Search Results

Search found 14 results on 1 pages for 'shotgun'.

Page 1/1 | 1 

  • Errors with shotgun gem and msvcrt-ruby18.dll when running my Sinatra app

    - by Adam Siddhi
    Greetings, Every time I make a change to a Sinatra app I'm working on and try to refresh the browser (located at http://localhost:4567/) the browser will refresh and, the console window seems to restart the WEB brick server. The problem is that the content in the browser window does not change. A friend of mine told me it was a shotgun issue and referred me to rtomayko's shotgun gem: http://github.com/rtomayko/shotgun On this page I read that the shotgun gem would basically solve my problem, allowing the changes made to my app to show up in the browser window after I refresh it. So I installed the shotgun gem. The installation was successful. To activate the shotgun function you have to type shotgun before the file name. In this case my Sinatra app's file name is shortener.rb When I type shotgun shortener.rb to run my Sinatra app I get this error: C:\ruby\sinatrashotgun shortener.rb c:/Ruby19/lib/ruby/gems/1.9.1/gems/shotgun-0.6/bin/shotgun:137:in `': No such f ile or directory - uname (Errno::ENOENT) from c:/Ruby19/lib/ruby/gems/1.9.1/gems/shotgun-0.6/bin/shotgun:137:in block in ' from c:/Ruby19/lib/ruby/gems/1.9.1/gems/shotgun-0.6/bin/shotgun:136:in each' from c:/Ruby19/lib/ruby/gems/1.9.1/gems/shotgun-0.6/bin/shotgun:136:in find' from c:/Ruby19/lib/ruby/gems/1.9.1/gems/shotgun-0.6/bin/shotgun:136:in <top (required)>' from c:/Ruby19/bin/shotgun:19:inload' from c:/Ruby19/bin/shotgun:19:in `' I should also mention that before testing the shotgun method out to see if it worked, I installed the mongrel (I realize I should have checked to see if shotgun worked before doing this as installing mongrel has complicated this problem). So on top of getting the error message above I also get a pop up window from Ruby.exe saying: Ruby.exe - Unable to load component This application has failed to start because msvcrt-ruby18.dll was not found. Re-installing the application may fix this problem. I have no idea what msvcrt-ruby18.dll is but I know that installing either shotgun and/or mongrel created this problem. Where to go from here? Thanks, Adam

    Read the article

  • Staring Shotgun with Thin as server using SSL

    - by Bryan Paronto
    I have a Facebook app I'm developing locally. I've configure everything correctly to SSL development with Thin. I know that using a shotgun.rb file, I can pass options to Thin to get it to start in SSL mode, but I'm not exact sure how to pass these options. I'm thinking something like: Thin:Server::options[:ssl] = true Thin:Server::options[:ssl_cert_path] = /path/to/cert/ Restarting thin constantly is getting old, so I'd really like to be able to use shotgun in development.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Superb post - What if Visual Studio had Achievements?

    - by Eric Nelson
    This post is simple superb – What if Visual Studio had Achievements :-) Although maybe you need to a developer who also has an Xbox to fully understand how good it is. My favourites: Shotgun Debugging – 5 Consecutive Solution Rebuilds with a single character change The Architect – Created 25 Interfaces in a single project The Multitasker – Have more than 50 source files open at the same time Every Option Considered – Created an enum with more than 30 values Thanks to Dominic for highlighting it to me!

    Read the article

  • (My)SQL performance: updating one field vs many unneccesary fields

    - by changokun
    i'm processing a form that has a lot of fields for a user who is editing an existing record. the user may have only changed one field, and i would typically do an update query that sets the values of all the fields, even though most of them don't change. i could do some sort of tracking to see which fields have actually changed, and only update the few that did. is there a performance difference between updating all fields in a record vs only the one that changed? are there other reasons to go with either method? the shotgun method is pretty easy...

    Read the article

  • Self-Configuring Classes W/ Command Line Args: Pattern or Anti-Pattern?

