Search Results

Search found 79 results on 4 pages for 'gn mithun'.

Page 1/4 | 1 2 3 4  | Next Page >

  • Setting up a software access point on Gigabyte GN-WPKG x64

    - by Reckage
    I'm using a Gigabyte GN-WPKG card on Windows 7 64-bit and was thinking it would be good to turn it into a wireless AP (I have a wired internet connection). Connectify, which would normally be the solution, says it's not compatible. There are instructions for setting up an AP, but they seem to be for 32-bit. I found the equivalent drivers for 7 and they don't seem to do anything. Is there no SoftAP for Vista and later on a Gigabyte card?

    Read the article

  • Finding all the shortest paths between two nodes in unweighted directed graphs using BFS algorithm

    - by andra-isan
    Hi All, I am working on a problem that I need to find all the shortest path between two nodes in a given directed unweighted graph. I have used BFS algorithm to do the job, but unfortunately I can only print one shortest path not all of them, for example if they are 4 paths having lenght 3, my algorithm only prints the first one but I would like it to print all the four shortest paths. I was wondering in the following code, how should I change it so that all the shortest paths between two nodes could be printed out? class graphNode{ public: int id; string name; bool status; double weight;}; map<int, map<int,graphNode>* > graph; int Graph::BFS(graphNode &v, graphNode &w){ queue <int> q; map <int, int> map1; // this is to check if the node has been visited or not. std::string str= ""; map<int,int> inQ; // just to check that we do not insert the same iterm twice in the queue map <int, map<int, graphNode>* >::iterator pos; pos = graph.find(v.id); if(pos == graph.end()) { cout << v.id << " does not exists in the graph " <<endl; return 1; } int parents[graph.size()+1]; // this vector keeps track of the parents for the node parents[v.id] = -1; // there is a direct path between these two words, simply print that path as the shortest path if (findDirectEdge(v.id,w.id) == 1 ){ cout << " Shortest Path: " << v.id << " -> " << w.id << endl; return 1; } //if else{ int gn; map <int, map<int, graphNode>* >::iterator pos; q.push(v.id); inQ.insert(make_pair(v.id, v.id)); while (!q.empty()){ gn = q.front(); q.pop(); map<int, int>::iterator it; cout << " Popping: " << gn <<endl; map1.insert(make_pair(gn,gn)); //backtracing to print all the nodes if gn is the same as our target node such as w.id if (gn == w.id){ int current = w.id; cout << current << " - > "; while (current!=v.id){ current = parents[current]; cout << current << " -> "; } cout <<endl; } if ((pos = graph.find(gn)) == graph.end()) { cout << " pos is empty " <<endl; continue; } map<int, graphNode>* pn = pos->second; map<int, graphNode>::iterator p = pn->begin(); while(p != pn->end()) { map<int, int>::iterator it; //map1 keeps track of the visited nodes it = map1.find(p->first); graphNode gn1= p->second; if (it== map1.end()) { map<int, int>::iterator it1; //if the node already exits in the inQ, we do not insert it twice it1 = inQ.find(p->first); if (it1== inQ.end()){ parents[p->first] = gn; cout << " inserting " << p->first << " into the queue " <<endl; q.push(p->first); // add it to the queue } //if } //if p++; } //while } //while } I do appreciate all your great help Thanks, Andra

    Read the article

  • 8-Puzzle Solution executes infinitely [migrated]

