/> </td> </tr> </xsl:for-each> </table> </div> </xsl:template> </xsl:stylesheet> XSLT way: <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform"> <xsl:template match="page"> <div id="skill"> <table border="0" cellpadding="1" cellspacing="1"> <tr> <th>Level</th> </tr> <xsl:for-each select="/page/Skill"> <tr> <td> <xsl:choose> <xsl:when test="@level = 0"> Level 1 </xsl:when> <xsl:when test="@level = 1"> Level 2 </xsl:when> <xsl:when test="@level = 2"> Level 3 </xsl:when> <xsl:otherwise> unknown </xsl:otherwisexsl:otherwise> </xsl:choose> </td> </tr> </xsl:for-each> </table> </div> </xsl:template> </xsl:stylesheet> EDIT: Also, I have some inline javascript functions for form submit. <input type="submit" onclick="javascript:document.forms[0].submit();return false;"/>

    Read the article

  • Am I just not understanding TDD unit testing (Asp.Net MVC project)?

    - by KallDrexx
    I am trying to figure out how to correctly and efficiently unit test my Asp.net MVC project. When I started on this project I bought the Pro ASP.Net MVC, and with that book I learned about TDD and unit testing. After seeing the examples, and the fact that I work as a software engineer in QA in my current company, I was amazed at how awesome TDD seemed to be. So I started working on my project and went gun-ho writing unit tests for my database layer, business layer, and controllers. Everything got a unit test prior to implementation. At first I thought it was awesome, but then things started to go downhill. Here are the issues I started encountering: I ended up writing application code in order to make it possible for unit tests to be performed. I don't mean this in a good way as in my code was broken and I had to fix it so the unit test pass. I mean that abstracting out the database to a mock database is impossible due to the use of linq for data retrieval (using the generic repository pattern). The reason is that with linq-sql or linq-entities you can do joins just by doing: var objs = select p from _container.Projects select p.Objects; However, if you mock the database layer out, in order to have that linq pass the unit test you must change the linq to be var objs = select p from _container.Projects join o in _container.Objects on o.ProjectId equals p.Id select o; Not only does this mean you are changing your application logic just so you can unit test it, but you are making your code less efficient for the sole purpose of testability, and getting rid of a lot of advantages using an ORM has in the first place. Furthermore, since a lot of the IDs for my models are database generated, I proved to have to write additional code to handle the non-database tests since IDs were never generated and I had to still handle those cases for the unit tests to pass, yet they would never occur in real scenarios. Thus I ended up throwing out my database unit testing. Writing unit tests for controllers was easy as long as I was returning views. However, the major part of my application (and the one that would benefit most from unit testing) is a complicated ajax web application. For various reasons I decided to change the app from returning views to returning JSON with the data I needed. After this occurred my unit tests became extremely painful to write, as I have not found any good way to write unit tests for non-trivial json. After pounding my head and wasting a ton of time trying to find a good way to unit test the JSON, I gave up and deleted all of my controller unit tests (all controller actions are focused on this part of the app so far). So finally I was left with testing the Service layer (BLL). Right now I am using EF4, however I had this issue with linq-sql as well. I chose to do the EF4 model-first approach because to me, it makes sense to do it that way (define my business objects and let the framework figure out how to translate it into the sql backend). This was fine at the beginning but now it is becoming cumbersome due to relationships. For example say I have Project, User, and Object entities. One Object must be associated to a project, and a project must be associated to a user. This is not only a database specific rule, these are my business rules as well. However, say I want to do a unit test that I am able to save an object (for a simple example). I now have to do the following code just to make sure the save worked: User usr = new User { Name = "Me" }; _userService.SaveUser(usr); Project prj = new Project { Name = "Test Project", Owner = usr }; _projectService.SaveProject(prj); Object obj = new Object { Name = "Test Object" }; _objectService.SaveObject(obj); // Perform verifications There are many issues with having to do all this just to perform one unit test. There are several issues with this. For starters, if I add a new dependency, such as all projects must belong to a category, I must go into EVERY single unit test that references a project, add code to save the category then add code to add the category to the project. This can be a HUGE effort down the road for a very simple business logic change, and yet almost none of the unit tests I will be modifying for this requirement are actually meant to test that feature/requirement. If I then add verifications to my SaveProject method, so that projects cannot be saved unless they have a name with at least 5 characters, I then have to go through every Object and Project unit test to make sure that the new requirement doesn't make any unrelated unit tests fail. If there is an issue in the UserService.SaveUser() method it will cause all project, and object unit tests to fail and it the cause won't be immediately noticeable without having to dig through the exceptions. Thus I have removed all service layer unit tests from my project. I could go on and on, but so far I have not seen any way for unit testing to actually help me and not get in my way. I can see specific cases where I can, and probably will, implement unit tests, such as making sure my data verification methods work correctly, but those cases are few and far between. Some of my issues can probably be mitigated but not without adding extra layers to my application, and thus making more points of failure just so I can unit test. Thus I have no unit tests left in my code. Luckily I heavily use source control so I can get them back if I need but I just don't see the point. Everywhere on the internet I see people talking about how great TDD unit tests are, and I'm not just talking about the fanatical people. The few people who dismiss TDD/Unit tests give bad arguments claiming they are more efficient debugging by hand through the IDE, or that their coding skills are amazing that they don't need it. I recognize that both of those arguments are utter bullocks, especially for a project that needs to be maintainable by multiple developers, but any valid rebuttals to TDD seem to be few and far between. So the point of this post is to ask, am I just not understanding how to use TDD and automatic unit tests?