    - by dsimcha
    I've got a program where a lot of classes have really complicated configuration requirements. I've adopted the pattern of decentralizing the configuration and allowing each class to take and parse the command line/configuration file arguments in its c'tor and do whatever it needs with them. (These are very coarse-grained classes that are only instantiated a few times, so there is absolutely no performance issue here.) This avoids having to do shotgun surgery to plumb new options I add through all the levels they need to be passed through. It also avoids having to specify each configuration option in multiple places (where it's parsed and where it's used). What are some advantages/disadvantages of this style of programming? It seems to reduce separation of concerns in that every class is now doing configuration stuff, and to make programs less self-documenting because what parameters a class takes becomes less explicit. OTOH, it seems to increase encapsulation in that it makes each class more self-contained because no other part of the program needs to know exactly what configuration parameters a class might need.

    Read the article

  • Why does clicking on Windows 7 Printer Properties Result In Driver Not Installed?

    - by octopusgrabbus
    The question I need to ask is has anyone heard of getting a "driver not installed" error when clicking on a printer's properties on Windows 7, and is there a workaround? Here are the details of the problem. One of our users has a Windows 7 desktop, and an HP LaserJet 4050 T connected to via a parallel-to-usb converter. The PLC5 universal driver was installed for series 4050 printers. I needed to install the PLC 6 driver, which completed successfully. The user is an administrator of the system, and I was prompted to and accepted running as Administrator to install the driver. After the install, I went to see the 4050's properties and was prompted that the PLC6 driver was not installed. I believe the PLC6 driver was installed, because the PLC5 driver resulted in receiving an official HP error page indicating the printer was "not set up for collating" as the second page of printing two copies of a one page email. This problem did not occur with the PLC 6 driver. Oddly enough, setting back to PLC5 produced the same error about the PLC5 driver not being installed. I ignored/dismissed the error box (did not re-install the driver), and reproduced the error, with the second page being the HP not set up for collating error page. Any thoughts on what is causing this and how to clear it would be appreciated. The closest fix I could find was on a Microsoft tech page, and they had me clear winsock out of a Administrator run command line, followed by a reboot. That did not fix the problem. I have also found this http://social.technet.microsoft.com/Forums/windowsserver/en-US/5101195b-3aca-4699-9a06-db4578614e2d/changing-driver-results-in-printer-driver-is-not-installed-error-on-server-2008?forum=winserverprint and will look into trying some of these suggestions, which appear to me to be a "shotgun" approach to fixing the problem.

    Read the article

  • Reloading Sinatra app on every request on Windows

    - by Darth
    I've set up Rack::Reload according to this thread # config.ru require 'rubygems' require 'sinatra' set :environment, :development require 'app' run Sinatra::Application # app.rb class Sinatra::Reloader < Rack::Reloader def safe_load(file, mtime, stderr = $stderr) if file == Sinatra::Application.app_file ::Sinatra::Application.reset! stderr.puts "#{self.class}: reseting routes" end super end end configure(:development) { use Sinatra::Reloader } get '/' do 'foo' end Running with thin via thin start -R config.ru, but it only reloads newly added routes. When I change already existing route, it still runs the old code. When I add new route, it correctly reloads it, so it is accessible, but it doesn't reload anything else. For example, if I changed routes to get '/' do 'bar' end get '/foo' do 'baz' end Than / would still serve foo, even though it has changed, but /foo would correctly reload and serve baz. Is this normal behavior, or am I missing something? I'd expect whole source file to be reloaded. The only way around I can think of right now is restarting whole webserver when filesystem changes. I'm running on Windows Vista x64, so I can't use shotgun because of fork().