    - by Ashwin
    I am looking for a solution to 8-puzzle problem using the A* Algorithm. I found this project on the internet. Please see the files - proj1 and EightPuzzle. The proj1 contains the entry point for the program(the main() function) and EightPuzzle describes a particular state of the puzzle. Each state is an object of the 8-puzzle. I feel that there is nothing wrong in the logic. But it loops forever for these two inputs that I have tried : {8,2,7,5,1,6,3,0,4} and {3,1,6,8,4,5,7,2,0}. Both of them are valid input states. What is wrong with the code? Note For better viewing copy the code in a Notepad++ or some other text editor(which has the capability to recognize java source file) because there are lot of comments in the code. Since A* requires a heuristic, they have provided the option of using manhattan distance and a heuristic that calculates the number of misplaced tiles. And to ensure that the best heuristic is executed first, they have implemented a PriorityQueue. The compareTo() function is implemented in the EightPuzzle class. The input to the program can be changed by changing the value of p1d in the main() function of proj1 class. The reason I am telling that there exists solution for the two my above inputs is because the applet here solves them. Please ensure that you select 8-puzzle from teh options in the applet. EDITI gave this input {0,5,7,6,8,1,2,4,3}. It took about 10 seconds and gave a result with 26 moves. But the applet gave a result with 24 moves in 0.0001 seconds with A*. For quick reference I have pasted the the two classes without the comments : EightPuzzle import java.util.*; public class EightPuzzle implements Comparable <Object> { int[] puzzle = new int[9]; int h_n= 0; int hueristic_type = 0; int g_n = 0; int f_n = 0; EightPuzzle parent = null; public EightPuzzle(int[] p, int h_type, int cost) { this.puzzle = p; this.hueristic_type = h_type; this.h_n = (h_type == 1) ? h1(p) : h2(p); this.g_n = cost; this.f_n = h_n + g_n; } public int getF_n() { return f_n; } public void setParent(EightPuzzle input) { this.parent = input; } public EightPuzzle getParent() { return this.parent; } public int inversions() { /* * Definition: For any other configuration besides the goal, * whenever a tile with a greater number on it precedes a * tile with a smaller number, the two tiles are said to be inverted */ int inversion = 0; for(int i = 0; i < this.puzzle.length; i++ ) { for(int j = 0; j < i; j++) { if(this.puzzle[i] != 0 && this.puzzle[j] != 0) { if(this.puzzle[i] < this.puzzle[j]) inversion++; } } } return inversion; } public int h1(int[] list) // h1 = the number of misplaced tiles { int gn = 0; for(int i = 0; i < list.length; i++) { if(list[i] != i && list[i] != 0) gn++; } return gn; } public LinkedList<EightPuzzle> getChildren() { LinkedList<EightPuzzle> children = new LinkedList<EightPuzzle>(); int loc = 0; int temparray[] = new int[this.puzzle.length]; EightPuzzle rightP, upP, downP, leftP; while(this.puzzle[loc] != 0) { loc++; } if(loc % 3 == 0){ temparray = this.puzzle.clone(); temparray[loc] = temparray[loc + 1]; temparray[loc + 1] = 0; rightP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); rightP.setParent(this); children.add(rightP); }else if(loc % 3 == 1){ //add one child swaps with right temparray = this.puzzle.clone(); temparray[loc] = temparray[loc + 1]; temparray[loc + 1] = 0; rightP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); rightP.setParent(this); children.add(rightP); //add one child swaps with left temparray = this.puzzle.clone(); temparray[loc] = temparray[loc - 1]; temparray[loc - 1] = 0; leftP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); leftP.setParent(this); children.add(leftP); }else if(loc % 3 == 2){ // add one child swaps with left temparray = this.puzzle.clone(); temparray[loc] = temparray[loc - 1]; temparray[loc - 1] = 0; leftP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); leftP.setParent(this); children.add(leftP); } if(loc / 3 == 0){ //add one child swaps with lower temparray = this.puzzle.clone(); temparray[loc] = temparray[loc + 