    Read the article

  • Checkbox to Show and Hide only for the near DIV

    - by Holp
    Select all options... Then, when the user uncheck "B" and check it again, the "D" parents must be hidden. I have to do it without give then IDs. <html> <head> <title>Form</title> <style> * { font-family: Segoe UI, Verdana; font-size: 10pt; } #total { padding: 10px; position: fixed; top: 10px; left: 500px; width: 150px; height: 100px; } p { margin: 5px; } .grupo { padding: 5px 0 5px 0; } </style> <script src="jquery-1.4.2.min.js" type="text/javascript"></script> </head> <body> <div class="grupo"> <p class="pergunta">A) Lorem ipsum dolor sit amet, nulla nec tortor?</p> <p><label><input type="radio" name="P-1" value="R-1-1" />Sim</label></p> <p><label><input type="radio" name="P-1" value="R-1-2" />Não</label></p> </div> <div class="grupo"> <p class="pergunta"><label><input type="checkbox" name="P-2" value="R-2-3" />B) Donec libero risus, commodo vitae</label></p> <div class="dependente"> <div class="grupo"> <p class="pergunta">C) Lorem ipsum dolor sit amet, nulla nec tortor?</p> <p><label><input type="radio" name="P-3" value="R-3-1" />Morbi in orci</label></p> <p><label><input type="radio" name="P-3" value="R-3-2" />Nulla purus lacus, pulvinar vel</label></p> <p><label><input type="radio" name="P-3" value="R-3-3" />Aliquam ante</label></p> <p><label><input type="radio" name="P-3" value="R-3-4" />Suspendisse scelerisque dui nec velit</label></p> </div> <div class="grupo"> <p class="pergunta"><label><input type="checkbox" name="P-4" value="R-4-5" />D) Donec libero risus, commodo vitae</label></p> <div class="dependente"> <div class="grupo"> <p class="pergunta">E) Lorem ipsum dolor sit amet, nulla nec tortor?</p> <p><label><input type="radio" name="P-5" value="R-5-1" />Morbi in orci</label></p> <p><label><input type="radio" name="P-5" value="R-5-2" />Nulla purus lacus</label></p> </div> </div> </div> </div> </div> <div class="grupo"> <p class="pergunta">F) Lorem ipsum dolor sit amet, nulla nec tortor?</p> <p><label><input type="radio" name="P-6" value="R-6-1" />Morbi in orci</label></p> <p><label><input type="radio" name="P-6" value="R-6-2" />Nulla purus lacus, pulvinar vel</label></p> <p><label><input type="radio" name="P-6" value="R-6-3" />Aliquam ante</label></p> <p><label><input type="radio" name="P-6" value="R-6-4" />Suspendisse scelerisque dui nec velit</label></p> </div> <script type="text/javascript"> $('.dependente').hide(); $(':checkbox').click(function () { var checked = this.checked; $('.dependente:first',$(this).parents('div:first')).css('display',checked ? 'block':'none'); $('.dependente input',$(this).parents('div:first')).attr('checked', false).change(); }); </script> </body> </html>

    Read the article

  • C++ Sentinel/Count Controlled Loop beginning programming

    - by Bryan Hendricks
    Hello all this is my first post. I'm working on a homework assignment with the following parameters. Piecework Workers are paid by the piece. Often worker who produce a greater quantity of output are paid at a higher rate. 1 - 199 pieces completed $0.50 each 200 - 399 $0.55 each (for all pieces) 400 - 599 $0.60 each 600 or more $0.65 each Input: For each worker, input the name and number of pieces completed. Name Pieces Johnny Begood 265 Sally Great 650 Sam Klutz 177 Pete Precise 400 Fannie Fantastic 399 Morrie Mellow 200 Output: Print an appropriate title and column headings. There should be one detail line for each worker, which shows the name, number of pieces, and the amount earned. Compute and print totals of the number of pieces and the dollar amount earned. Processing: For each person, compute the pay earned by multiplying the number of pieces by the appropriate price. Accumulate the total number of pieces and the total dollar amount paid. Sample Program Output: Piecework Weekly Report Name Pieces Pay Johnny Begood 265 145.75 Sally Great 650 422.50 Sam Klutz 177 88.5 Pete Precise 400 240.00 Fannie Fantastic 399 219.45 Morrie Mellow 200 110.00 Totals 2091 1226.20 You are required to code, compile, link, and run a sentinel-controlled loop program that transforms the input to the output specifications as shown in the above attachment. The input items should be entered into a text file named piecework1.dat and the ouput file stored in piecework1.out . The program filename is piecework1.cpp. Copies of these three files should be e-mailed to me in their original form. Read the name using a single variable as opposed to two different variables. To accomplish this, you must use the getline(stream, variable) function as discussed in class, except that you will replace the cin with your textfile stream variable name. Do not forget to code the compiler directive #include < string at the top of your program to acknowledge the utilization of the string variable, name . Your nested if-else statement, accumulators, count-controlled loop, should be properly designed to process the data correctly. The code below will run, but does not produce any output. I think it needs something around line 57 like a count control to stop the loop. something like (and this is just an example....which is why it is not in the code.) count = 1; while (count <=4) Can someone review the code and tell me what kind of count I need to introduce, and if there are any other changes that need to be made. Thanks. [code] //COS 502-90 //November 2, 2012 //This program uses a sentinel-controlled loop that transforms input to output. #include <iostream> #include <fstream> #include <iomanip> //output formatting #include <string> //string variables using namespace std; int main() { double pieces; //number of pieces made double rate; //amout paid per amount produced double pay; //amount earned string name; //name of worker ifstream inFile; ofstream outFile; //***********input statements**************************** inFile.open("Piecework1.txt"); //opens the input text file outFile.open("piecework1.out"); //opens the output text file outFile << setprecision(2) << showpoint; outFile << name << setw(6) << "Pieces" << setw(12) << "Pay" << endl; outFile << "_____" << setw(6) << "_____" << setw(12) << "_____" << endl; getline(inFile, name, '*'); //priming read inFile >> pieces >> pay >> rate; // ,, while (name != "End of File") //while condition test { //begining of loop pay = pieces * rate; getline(inFile, name, '*'); //get next name inFile >> pieces; //get next pieces } //end of loop inFile.close(); outFile.close(); return 0; }[/code]