    Read the article

  • Design pattern to use instead of multiple inheritance

    - by mizipzor
    Coming from a C++ background, Im used to multiple inheritance. I like the feeling of a shotgun squarely aimed at my foot. Nowadays, I work more in C# and Java, where you can only inherit one baseclass but implement any number of interfaces (did I get the terminology right?). For example, lets consider two classes that implement a common interface but different (yet required) baseclasses: public class TypeA : CustomButtonUserControl, IMagician { public void DoMagic() { // ... } } public class TypeB : CustomTextUserControl, IMagician { public void DoMagic() { // ... } } Both classes are UserControls so I cant substitute the base class. Both needs to implement the DoMagic function. My problem now is that both implementations of the function are identical. And I hate copy-and-paste code. The (possible) solutions: I naturally want TypeA and TypeB to share a common baseclass, where I can write that identical function definition just once. However, due to having the limit of just one baseclass, I cant find a place along the hierarchy where it fits. One could also try to implement a sort of composite pattern. Putting the DoMagic function in a separate helper class, but the function here needs (and modifies) quite a lot of internal variables/fields. Sending them all as (reference) parameters would just look bad. My gut tells me that the adapter pattern could have a place here, some class to convert between the two when necessery. But it also feels hacky. I tagged this with language-agnostic since it applies to all languages that use this one-baseclass-many-interfaces approach. Also, please point out if I seem to have misunderstood any of the patterns I named. In C++ I would just make a class with the private fields, that function implementation and put it in the inheritance list. Whats the proper approach in C#/Java and the like?

    Read the article

  • I don't like Python functions that take two or more iterables. Is it a good idea?

    - by Xavier Ho
    This question came from looking at this question on Stackoverflow. def fringe8((px, py), (x1, y1, x2, y2)): Personally, it's been one of my pet peeves to see a function that takes two arguments with fixed-number iterables (like a tuple) or two or more dictionaries (Like in the Shotgun API). It's just hard to use, because of all the verbosity and double-bracketed enclosures. Wouldn't this be better: >>> class Point(object): ... def __init__(self, x, y): ... self.x = x ... self.y = y ... >>> class Rect(object): ... def __init__(self, x1, y1, x2, y2): ... self.x1 = x1 ... self.y1 = y1 ... self.x2 = x2 ... self.y2 = y2 ... >>> def fringe8(point, rect): ... # ... ... >>> >>> point = Point(2, 2) >>> rect = Rect(1, 1, 3, 3) >>> >>> fringe8(point, rect) Is there a situation where taking two or more iterable arguments is justified? Obviously the standard itertools Python library needs that, but I can't see it being pretty in maintainable, flexible code design.