3]; temparray[loc + 3] = 0; downP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); downP.setParent(this); children.add(downP); }else if(loc / 3 == 1 ){ //add one child, swap with upper temparray = this.puzzle.clone(); temparray[loc] = temparray[loc - 3]; temparray[loc - 3] = 0; upP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); upP.setParent(this); children.add(upP); //add one child, swap with lower temparray = this.puzzle.clone(); temparray[loc] = temparray[loc + 3]; temparray[loc + 3] = 0; downP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); downP.setParent(this); children.add(downP); }else if (loc / 3 == 2 ){ //add one child, swap with upper temparray = this.puzzle.clone(); temparray[loc] = temparray[loc - 3]; temparray[loc - 3] = 0; upP = new EightPuzzle(temparray, this.hueristic_type, this.g_n + 1); upP.setParent(this); children.add(upP); } return children; } public int h2(int[] list) // h2 = the sum of the distances of the tiles from their goal positions // for each item find its goal position // calculate how many positions it needs to move to get into that position { int gn = 0; int row = 0; int col = 0; for(int i = 0; i < list.length; i++) { if(list[i] != 0) { row = list[i] / 3; col = list[i] % 3; row = Math.abs(row - (i / 3)); col = Math.abs(col - (i % 3)); gn += row; gn += col; } } return gn; } public String toString() { String x = ""; for(int i = 0; i < this.puzzle.length; i++){ x += puzzle[i] + " "; if((i + 1) % 3 == 0) x += "\n"; } return x; } public int compareTo(Object input) { if (this.f_n < ((EightPuzzle) input).getF_n()) return -1; else if (this.f_n > ((EightPuzzle) input).getF_n()) return 1; return 0; } public boolean equals(EightPuzzle test){ if(this.f_n != test.getF_n()) return false; for(int i = 0 ; i < this.puzzle.length; i++) { if(this.puzzle[i] != test.puzzle[i]) return false; } return true; } public boolean mapEquals(EightPuzzle test){ for(int i = 0 ; i < this.puzzle.length; i++) { if(this.puzzle[i] != test.puzzle[i]) return false; } return true; } } proj1 import java.util.*; public class proj1 { /** * @param args */ public static void main(String[] args) { int[] p1d = {1, 4, 2, 3, 0, 5, 6, 7, 8}; int hueristic = 2; EightPuzzle start = new EightPuzzle(p1d, hueristic, 0); int[] win = { 0, 1, 2, 3, 4, 5, 6, 7, 8}; EightPuzzle goal = new EightPuzzle(win, hueristic, 0); astar(start, goal); } public static void astar(EightPuzzle start, EightPuzzle goal) { if(start.inversions() % 2 == 1) { System.out.println("Unsolvable"); return; } // function A*(start,goal) // closedset := the empty set // The set of nodes already evaluated. LinkedList<EightPuzzle> closedset = new LinkedList<EightPuzzle>(); // openset := set containing the initial node // The set of tentative nodes to be evaluated. priority queue PriorityQueue<EightPuzzle> openset = new PriorityQueue<EightPuzzle>(); openset.add(start); while(openset.size() > 0){ // x := the node in openset having the lowest f_score[] value EightPuzzle x = openset.peek(); // if x = goal if(x.mapEquals(goal)) { // return reconstruct_path(came_from, came_from[goal]) Stack<EightPuzzle> toDisplay = reconstruct(x); System.out.println("Printing solution... "); System.out.println(start.toString()); print(toDisplay); return; } // remove x from openset // add x to closedset closedset.add(openset.poll()); LinkedList <EightPuzzle> neighbor = x.getChildren(); // foreach y in neighbor_nodes(x) while(neighbor.size() > 0) { EightPuzzle y = neighbor.removeFirst(); // if y in closedset if(closedset.contains(y)){ // continue continue; } // tentative_g_score := g_score[x] + dist_between(x,y) // // if y not in openset if(!closedset.contains(y)){ // add y to openset openset.add(y); // } // } // } } public static void print(Stack<EightPuzzle> x) { while(!x.isEmpty()) { EightPuzzle temp = x.pop(); System.out.println(temp.toString()); } } public static Stack<EightPuzzle> reconstruct(EightPuzzle winner) { Stack<EightPuzzle> correctOutput = new Stack<EightPuzzle>(); while(winner.getParent() != null) { correctOutput.add(winner); winner = winner.getParent(); } return correctOutput; } }