    Read the article

  • Self-relation messes up contents in fetching

    - by holographix
    Hi folks, I'm dealing with an annoying problem in core data I've got a table named Character, which is made as follows I'm filling the table in various steps: 1) fill the attributes of the table 2) fill the Character Relation (charRel) FYI charRel is defined as follows I'm feeding the contents by pulling the data from an xml, the feeding code is this curStr = [[NSMutableString stringWithString:[curStr stringByTrimmingCharactersInSet:[NSCharacterSet whitespaceAndNewlineCharacterSet]]] retain]; NSLog(@"Parsing relation within these keys %@, in order to get'em associated",curStr); NSArray *chunks = [curStr componentsSeparatedByString: @","]; for( NSString *relId in chunks ) { NSLog(@"Associating %@ with id %@",[currentCharacter valueForKey:@"character_id"], relId); NSFetchRequest *request = [[NSFetchRequest alloc] init]; NSPredicate *predicate = [NSPredicate predicateWithFormat:@"character_id == %@", relId]; [request setEntity:[NSEntityDescription entityForName:@"Character" inManagedObjectContext:[self managedObjectContext] ]]; [request setPredicate:predicate]; NSerror *error = nil; NSArray *results = [[self managedObjectContext] executeFetchRequest:request error:&error]; // error handling code if(error != nil) { NSLog(@"[SYMBOL CORRELATION]: retrieving correlated symbol error: %@", [error localizedDescription]); } else if([results count] > 0) { Character *relatedChar = [results objectAtIndex:0]; // grab the first result in the stack, could be done better! [currentCharacter addCharRelObject:relatedChar]; //VICE VERSA RELATIONS NSArray *charRels = [relatedChar valueForKey:@"charRel"]; BOOL alreadyRelated = NO; for(Character *charRel in charRels) { if([[charRel valueForKey:@"character_id"] isEqual:[currentCharacter valueForKey:@"character_id"]]) { alreadyRelated = YES; break; } } if(!alreadyRelated) { NSLog(@"\n\t\trelating %@ with %@", [relatedChar valueForKey:@"character_id"], [currentCharacter valueForKey:@"character_id"]); [relatedChar addCharRelObject:currentCharacter]; } } else { NSLog(@"[SYMBOL CORRELATION]: related symbol was not found! ##SKIPPING-->"); } [request release]; } NSLog(@"\t\t### TOTAL OF REALTIONS FOR ID %@: %d\n%@", [currentCharacter valueForKey:@"character_id"], [[currentCharacter valueForKey:@"charRel"] count], currentCharacter); error = nil; /* SAVE THE CONTEXT */ if (![managedObjectContext save:&error]) { NSLog(@"Whoops, couldn't save the symbol record: %@", [error localizedDescription]); NSArray* detailedErrors = [[error userInfo] objectForKey:NSDetailedErrorsKey]; if(detailedErrors != nil && [detailedErrors count] > 0) { for(NSError* detailedError in detailedErrors) { NSLog(@"\n################\t\tDetailedError: %@\n################", [detailedError userInfo]); } } else { NSLog(@" %@", [error userInfo]); } } at this point when I print out the values of the currentCharacter, everything looks perfect. every relation is in its place. in example in this log we can clearly see that this element has got 3 items in charRel: <Character: 0x5593af0> (entity: Character; id: 0x55938c0 <x-coredata://67288D50-D349-4B19-B7CB-F7AC4671AD61/Character/p86> ; data: { catRel = "<relationship fault: 0x9a29db0 'catRel'>"; charRel = ( "0x9a1f870 <x-coredata://67288D50-D349-4B19-B7CB-F7AC4671AD61/Character/p74>", "0x9a14bd0 <x-coredata://67288D50-D349-4B19-B7CB-F7AC4671AD61/Character/p109>", "0x558ba00 <x-coredata://67288D50-D349-4B19-B7CB-F7AC4671AD61/Character/p5>" ); "character_id" = 254; examplesRel = "<relationship fault: 0x9a29df0 'examplesRel'>"; meaning = "\n Left"; pinyin = "\n zu\U01d2"; "pronunciation_it" = "\n zu\U01d2"; strokenumber = 5; text = "\n \n <p>The most ancient form of this symbol"; unicodevalue = "\n \U5de6"; }) then when I'm in need of retrieving this item I perform an extraction, like this: // at first I get the single Character record NSFetchRequest *request = [[NSFetchRequest alloc] init]; NSError *error; NSPredicate *predicate = [NSPredicate predicateWithFormat:@"character_id == %@", self.char_id ]; [request setEntity:[NSEntityDescription entityForName:@"Character" inManagedObjectContext:_context ]]; [request setPredicate:predicate]; NSArray *fetchedObjs = [_context executeFetchRequest:request error:&error]; when, for instance, I print out in NSLog the contents of charRel NSArray *correlations = [singleCharacter valueForKey:@"charRel"]; NSLog(@"CHARACTER OBJECT \n%@", correlations); I get this Relationship fault for (<NSRelationshipDescription: 0x5568520>), name charRel, isOptional 1, isTransient 0, entity Character, renamingIdentifier charRel, validation predicates (), warnings (), versionHashModifier (null), destination entity Character, inverseRelationship (null), minCount 1, maxCount 99 on 0x6937f00 hope that I made myself clear. this thing is driving me insane, I've googled all over world, but I couldn't find a solution (and this make me think to as issue related to bad coding somehow :P). thank you in advance guys. k