    Read the article

  • XNA Notes 006

    - by George Clingerman
    If you used to think the XNA community was small and inactive, hopefully these XNA Notes are opening your eyes. And I honestly feel like I’m still only catching the tail end of everything that’s going on. It’s a large and active community and you can be so mired down in one part of it you miss all sorts of cool stuff another part is doing. XNA is many things to a lot of people and that makes for a lot of really awesome things going on. So here’s what I saw going on this last week! Time Critical XNA New: XNA Team - Peer Review now closes for XNA 3.1 games http://blogs.msdn.com/b/xna/archive/2011/02/08/peer-review-pipeline-closed-for-new-xna-gs-3-1-games-or-updates-on-app-hub.aspx http://twitter.com/XNACommunity/statuses/34649816529256448 The XNA Team posts about a meet up with Microsoft for Creator’s going to be at GDC, March 3rd at the Lobby Bar http://on.fb.me/fZungJ XNA Team: @mklucher is busying playing the the bubblegum on WP7 made by a member of the XNA team (although reportedly made in Silverlight? Crazy! ;) ) http://twitter.com/mklucher/statuses/34645662737895426 http://bubblegum.me Shawn Hargreaves posts multiple posts (is this a sign that something new is coming from the XNA team? Usually when Shawn has time to post, something has just wrapped up…) Random Shuffle http://blogs.msdn.com/b/shawnhar/archive/2011/02/09/random-shuffle.aspx Doing the right thing: resume, rewind or skip ahead http://blogs.msdn.com/b/shawnhar/archive/2011/02/10/doing-the-right-thing-resume-rewind-or-skip-ahead.aspx XNA Developers: Andrew Russel was on .NET Rocks recently talking with Carl and Richard about developing games for Xbox, iPhone and Android http://www.dotnetrocks.com/default.aspx?ShowNum=635 Eric W. releases the Fishing Girl source code into the wild http://ericw.ca/blog/posts/fishing-girl-now-open-source/ http://forums.create.msdn.com/forums/p/74642/454512.aspx#454512 BinaryTweedDeej reminds that XNA community that Indie City wants you involved http://twitter.com/BinaryTweedDeej/statuses/34596114028044288 http://www.indiecity.com Mike McLaughlin (@mikebmcl) releases his first two XNA articles on the TechNet wiki http://social.technet.microsoft.com/wiki/contents/articles/xna-framework-overview.aspx http://social.technet.microsoft.com/wiki/contents/articles/content-pipeline-overview.aspx John Watte plays around with the Content Pipeline and Music Visualization exploring just what can be done. http://www.enchantedage.com/xna-content-pipeline-fft-song-analysis http://www.enchantedage.com/fft-in-xna-content-pipeline-for-beat-detection-for-the-win Simon Stevens writes up his talk on Vector Collision Physics http://www.simonpstevens.com/News/VectorCollisionPhysics @domipheus puts together an XNA Task Manager http://www.flickr.com/photos/domipheus/5405603197/ MadNinjaSkillz releases his fork of Nick's Easy Storage component on CodePlex http://twitter.com/MadNinjaSkillz/statuses/34739039068229634 http://ezstorage.codeplex.com @ActiveNick was interviewed by Rob Cameron and discusses Windows Phone 7, Bing Maps and XNA http://twitter.com/ActiveNick/statuses/35348548526546944 http://msdn.microsoft.com/en-us/cc537546 Radiangames (Luke Schneider) posts about converting his games from XNA to Unity http://radiangames.com/?p=592 UberMonkey (@ElementCy) posts about a new project in the works, CubeTest a Minecraft style