    Read the article

  • Finding a person in the forest

    - by PointsToShare
    © 2011 By: Dov Trietsch. All rights reserved finding a person in the forest or Limiting the AD result in SharePoint People Picker There are times when we need to limit the SharePoint audience of certain farms or servers or site collections to a particular audience. One of my experiences involved limiting access to US citizens, another to a particular location. Now, most of us – your humble servant included – are not Active Directory experts – but we must be able to handle the “audience restrictions” as required. So here is how it’s done in a nutshell. Important note. Not all could be done in PowerShell (at least not yet)! There are no Windows PowerShell commands to configure People Picker. The stsadm command is: stsadm -o setproperty -pn peoplepicker-searchadcustomquery -pv ADQuery –url http://somethingOrOther Note the long-hyphenated property name. Now to filling the ADQuery.   LDAP Query in a nutshell Syntax LDAP is no older than SQL and an LDAP query is actually a query against the LDAP Database. LDAP attributes are the equivalent of Database columns, so why do we have to learn a new query language? Beats me! But we must, so here it is. The syntax of an LDAP query string is made of individual statements with relational operators including: = Equal <= Lower than or equal >= Greater than or equal… and memberOf – a group membership. ! Not * Wildcard Equal and memberOf are the most commonly used. Checking for absence uses the ! – not and the * - wildcard Example: (SN=Grant) All whose last name – SurName – is Grant Example: (!(SN=Grant)) All except Grant Example: (!(SN=*)) all where there is no SurName i.e SurName is absent (probably Rappers). Example: (CN=MyGroup) Common Name is MyGroup.  Example: (GN=J*) all the Given Names that start with J (JJ, Jane, Jon, John, etc.) The cryptic SN, CN, GN, etc. are attributes and more about them later All the queries are enclosed in parentheses (Query). Complex queries are comprised of sets that are in AND or OR conditions. AND is denoted by the ampersand (&) and the OR is denoted by the vertical pipe (|). The general syntax is that of the Prefix polish notation where the operand precedes the variables. E.g +ab is the sum of a and b. In an LDAP query (&(A)(B)) will garner the objects for which both A and B are true. In an LDAP query (&(A)(B)(C)) will garner the objects for which A, B and C are true. There’s no limit to the number of conditions. In an LDAP query (|(A)(B)) will garner the objects for which either A or B are true. In an LDAP query (|(A)(B)(C)) will garner the objects for which at least one of A, B and C is true. There’s no limit to the number of conditions. More complex queries have both types of conditions and the parentheses determine the order of operations. Attributes Now let’s get into the SN, CN, GN, and other attributes of the query SN – is the SurName (last name) GN – is the Given Name (first name) CN – is the Common Name, usually GN followed by SN OU – is an Organization Unit such as division, department etc. DC – is a Domain Content in the AD forest l – lower case ‘L’ stands for location. Jerusalem anybody? Or Katmandu. UPN – User Principal Name, is usually the first part of an email address. By nature it is unique in the forest. Most systems set the UPN to be the first initial followed by the SN of the person involved. Some limit the total to 8 characters. If we have many ‘jsmith’ we have to somehow distinguish them from each other. DN – is the distinguished name – a name unique to AD forest in which it lives. Usually it’s a CN with some domain or group distinguishers. DN is important in conjunction with the memberOf relation. Groups have stricter requirement. Each group has to have a unique name - its CN and it has to be unique regardless of its place. See more below. All of the attributes are case insensitive. CN, cn, Cn, and cN are identical. objectCategory is an element that requires special consideration. AD contains many different object like computers, printers, and of course people and groups. In the queries below, we’re limiting our search to people (person). Putting it altogether Let’s get a list of all the Johns in the SPAdmin group of the Jerusalem that local domain. (&(objectCategory=person)(memberOf=cn=SPAdmin,ou=Jerusalem,dc=local)) The memberOf=cn=SPAdmin uses the cn (Common Name) of the SPAdmin group. This is how the memberOf relation is used. ‘SPAdmin’ is actually the DN of the group. Also the memberOf relation does not allow wild cards (*) in the group name. Also, you are limited to at most one ‘OU’ entry. Let’s add Marvin Minsky to the search above. |(&(objectCategory=person)(memberOf=cn=SPAdmin,ou=Jerusalem,dc=local))(CN=Marvin Minsky) Here I added the or pipeline at the beginning of the query and put the CN requirement for Minsky at the end. Note that if Marvin was already in the prior result, he’s not going to be listed twice. One last note: You may see a dryer but more complete list of attributes rules and examples in: http://www.tek-tips.com/faqs.cfm?fid=5667 And finally (thus negating the claim that my previous note was last), to the best of my knowledge there are 3 more ways to limit the audience. One is to use the peoplepicker-searchadcustomfilter property using the same ADQuery. This works only in SP1 and above. The second is to limit the search to users within this particular site collection – the property name is peoplepicker-onlysearchwithinsitecollection and the value is yes (-pv yes) And the third is –pn peoplepicker-serviceaccountdirectorypaths –pv “OU=ou1,DC=dc1…..” Again you are limited to at most one ‘OU’ phrase – no OU=ou1,OU=ou2… And now the real end. The main property discussed in this sprawling and seemingly endless monogram – peoplepicker-searchadcustomquery - is the most general way of getting the job done. Here are a few examples of command lines that worked and some that didn’t. Can you see why? C:\Program Files\Common Files\Microsoft Shared\Web Server Extensions\12\BIN>stsa dm -o setproperty -url http://somethingOrOther -pn peoplepicker-searchadcustomfi lter -pv (Title=David) Operation completed successfully. C:\Program Files\Common Files\Microsoft Shared\Web Server Extensions\12\BIN>stsa dm -o setproperty -url http://somethingOrOther -pn peoplepicker-searchadcustomfi lter -pv (!Title=David) Operation completed successfully. C:\Program Files\Common Files\Microsoft Shared\Web Server Extensions\12\BIN>stsa dm -o setproperty -url http://somethingOrOther -pn peoplepicker-searchadcustomfi lter -pv (OU=OURealName,OU=OUMid,OU=OUTop,DC=TopDC,DC=MidDC,DC=BottomDC) Command line error. Too many OUs C:\Program Files\Common Files\Microsoft Shared\Web Server Extensions\12\BIN>stsa dm -o setproperty -url http://somethingOrOther -pn peoplepicker-searchadcustomfi lter -pv (OU=OURealName) Operation completed successfully. C:\Program Files\Common Files\Microsoft Shared\Web Server Extensions\12\BIN>stsa dm -o setproperty -url http://somethingOrOther -pn peoplepicker-searchadcustomfi lter -pv (DC=TopDC,DC=MidDC,DC=BottomDC) Operation completed successfully. C:\Program Files\Common Files\Microsoft Shared\Web Server Extensions\12\BIN>stsa dm -o setproperty -url http://somethingOrOther -pn peoplepicker-searchadcustomfi lter -pv (OU=OURealName,DC=TopDC,DC=MidDC,DC=BottomDC) Operation completed successfully.   That’s all folks!