    Read the article

  • Struts Tiles application

    - by rav83
    Am trying a tiles application.Below is my code tiles-defs.xml </tiles-definitions> <definition name="${YOUR_DEFINITION_HERE}"> </definition> <definition name="commonPage" path="/jsps/template.jsp"> <put name="header" value="/jsps/header.jsp" /> <put name="menu" value="/jsps/menu.jsp" /> <put name="body" value="/jsps/homebody.jsp" /> <put name="footer" value="/jsps/footer.jsp" /> </definition> <definition name="aboutUsPage" extends="commonPage"> <put name="body" value="/jsps/aboutUsBody.jsp" /> </definition> </tiles-definitions> struts-config.xml <action path="/aboutus" type="java.com.mbest.core.action.AboutUsAction" parameter="method"> <forward name="success" path="aboutUsPage"/> <forward name="failure" path="aboutUsPage"/> </action> </action-mappings> template.jsp <%@ taglib uri="/WEB-INF/struts-tiles.tld" prefix="tiles" %> <html> <head><title></title></head> <body> <table border="1" cellspacing="0" cellpadding="0" style="width: 98%; height: 100%"> <tr> <td colspan="2"> <tiles:insert attribute="header"/> </td> </tr> <tr style="height: 500px"> <td valign="top" style="width: 200px"> <tiles:insert attribute="menu"/> </td> <td valign="baseline" align="left"> <tiles:insert attribute="body"/> </tr> <tr> <td colspan="2"> <tiles:insert attribute="footer"/> </td> </tr> </table> </body> </html> homebody.jsp <%@ taglib uri="/WEB-INF/struts-bean.tld" prefix="bean" %> <%@taglib uri="/WEB-INF/struts-html.tld" prefix="html"%> <%@taglib uri="/WEB-INF/struts-tiles.tld" prefix="tiles" %> <html> <head> <title></title> <style type="text/css"> <%@include file="../css/helper.css"%> <%@include file="../css/dropdown.css" %> <%@include file="../css/default.ultimate.css" %> </style> </head> <body> <div id="header"> <ul id="nav" class="dropdown dropdown-horizontal"> <li><span class="dir"><html:link page="/aboutus.do?method=aboutUsPage" >About Us</html:link></span></li> <li><span class="dir"><a href="./">Products</a></span></li> <li><span class="dir"><a href="./">Infrastructure</a></span></li> <li><span class="dir"><a href="./">Pharmaceutical Formulations</a></span></li> <li><span class="dir"><a href="./">Contact Us</a></span></li> </ul> </div> </body> </html> AboutUsAction.java package java.com.mindbest.core.action; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import org.apache.struts.action.ActionForm; import org.apache.struts.action.ActionForward; import org.apache.struts.action.ActionMapping; import org.apache.struts.actions.DispatchAction; public class AboutUsAction extends DispatchAction { public ActionForward aboutUsPage(ActionMapping mapping,ActionForm form, HttpServletRequest request,HttpServletResponse response)throws Exception { return mapping.findForward("success"); } } aboutUsBody.jsp hello In my above code if i try to access the app using (domainname)/example/aboutus.do its giving 500 error.Can anyone help me figure this out?