terrain http://www.ubergamermonkey.com/personal-projects/new-project-in-the-works/?utm_source=feedburner&utm_medium=feed&utm_campaign=Feed%3A+Ubergamermonkey+%28UberGamerMonkey%29 Xbox LIVE Indie Games (XBLIG): VideoGamer Rob review Bonded Realities http://videogamerrob.wordpress.com/2011/02/05/xblig-review-bonded-realities/ XBLIG Round Up on Gamergeddon http://www.gamergeddon.com/2011/02/06/xbox-indie-game-round-up-february-6th/ Are gamers still rating Indie Games after the Xbox Dashboard update? http://www.gamemarx.com/news/2011/02/06/are-gamers-still-rating-indie-games-after-the-xbox-dashboard-update.aspx Joystiq - Xbox Live Indie Gems: Corrupted http://www.joystiq.com/2011/02/04/xbox-live-indie-gems-corrupted/ Raymond Matthews of DarkStarMatryx reviews (Almost) Total Mayhem and Aban Hawkins & the 1000 Spikes http://www.darkstarmatryx.com/?p=225 http://www.darkstarmatryx.com/?p=229 8 Bit Horse reviews Aban Hawkins & the 1000 spikes http://8bithorse.blogspot.com/2011/01/aban-hawkins-1000-spikes-xbl-indie.html 2010 wrap-up for FunInfused Games http://www.krissteele.net/blogdetails.aspx?id=245 NeoGaf roundup of January's XBLIGs http://www.neogaf.com/forum/showthread.php?t=420528 Armless Ocotopus interviews Michael Ventnor creator of Bonded Realities http://www.armlessoctopus.com/2011/02/07/interview-michael-ventnor-of-red-crest-studios/ @recharge_media posts about the new city music for Woodvale in Sin Rising http://rechargemedia.com/2011/02/08/new-city-theme-woodvale/ @DrMisty posts some footage of YoYoYo in action http://www.mstargames.co.uk/mistryblogmain/54-yoyoyoblogs/184-video-update.html Xona Games - Decimation X3 on Reviews on the Run http://video.citytv.com/video/detail/782443063001.000000/reviews-on-the-run--february-8-2011/g4/ @benkane gives an early peek at his action RPG coming to XBLIG http://www.youtube.com/watch?v=bDF_PrvtwU8 Rock, Paper Shotgun talks to Zeboyd games about bringing Cthulhu Saves the World to PC http://www.rockpapershotgun.com/2011/02/11/summoning-cthulhu-natter-with-zeboyd/ Xbox LIVE Indieverse interviews the creator of Bonded Realities http://xbl-indieverse.blogspot.com/2011/02/xbl-indieverse-interview-red-crest.html XNA Game Development: Dream-In-Code posts about an upcoming XNA Challenge/Coding contest http://www.dreamincode.net/forums/blog/1385/entry-3192-xna-challengecontest/ Sgt.Conker covers Fishing Girl and IndieFreaks Game Framework release http://www.sgtconker.com/2011/02/fishing-girl-did-not-sell-a-single-copy/ http://www.sgtconker.com/2011/02/indiefreaks-game-framework-v0-2-0-0/ @slyprid releases Transmute v0.40a with lots of new features and fixes http://twitter.com/slyprid/statuses/34125423067533312 http://twitter.com/slyprid/statuses/35326876243337216 http://forgottenstarstudios.com/ Jeff Brown writes an XNA 4.0 tutorial on Saving/Loading on the Xbox 360 http://www.robotfootgames.com/xna-tutorials/92-xna-tutorial-savingloading-on-xbox-360-40 XNA for Silverlight Developers: Part 3- Animation http://www.silverlightshow.net/items/XNA-for-Silverlight-developers-Part-3-Animation-transforms.aspx?utm_source=feedburner&utm_medium=feed&utm_campaign=Feed%3A+xna-connection-twitter-specific-stream+%28XNA+Connection%27s+Twitter+specific+stream%29 The news from Nokia is definitely something XNA developers will want to keep their eye on http://blogs.forum.nokia.com/blog/nokia-developer-news/2011/02/11/letter-to-developers?sf1066337=1