    Read the article

  • How to minimize a window using mouse in PCManFM?

    - by Mithun P
    How can I minimize a window using mouse in PCManFM? I'm using Elementary Desktop Environment in Ubuntu 12.04 Update I tried to bring the minimize button back by opening gconf-editor and change the value of /apps/metacity/general/button_layout from close:maximize to close,minimize:maximize. Then I logged out and back in, but that change was simply ignored. Update Again Screenshot And the System settings

    Read the article

  • Are the famous websites handmade? [closed]

    - by Mithun Chuckraverthy
    I'm a newbie in web designing. I always wanted to build a professional quality website by myself. So, I started learning HTML/XHTML and CSS for presentation; and, JavaScript and PHP/MySQL for scripting. I wonder, would the developers of famous websites design them by hand? Or, have they found out any better idea of using softwares? If so, can you tell me what are they? (By the word famous, I mean any websites that are liked by millions of people all over the world. Like: Google, Facebook etc.) Thanks in advance!

    Read the article

  • Force logout a user

    - by Mithun
    I When I logged into the machine as root and typed who to see which users are logged in, I found somebody else too logged in as root devuser pts/0 2011-11-18 09:55 (xxx.xxx.xxx.xxx) root pts/1 2011-11-18 09:56 (xxx.xxx.xxx.xxx) testuser pts/2 2011-11-18 14:54 (xxx.xxx.xxx.xxx) root pts/3 2011-11-18 14:55 (xxx.xxx.xxx.xxx) How can I force a root user at pts/3 to logout?

    Read the article

  • Video Recording on iPhone

    - by gn-mithun
    I have this iPhone app, which plays streaming video from a source(Just video, no audio). Is there any mechanism by which i can capture this streaming video or record them, for later playback?

    Read the article

  • Not able to Defrag my drive for shrink even using PerfectDisk on Windows 7

    - by Mithun Sasidharan
    I want to partition my c drive which has over 450gb capacity of which hardly 30gb is being used. I deleted the pagefile.sys and also disabled hibernate and cache memory. I then defragmented and consolidated free space using PerfectDisk 12 and also run a boot time defragmented. Now what remains is Metadata files that preventing me from shrinking the volume beyond half the size if disk. Please tell me what to do?????