    Read the article

  • on click checkbox set input attr

    - by Tommy Arnold
    html form with 4 columns the first 2 columns are the sizes inside input boxes with disabled ='disabled', when they click radio button to select a size a checkbox appears, when they click that checkbox I would like to change the class and disabled attr of the inputs on that table row to allow them to edit the input box <table width="388" border="1" id="product1"> <tr> <td width="100">Width</td> <td width="100">Height</td> <td width="48">Price</td> <td width="65">Select</td> </tr> <tr> <td><input type="text" disabled='disabled'value="200"/><span> CMS</span></td> <td><input disabled='disabled'type="text" value="500"/><span> CMS</span></td> <td>£50.00</td> <td><input type="radio" name="product1" value="size1" /> Customise<input type="checkbox" name="custom[size1]" class="custombox" value="1"/></td> </tr> <tr> <td>200</td> <td>1000</td> <td>£100.00</td> <td><input type="radio" name="product1" value="size2" /> Customise<input disabled='disabled' type="checkbox" name="custom[size2]" class="custombox" value="1"/></td> </tr> <tr> <td>200</td> <td>1500</td> <td>£150</td> <td><input type="radio" name="product1" value="size3" /> Customise<input type="checkbox" name="custom[size3]" class="custombox" value="1"/></td> </tr> </table> <table width="288" border="1" id="product2"> <tr> <td width="72">Width</td> <td width="75">Height</td> <td width="48">Price</td> <td width="65">&nbsp;</td> </tr> <tr> <td>200</td> <td>500</td> <td>£50.00</td> <td><input type="radio" name="product2" value="size1" /> Customise<input type="checkbox" name="custom[size1]" class="custombox" value="1"/></td> </tr> <tr> <td>200</td> <td>1000</td> <td>£100.00</td> <td><input type="radio" name="product2" value="size2" /> Customise<input type="checkbox" name="custom[size2]" class="custombox" value="1"/></td> </tr> <tr> <td>200</td> <td>1500</td> <td>£150</td> <td><input type="radio" name="product2" value="size3" /> Customise<input type="checkbox" name="custom[size3]" class="custombox" value="1"/></td> </tr> <table> CSS input[type=checkbox] { display: none; } input[type=checkbox].shown { display: inline; } input .edit{ border:1px solid red; } input[disabled='disabled'] { border:0px; width:60px; padding:5px; float:left; background:#fff; } span{float:left; width:30px; padding:5px;} Jquery $("body :checkbox").hide(); // The most obvious way is to set radio-button click handlers for each table separatly: $("#product1 :radio").click(function() { $("#product1 :checkbox").hide(); $("#product1 .cbox").hide(); $(this).parent().children(":checkbox").show(); $(this).parent().children(".cbox").show(); }); $("#product2 :radio").click(function() { $("#product2 :checkbox").hide(); $("#product2 .cbox").hide(); $(this).parent().children(":checkbox").show(); $(this).parent().children(".cbox").show(); }); This is what I thought but its not working $("#product1 :checkbox").click(function(){ $(this).parent("tr").children("td :input").attr('disabled',''); $(this).parent("tr").children("td :input").toggleClass(edit); }); $("#product2 :checkbox").click(function(){ $(this).parent("tr").children("td :input").attr('disabled',''); $(this).parent("tr").children("td :input").toggleClass(edit); }); Thanks in advance for any help.

    Read the article

  • Search function fails because it refers to the wrong controller action?