    Read the article

  • How I do VCS

    - by Wes McClure
    After years of dabbling with different version control systems and techniques, I wanted to share some of what I like and dislike in a few blog posts.  To start this out, I want to talk about how I use VCS in a team environment.  These come in a series of tips or best practices that I try to follow.  Note: This list is subject to change in the future. Always use some form of version control for all aspects of software development. Development is an evolution.  Looking back at where we were is an invaluable asset in that process.  This includes data schemas and documentation. Reverting / reapplying changes is absolutely critical for efficient development. The tools I use: Code: Hg (preferred), SVN Database: TSqlMigrations Documents: Sometimes in code repository, also SharePoint with versioning Always tag a commit (changeset) with comments This is a quick way to describe to someone else (or your future self) what the changeset entails. Be brief but courteous. One or two sentences about the task, not the actual changes. Use precommit hooks or setup the central repository to reject changes without comments. Link changesets to documentation If your project management system integrates with version control, or has a way to externally reference stories, tasks etc then leave a reference in the commit.  This helps locate more information about the commit and/or related changesets. It’s best to have a precommit hook or system that requires this information, otherwise it’s easy to forget. Ability to work offline is required, including commits and history Yes this requires a DVCS locally but doesn’t require the central repository to be a DVCS.  I prefer to use either Git or Hg but if it isn’t possible to migrate the central repository, it’s still possible for a developer to push / pull changes to that repository from a local Hg or Git repository. Never lock resources (files) in a central repository… Rude! We have merge tools for a reason, merging sucked a long time ago, it doesn’t anymore… stop locking files! This is unproductive, rude and annoying to other team members. Always review everything in your commit. Never ever commit a set of files without reviewing the changes in each. Never add a file without asking yourself, deep down inside, does this belong? If you leave to make changes during a review, start the review over when you come back.  Never assume you didn’t touch a file, double check. This is another reason why you want to avoid large, infrequent commits. Requirements for tools Quickly show pending changes for the entire repository. Default action for a resource with pending changes is a diff. Pluggable diff & merge tool Produce a unified diff or a diff of all changes.  This is helpful to bulk review changes instead of opening each file. The central repository is not your own personal dump yard.  Breaking this rule is a sure fire way to get the F bomb dropped in front of your name, multiple times. If you turn on Visual Studio’s commit on closing studio option, I will personally break your fingers. By the way, the person(s) in charge of this feature should be fired and never be allowed near programming, ever again. Commit (integrate) to the central repository / branch frequently I try to do this before leaving each day, especially without a DVCS.  One never knows when they might need to work from remote the following day. Never commit commented out code If it isn’t needed anymore, delete it! If you aren’t sure if it might be useful in the future, delete it! This is why we have history. If you don’t know why it’s commented out, figure it out and then either uncomment it or delete it. Don’t commit build artifacts, user preferences and temporary files. Build artifacts do not belong in VCS, everything in them is present in the code. (ie: bin\*, obj\*, *.dll, *.exe) User preferences are your settings, stop overriding my preferences files! (ie: *.suo and *.user files) Most tools allow you to ignore certain files and Hg/Git allow you to version this as an ignore file.  Set this up as a first step when creating a new repository! Be polite when merging unresolved conflicts. Count to 10, cuss, grab a stress ball and realize it’s not a big deal.  Actually, it’s an opportunity to let you know that someone else is working in the same area and you might want to communicate with them. Following the other rules, especially committing frequently, will reduce the likelihood of this. Suck it up, we all have to deal with this unintended consequence at times.  Just be careful and GET FAMILIAR with your merge tool.  It’s really not as scary as you think.  I personally prefer KDiff3 as its merging capabilities rock. Don’t blindly merge and then blindly commit your changes, this is rude and unprofessional.  Make sure you understand why the conflict occurred and which parts of the code you want to keep.  Apply scrutiny when you commit a manual merge: review the diff! Make sure you test the changes (build and run automated tests) Become intimate with your version control system and the tools you use with it. Avoid trial and error as much as is possible, sit down and test the tool out, read some tutorials etc.  Create test repositories and walk through common scenarios. Find the most efficient way to do your work.  These tools will be used repetitively, so inefficiencies will add up. Sometimes this involves a mix of tools, both GUI and CLI. I like a combination of both Tortoise Hg and hg cli to get the job efficiently. Always tag releases Create a way to find a given release, whether this be in comments or an explicit tag / branch.  This should be readily discoverable. Create release branches to patch bugs and then merge the changes back to other development branch(es). If using feature branches, strive for periodic integrations. Feature branches often cause forked code that becomes irreconcilable.  Strive to re-integrate somewhat frequently with the branch this code will ultimately be merged into.  This will avoid merge conflicts in the future. Feature branches are best when they are mutually exclusive of active development in other branches. Use and abuse local commits , at least one per task in a story. This builds a trail of changes in your local repository that can be pushed to a central repository when the story is complete. Never commit a broken build or failing tests to the central repository. It’s ok for a local commit to break the build and/or tests.  In fact, I encourage this if it helps group the changes more logically.  This is one of the main reasons I got excited about DVCS, when I wanted more than one changeset for a set of pending changes but some files could be grouped into both changesets (like solution file / project file changes). If you have more than a dozen outstanding changed resources, there should probably be more than one commit involved. Exceptions when maintaining code bases that require shotgun surgery, in this case, it’s a design smell :) Don’t version sensitive information Especially usernames / passwords   There is one area I haven’t found a solution I like yet: versioning 3rd party libraries and/or code.  I really dislike keeping any assemblies in the repository, but seems to be a common practice for external libraries.  Please feel free to share your ideas about this below.    -Wes