    - by Christoffer
    My Sunspot search function (sunspot_rails gem) works just fine in my index view, but when I duplicate it to my show view my search breaks... views/supplierproducts/show.html.erb <%= form_tag supplierproducts_path, :method => :get, :id => "supplierproducts_search" do %> <p> <%= text_field_tag :search, params[:search], placeholder: "Search by SKU, product name & EAN number..." %> </p> <div id="supplierproducts"><%= render 'supplierproducts' %></div> <% end %> assets/javascripts/application.js $(function () { $('#supplierproducts th a').live('click', function () { $.getScript(this.href); return false; } ); $('#supplierproducts_search input').keyup(function () { $.get($("#supplierproducts_search").attr("action"), $("#supplierproducts_search").serialize(), null, 'script'); return false; }); }); views/supplierproducts/show.js.erb $('#supplierproducts').html('<%= escape_javascript(render("supplierproducts")) %>'); views/supplierproducts/_supplierproducts.hmtl.erb <%= hidden_field_tag :direction, params[:direction] %> <%= hidden_field_tag :sort, params[:sort] %> <table class="table table-bordered"> <thead> <tr> <th><%= sortable "sku", "SKU" %></th> <th><%= sortable "name", "Product name" %></th> <th><%= sortable "stock", "Stock" %></th> <th><%= sortable "price", "Price" %></th> <th><%= sortable "ean", "EAN number" %></th> </tr> </thead> <% for supplierproduct in @supplier.supplierproducts %> <tbody> <tr> <td><%= supplierproduct.sku %></td> <td><%= supplierproduct.name %></td> <td><%= supplierproduct.stock %></td> <td><%= supplierproduct.price %></td> <td><%= supplierproduct.ean %></td> </tr> </tbody> <% end %> </table> controllers/supplierproducts_controller.rb class SupplierproductsController < ApplicationController helper_method :sort_column, :sort_direction def show @supplier = Supplier.find(params[:id]) @search = @supplier.supplierproducts.search do fulltext params[:search] end @supplierproducts = @search.results end end private def sort_column Supplierproduct.column_names.include?(params[:sort]) ? params[:sort] : "name" end def sort_direction %w[asc desc].include?(params[:direction]) ? params[:direction] : "asc" end models/supplierproduct.rb class Supplierproduct < ActiveRecord::Base attr_accessible :ean, :name, :price, :sku, :stock, :supplier_id belongs_to :supplier validates :supplier_id, presence: true searchable do text :ean, :name, :sku end end Visiting show.html.erb works just fine. Log shows: Started GET "/supplierproducts/2" for 127.0.0.1 at 2012-06-24 13:44:52 +0200 Processing by SupplierproductsController#show as HTML Parameters: {"id"=>"2"} Supplier Load (0.1ms) SELECT "suppliers".* FROM "suppliers" WHERE "suppliers"."id" = ? LIMIT 1 [["id", "2"]] SOLR Request (252.9ms) [ path=#<RSolr::Client:0x007fa5880b8e68> parameters={data: fq=type%3ASupplierproduct&start=0&rows=30&q=%2A%3A%2A, method: post, params: {:wt=>:ruby}, query: wt=ruby, headers: {"Content-Type"=>"application/x-www-form-urlencoded; charset=UTF-8"}, path: select, uri: http://localhost:8982/solr/select?wt=ruby, open_timeout: , read_timeout: } ] Supplierproduct Load (0.2ms) SELECT "supplierproducts".* FROM "supplierproducts" WHERE "supplierproducts"."id" IN (1) Supplierproduct Load (0.1ms) SELECT "supplierproducts".* FROM "supplierproducts" WHERE "supplierproducts"."supplier_id" = 2 Rendered supplierproducts/_supplierproducts.html.erb (2.2ms) Rendered supplierproducts/show.html.erb within layouts/application (3.3ms) Rendered layouts/_shim.html.erb (0.0ms) User Load (0.1ms) SELECT "users".* FROM "users" WHERE "users"."remember_token" = 'zMrtTbDun2MjMHRApSthCQ' LIMIT 1 Rendered layouts/_header.html.erb (2.1ms) Rendered layouts/_footer.html.erb (0.2ms) Completed 200 OK in 278ms (Views: 20.6ms | ActiveRecord: 0.6ms | Solr: 252.9ms) But it breaks when I type in a search. Log shows: Started GET "/supplierproducts?utf8=%E2%9C%93&search=a&direction=&sort=&_=1340538830635" for 127.0.0.1 at 2012-06-24 13:53:50 +0200 Processing by SupplierproductsController#index as JS Parameters: {"utf8"=>"?", "search"=>"a", "direction"=>"", "sort"=>"", "_"=>"1340538830635"} Rendered supplierproducts/_supplierproducts.html.erb (2.4ms) Rendered supplierproducts/index.js.erb (2.9ms) Completed 500 Internal Server Error in 6ms ActionView::Template::Error (undefined method `supplierproducts' for nil:NilClass): 10: <th><%= sortable "ean", "EAN number" %></th> 11: </tr> 12: </thead> 13: <% for supplierproduct in @supplier.supplierproducts %> 14: <tbody> 15: <tr> 16: <td><%= supplierproduct.sku %></td> app/views/supplierproducts/_supplierproducts.html.erb:13:in `_app_views_supplierproducts__supplierproducts_html_erb___2251600857885474606_70174444831200' app/views/supplierproducts/index.js.erb:1:in `_app_views_supplierproducts_index_js_erb___1613906916161905600_70174464073480' Rendered /Users/Computer/.rvm/gems/ruby-1.9.3-p194@myapp/gems/actionpack-3.2.3/lib/action_dispatch/middleware/templates/rescues/_trace.erb (33.3ms) Rendered /Users/Computer/.rvm/gems/ruby-1.9.3-p194@myapp/gems/actionpack-3.2.3/lib/action_dispatch/middleware/templates/rescues/_request_and_response.erb (0.9ms) Rendered /Users/Computer/.rvm/gems/ruby-1.9.3-p194@myapp/gems/actionpack-3.2.3/lib/action_dispatch/middleware/templates/rescues/template_error.erb within rescues/layout (39.7ms)

    Read the article

  • Paypal development. encrypt transactions. php p12

    - by ninchen
    when i take a look at the paypal documentation, they say "Note that the PayPal SDK for PHP does not require SSL encryption". https://developer.paypal.com/docs/classic/api/apiCredentials/#encrypting-your-certificate Is the statement of this phrase, that i don't have to create a p12 certificate when working with php, but use the public_key.pem and paypal_public_key.pem? If yes: Is it secure enough to create the encrypted form input elements without p12 certificate? If no: What do they mean? :-) Before this question came up, i've tested this little programm. http://www.softarea51.com/blog/how-to-integrate-your-custom-shopping-cart-with-paypal-website-payments-standard-using-php/ There is a config file paypal-wps-config.inc.php where i can define the paths to my certificates. // tryed to use // 'paypal_cert.p12 '; $config['private_key_path'] = '/home/folder/.cert/pp/prvkey.pem'; // must match the one you set when you created the private key $config['private_key_password'] = ''; //'my_password'; When i try to use the p12 certificate, openssl_error_string() returns "Could not sign data: error:0906D06C:PEM routines:PEM_read_bio:no start line openssl_pkcs7_sign When i instead use the prvkey.pem without password all works fine. Here is the function, which signs and encrypt the data. function signAndEncrypt($dataStr_, $ewpCertPath_, $ewpPrivateKeyPath_, $ewpPrivateKeyPwd_, $paypalCertPath_) { $dataStrFile = realpath(tempnam('/tmp', 'pp_')); $fd = fopen($dataStrFile, 'w'); if(!$fd) { $error = "Could not open temporary file $dataStrFile."; return array("status" => false, "error_msg" => $error, "error_no" => 0); } fwrite($fd, $dataStr_); fclose($fd); $signedDataFile = realpath(tempnam('/tmp', 'pp_')); **// here the error came from** if(!@openssl_pkcs7_sign( $dataStrFile, $signedDataFile, "file://$ewpCertPath_", array("file://$ewpPrivateKeyPath_", $ewpPrivateKeyPwd_), array(), PKCS7_BINARY)) { unlink($dataStrFile); unlink($signedDataFile); $error = "Could not sign data: ".openssl_error_string(); return array("status" => false, "error_msg" => $error, "error_no" => 0); } unlink($dataStrFile); $signedData = file_get_contents($signedDataFile); $signedDataArray = explode("\n\n", $signedData); $signedData = $signedDataArray[1]; $signedData = base64_decode($signedData); unlink($signedDataFile); $decodedSignedDataFile = realpath(tempnam('/tmp', 'pp_')); $fd = fopen($decodedSignedDataFile, 'w'); if(!$fd) { $error = "Could not open temporary file $decodedSignedDataFile."; return array("status" => false, "error_msg" => $error, "error_no" => 0); } fwrite($fd, $signedData); fclose($fd); $encryptedDataFile = realpath(tempnam('/tmp', 'pp_')); if(!@openssl_pkcs7_encrypt( $decodedSignedDataFile, $encryptedDataFile, file_get_contents($paypalCertPath_), array(), PKCS7_BINARY)) { unlink($decodedSignedDataFile); unlink($encryptedDataFile); $error = "Could not encrypt data: ".openssl_error_string(); return array("status" => false, "error_msg" => $error, "error_no" => 0); } unlink($decodedSignedDataFile); $encryptedData = file_get_contents($encryptedDataFile); if(!$encryptedData) { $error = "Encryption and signature of data failed."; return array("status" => false, "error_msg" => $error, "error_no" => 0); } unlink($encryptedDataFile); $encryptedDataArray = explode("\n\n", $encryptedData); $encryptedData = trim(str_replace("\n", '', $encryptedDataArray[1])); return array("status" => true, "encryptedData" => $encryptedData); } // signAndEncrypt } // PPCrypto The main questions: 1. Is it possible to use p12 cert with php, or is it secure enough to work without it? 2. Why i become an error when using openssl_pkcs7_sign Please help. Greetings ninchen