    Read the article

  • The UIManager Pattern

    - by Duncan Mills
    One of the most common mistakes that I see when reviewing ADF application code, is the sin of storing UI component references, most commonly things like table or tree components in Session or PageFlow scope. The reasons why this is bad are simple; firstly, these UI object references are not serializable so would not survive a session migration between servers and secondly there is no guarantee that the framework will re-use the same component tree from request to request, although in practice it generally does do so. So there danger here is, that at best you end up with an NPE after you session has migrated, and at worse, you end up pinning old generations of the component tree happily eating up your precious memory. So that's clear, we should never. ever, be storing references to components anywhere other than request scope (or maybe backing bean scope). So double check the scope of those binding attributes that map component references into a managed bean in your applications.  Why is it Such a Common Mistake?  At this point I want to examine why there is this urge to hold onto these references anyway? After all, JSF will obligingly populate your backing beans with the fresh and correct reference when needed.   In most cases, it seems that the rational is down to a lack of distinction within the application between what is data and what is presentation. I think perhaps, a cause of this is the logical separation between business data behind the ADF data binding (#{bindings}) façade and the UI components themselves. Developers tend to think, OK this is my data layer behind the bindings object and everything else is just UI.  Of course that's not the case.  The UI layer itself will have state which is intrinsically linked to the UI presentation rather than the business model, but at the same time should not be tighly bound to a specific instance of any single UI component. So here's the problem.  I think developers try and use the UI components as state-holders for this kind of data, rather than using them to represent that state. An example of this might be something like the selection state of a tabset (panelTabbed), you might be interested in knowing what the currently disclosed tab is. The temptation that leads to the component reference sin is to go and ask the tabset what the selection is.  That of course is fine in context - e.g. a handler within the same request scoped bean that's got the binding to the tabset. However, it leads to problems when you subsequently want the same information outside of the immediate scope.  The simple solution seems to be to chuck that component reference into session scope and then you can simply re-check in the same way, leading of course to this mistake. Turn it on its Head  So the correct solution to this is to turn the problem on its head. If you are going to be interested in the value or state of some component outside of the immediate request context then it becomes persistent state (persistent in the sense that it extends beyond the lifespan of a single request). So you need to externalize that state outside of the component and have the component reference and manipulate that state as needed rather than owning it. This is what I call the UIManager pattern.  Defining the Pattern The  UIManager pattern really is very simple. The premise is that every application should define a session scoped managed bean, appropriately named UIManger, which is specifically responsible for holding this persistent UI component related state.  The actual makeup of the UIManger class varies depending on a needs of the application and the amount of state that needs to be stored. Generally I'll start off with a Map in which individual flags can be created as required, although you could opt for a more formal set of typed member variables with getters and setters, or indeed a mix. This UIManager class is defined as a session scoped managed bean (#{uiManager}) in the faces-config.xml.  The pattern is to then inject this instance of the class into any other managed bean (usually request scope) that needs it using a managed property.  So typically you'll have something like this:   <managed-bean>     <managed-bean-name>uiManager</managed-bean-name>     <managed-bean-class>oracle.demo.view.state.UIManager</managed-bean-class>     <managed-bean-scope>session</managed-bean-scope>   </managed-bean>  When is then injected into any backing bean that needs it:    <managed-bean>     <managed-bean-name>mainPageBB</managed-bean-name>     <managed-bean-class>oracle.demo.view.MainBacking</managed-bean-class>     <managed-bean-scope>request</managed-bean-scope>     <managed-property>       <property-name>uiManager</property-name>       <property-class>oracle.demo.view.state.UIManager</property-class>       <value>#{uiManager}</value>     </managed-property>   </managed-bean> In this case the backing bean in question needs a member variable to hold and reference the UIManager: private UIManager _uiManager;  Which should be exposed via a getter and setter pair with names that match the managed property name (e.g. setUiManager(UIManager _uiManager), getUiManager()).  This will then give your code within the backing bean full access to the UI state. UI components in the page can, of course, directly reference the uiManager bean in their properties, for example, going back to the tab-set example you might have something like this: <af:paneltabbed>   <af:showDetailItem text="First"                disclosed="#{uiManager.settings['MAIN_TABSET_STATE'].['FIRST']}"> ...   </af:showDetailItem>   <af:showDetailItem text="Second"                      disclosed="#{uiManager.settings['MAIN_TABSET_STATE'].['SECOND']}">     ...   </af:showDetailItem>   ... </af:panelTabbed> Where in this case the settings member within the UI Manger is a Map which contains a Map of Booleans for each tab under the MAIN_TABSET_STATE key. (Just an example you could choose to store just an identifier for the selected tab or whatever, how you choose to store the state within UI Manger is up to you.) Get into the Habit So we can see that the UIManager pattern is not great strain to implement for an application and can even be retrofitted to an existing application with ease. The point is, however, that you should always take this approach rather than committing the sin of persistent component references which will bite you in the future or shotgun scattered UI flags on the session which are hard to maintain.  If you take the approach of always accessing all UI state via the uiManager, or perhaps a pageScope focused variant of it, you'll find your applications much easier to understand and maintain. Do it today!