    Read the article

  • Google App Engine - SiteMap Creation for a social network

    - by spidee
    Hi all. I am creating a social tool - I want to allow search engines to pick up "public" user profiles - like twitter and face-book. I have seen all the protocol info at http://www.sitemaps.org and i understand this and how to build such a file - along with an index if i exceed the 50K limit. Where i am struggling is the concept of how i make this run. The site map for my general site pages is simple i can use a tool to create the file - or a script - host the file - submit the file and done. What i then need is a script that will create the site-maps of user profiles. I assume this would be something like: <?xml version="1.0" encoding="UTF-8"?> <urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9"> <url> <loc>http://www.socialsite.com/profile/spidee</loc> <lastmod>2010-5-12</lastmod> <changefreq>???</changefreq> <priority>???</priority> </url> <url> <loc>http://www.socialsite.com/profile/webbsterisback</loc> <lastmod>2010-5-12</lastmod> <changefreq>???</changefreq> <priority>???</priority> </url> </urlset> Ive added some ??? as i don't know how i should set these settings for my profiles based on the following:- When a new profile is created it must be added to a site-map. If the profile is changed or if "certain" properties are changed - then i don't know if i update the entry in the map - or do something else? (updating would be a nightmare!) Some users may change their profile. In terms of relevance to the search engine the only way a google or yahoo search will find the users (for my requirement) profile would be for example by means of [user name] and [location] so once the entry for the profile has been added to the map file the only reason to have the search-bot re-index the profile would be if the user changed their user-name - which they cant. or their location - and or set their settings so that their profile would be "hidden" from search engines. I assume my map creation will need to be dynamic. From what i have said above i would imagine that creating a new profile and possible editing certain properties could mark it as needing adding/updating in the sitemap. Assuming i will have millions of profiles added/being edited how can i manage this in a sensible manner. i know i need a script that can append urls as each profile is created i know the script will prob be a TASK - running at a set freq - perhaps the profiles have a property like "indexed" and the TASK sets them to "true" when the profiles are added to the map. I dont see the best way to store the map - do i store it in the datastore i.e; model=sitemaps properties key_name=sitemap_xml_1 (and for my map sitemap_index_xml) mapxml=blobstore (the raw xml map or ror map) full=boolean (set true when url count is 50) # might need this as a shard will tell us To make this work my thoughts are m cache the current site map structure as "sitemap_xml" keep a shard of url count when my task executes 1. build the xml structure for say the first 100 urls marked "index==false" (how many could u run at a time?) 2. test if the current mcache sitemap is full (shardcounter+10050K) 3.a if the map is near full create a new map entry in models "sitemap_xml_2" - update the map_index file (also stored in my model as "sitemap_index" start a new shard - or reset.2 3.b if the map is not full grab it from mcache 4.append the 100 url xml structure 5.save / m cache the map I can now add a handler using a url map/route like /sitemaps/* Get my * as map name and serve the maps from the blobstore/mache on the fly. Now my question is does this work - is this the right way or a good way to start? Will this handle the situation of making sure the search bots update when a user changes their profile - possibly by setting the change freq correctly? - Do i need a more advance system :( ? or have i re-invented the wheel! I hope this is all clear and make some form of sense :-)

    Read the article

  • rowupdating not giving new values.