    Read the article

  • nested for-each loops in xml

    - by user1748443
    I'm new to XML. I'm trying to create table containing item details and another table to contain customer details for each order on a picklist. It seems like it should be straightforward but I just get a list of all items on all orders repeated by the number of orders. What am I doing wrong? (XSL code below...) <?xml version="1.0" encoding="utf-8"?> <xsl:stylesheet version="1.0" xmlns:xsl = "http://www.w3.org/1999/XSL/Transform"> <xsl:output method="html" doctype-system="about:legacy-compat"/> <xsl:template match="/"> <html xmlns = "http://www.w3.org/1999/xhtml"> <head> <meta charset="utf-8"/> <link rel="stylesheet" type="css/text" href="style.css"/> <title>Orders</title> </head> <body> <xsl:for-each select="//order"> <table> <caption><h3>Order Information</h3></caption> <thead> <th align="left">Item Id</th> <th align="left">Item Description</th> <th align="left">Quantity</th> <th align="left">Price</th> </thead> <xsl:for-each select="//item"> <tr> <td align="left"><xsl:value-of select="itemId"/></td> <td align="left"><xsl:value-of select="itemName"/></td> <td align="left"><xsl:value-of select="quantity"/></td> <td align="left"><xsl:value-of select="price"/></td> </tr> </xsl:for-each> </table> <table> <caption><h3>Customer Information</h3></caption> <thead> <th align="left">Customer Name</th> <th align="left">Street</th> <th align="left">City</th> </thead> <xsl:for-each select="//item"> <tr> <td align="left"><xsl:value-of select="customerName"/></td> <td align="left"><xsl:value-of select="street"/></td> <td align="left"><xsl:value-of select="city"/></td> </tr> </xsl:for-each> </table> </xsl:for-each> </body> </html> </xsl:template> </xsl:stylesheet> This is the XML: <?xml version="1.0" encoding="utf-8"?> <?xml-stylesheet type="text/xsl" href="Orders.xsl"?> <orders xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="Orders.xsd"> <order> <orderId>123</orderId> <items> <item> <itemId>001</itemId> <itemName>Nylon Rope</itemName> <quantity>1</quantity> <price>3.50</price> </item> <item> <itemId>002</itemId> <itemName>Shovel</itemName> <quantity>1</quantity> <price>24.95</price> </item> </items> <customerAddress> <customerName>Larry Murphy</customerName> <street>Shallowgrave Lane</street> <city>Ballymore Eustace, Co. Kildare</city> </customerAddress> </order> <order> <orderId>124</orderId> <items> <item> <itemId>001</itemId> <itemName>Whiskey</itemName> <quantity>1</quantity> <price>18.50</price> </item> <item> <itemId>002</itemId> <itemName>Shotgun</itemName> <quantity>1</quantity> <price>225</price> </item> <item> <itemId>003</itemId> <itemName>Cartridge</itemName> <quantity>1</quantity> <price>1.85</price> </item> </items> <customerAddress> <customerName>Enda Kenny</customerName> <street>A Avenue</street> <city>Castlebar, Co. Mayo</city> </customerAddress> </order> </orders>

    Read the article

1