    - by pankaj
    Hi, I am working on a application where i am using rowupdating event of the gridview. I am using templatefield in my columns so i am not able to get the new values from the textboxws that i am having in the gridview. How can i get the new values from the textboxes. Following is my code in rowupdating: protected void gviewTemplate_RowUpdating(object sender, GridViewUpdateEventArgs e) { gviewTemplate.EditIndex = -1; string rowNum = ViewState["ID"].ToString(); Label lbl2 = (Label)gviewTemplate.Rows[e.RowIndex].FindControl("lblTemplateName"); Label lbl1 = (Label)gviewTemplate.Rows[e.RowIndex].FindControl("lblUploaded"); TextBox txtTempName = (TextBox)gviewTemplate.Rows[e.RowIndex].FindControl("txtTemplateName"); TextBox txtHeading = (TextBox)gviewTemplate.Rows[e.RowIndex].FindControl("txtHeading"); TextBox txtCoupon = (TextBox)gviewTemplate.Rows[e.RowIndex].FindControl("txtCouponText"); TextBox txtBrand = (TextBox)gviewTemplate.Rows[e.RowIndex].FindControl("txtBrandName"); TextBox txtSearchText = (TextBox)gviewTemplate.Rows[e.RowIndex].FindControl("txtSearch"); TextBox txtDiscount = (TextBox)gviewTemplate.Rows[e.RowIndex].FindControl("txtDiscount"); TextBox txtStartDt = (TextBox)gviewTemplate.Rows[e.RowIndex].FindControl("txtStartDt"); } i want to get the new values form these textboxes but it is always giving me old values. and yes, e.Newvalues is not giving me anything. It is always empty. This is small extract from my gridview design: <asp:GridView runat="server" AutoGenerateColumns="False" ID="gviewTemplate" onrowdatabound="gviewTemplate_RowDataBound" DataKeyNames="F1" onrowcommand="gviewTemplate_RowCommand" onrowediting="gviewTemplate_RowEditing" onrowcancelingedit="gviewTemplate_RowCancelingEdit" onrowupdating="gviewTemplate_RowUpdating" onrowdeleting="gviewTemplate_RowDeleting" onrowupdated="gviewTemplate_RowUpdated"> <Columns> <asp:TemplateField HeaderText="Uploaded Image"> <EditItemTemplate> <asp:LinkButton Text="Reload" runat="server" OnClick="lbtnReloadImage_Click" CommandName="reload" ID="lbtnReloadImage"></asp:LinkButton> </EditItemTemplate> <ItemTemplate> <table id="Table2" runat="server" width="100%" cellpadding="0" cellspacing="0" border="0"> <tr> <td> <asp:Label Runat="server" Text='<%# Eval("Uploaded") %>' ID="lblUploaded"></asp:Label> </td> </tr> </table> </ItemTemplate> </asp:TemplateField> <asp:TemplateField HeaderText="Template Name"> <ItemStyle VerticalAlign="Top" HorizontalAlign="Center" /> <EditItemTemplate> <asp:TextBox ID="txtTemplateName" Width="60" Runat="server" Text='<%# Eval("F1") %>'></asp:TextBox> <asp:RequiredFieldValidator ID="RequiredFieldValidator1" Runat="server" ErrorMessage="You must provide a Product Name." ControlToValidate="txtTemplateName">*</asp:RequiredFieldValidator> </EditItemTemplate> <ItemTemplate> <table id="Table3" runat="server" width="100%" cellpadding="0" cellspacing="0" border="0"> <tr> <td> <asp:Label ID="lblTemplateName" runat="server" Text='<%# Eval("F1") %>'></asp:Label> </td> </tr> </table> </ItemTemplate> </asp:TemplateField> <asp:TemplateField HeaderText="Heading"> <ItemStyle VerticalAlign="Top" HorizontalAlign="Center" /> <EditItemTemplate> <asp:TextBox ID="txtHeading" Runat="server" Width="60" Text='<%# Eval("F2") %>'></asp:TextBox> <asp:RequiredFieldValidator ID="RequiredFieldValidator2" Runat="server" ErrorMessage="You must provide a Product Name." ControlToValidate="txtHeading">*</asp:RequiredFieldValidator> </EditItemTemplate> <ItemTemplate> <table id="Table4" runat="server" width="100%" cellpadding="0" cellspacing="0" border="0"> <tr> <td> <asp:Label ID="lblHeading" runat="server" Text='<%# Eval("F2") %>'></asp:Label> </td> </tr> </table> </ItemTemplate> </asp:TemplateField> <asp:TemplateField HeaderText="Coupon Text"> <ItemStyle VerticalAlign="Top" HorizontalAlign="Center" /> <EditItemTemplate> <asp:TextBox ID="txtCouponText" Runat="server" Width="80" Text='<%# Bind("F3") %>'></asp:TextBox> <asp:RequiredFieldValidator ID="RequiredFieldValidator3" Runat="server" ErrorMessage="You must provide a Product Name." ControlToValidate="txtCouponText">*</asp:RequiredFieldValidator> </EditItemTemplate> <ItemTemplate> <table id="Table5" runat="server" width="100%" cellpadding="0" cellspacing="0" border="0"> <tr> <td> <asp:Label Runat="server" Text='<%# Bind("F3") %>' ID="lblCouponText"></asp:Label> </td> </tr> </table> </ItemTemplate> </asp:TemplateField> Can anyone please tell me how to get the new values from these textboxes?

    Read the article

< Previous Page | 978 979 980 981 982 983 984 985 986 987 988 989  | Next Page >