    Read the article

  • FFmpeg on iPhone

    - by gn-mithun
    Hello, I have downloaded ffmpeg libraries for iPhone and compiled them. My objective is to create a movie file from a series of images using ffmpeg libraries.The amount of documentation for ffmpeg on iphone is very less. I checked an app called iFrameExtractor, which does the opposite of what i want, it extracts frames from a video. On the command line there is a command called ffmpeg -f image2 -i image%d.jpg video.mov This turns a series of images into a video. I actually checked it on my mac and it works fine. What i wanted to know was how do we get the equivalent in iPhone. Or rather which class/api or method to call. There are a couple of examples of apps doing this on iPhone. Not sure whether they do it through ffmpeg though. Anyways, for reference "Time lapser" and "reel moments" Thanks in advance

    Read the article

  • OpenCV and iPhone

    - by gn-mithun
    Hello, I am writing an application to create a movie file from a bunch of images on an iPhone. I am using OpenCv. I downloaded openCv static libraries for arm(iPhones native instruction architecture) and the libraries were generated just fine. There were no problems linking to them libraries. As a first step, i was trying to create a .avi file using one image, to see if it works. But cvCreateVideoWriter always returns me a NULL value. I did some searchin and i believe its due to the codec not being present. I am trying this on the iPhone simulator. this is what i do... (void)viewDidLoad { [super viewDidLoad]; UIImage *anImage = [UIImage imageNamed:@"1.jpg"]; IplImage *img_color = [self CreateIplImageFromUIImage:anImage]; //The image gets created just fine CvVideoWriter *writer = cvCreateVideoWriter("out.avi",CV_FOURCC('P','I','M','1'), 25,cvSize(320,480),1); //writer is always null int result = cvWriteFrame(writer, img_color); NSLog(@"\n%d",result); //hence this is also 0 all the time cvReleaseVideoWriter(&writer); } I am not sure about the the second parameter. What sort of codec or what exactly it does... I am a n00B in this. Any suggestions?

    Read the article

  • iPhone and OpenCV

    - by gn-mithun
    Hello, I am writing an application to create a movie file from a bunch of images on an iPhone. I am using OpenCv. I downloaded openCv static libraries for arm(iPhones native instruction architecture) and the libraries were generated just fine. There were no problems linking to them libraries. As a first step, i was trying to create a .avi file using one image, to see if it works. But cvCreateVideoWriter always returns me a NULL value. I did some searchin and i believe its due to the codec not being present. I am trying this on the iPhone simulator. this is what i do... (void)viewDidLoad { [super viewDidLoad]; UIImage *anImage = [UIImage imageNamed:@"1.jpg"]; IplImage *img_color = [self CreateIplImageFromUIImage:anImage]; //The image gets created just fine CvVideoWriter *writer = cvCreateVideoWriter("out.avi",CV_FOURCC('P','I','M','1'), 25,cvSize(320,480),1); //writer is always null int result = cvWriteFrame(writer, img_color); NSLog(@"\n%d",result); //hence this is also 0 all the time cvReleaseVideoWriter(&writer); } I am not sure about the the second parameter. What sort of codec or what exactly it does... I am a n00B in this. Any suggestions?

    Read the article

  • Ad hoc network between iPhone and non iPhone devices???

    - by gn-mithun
    Is it possible to set up a ad hoc network between an iPhone and a totally different device like camera,scanner or printer and build a data tunnel between them to exchange data or services. I believe iPhone does not have the provision of creating an ad hoc network. So i am assuming that the other device are the initiator of the ad hoc network. I tried doing the same with a mac book and iPhone and i could surf on the phone after enabling internet sharing. But i wanted to make sure that its possible with other devices as well I believe the upcoming WiFi Direct is a way to do it.

    Read the article

  • Current network being accessed

    - by gn-mithun
    Is there way i can get the current network being used by iPhone programmatically in an iPhone app. To SImplify, suppose there are 3 networks visible in the wifi vicinity of the phone and i can see them in the settings page. I select one and is it possible for any app to find that out?

    Read the article

  • How to repaint a form so that it does not disappear on minimizing?

    - by gn
    I have a form in which i paint a waveform on a button click that is as soon as i click button, the waveform displays. Now when i minimize the form and maximize it again, the waveform disappears.How to repaint it? I have seen people using paint event but i dont know how to use it after/inside the button click event. Please help.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • subscribing an event to a class object before initializing it.

    - by GN
    I have two classes class A and B.I have a delegate n event published in class B.The class B object is declared in class A.All he functionality dependes on the parameterised constru ctor of class B. Before initializing the object of class B i need to subscibe the event for it.how to do it? e.g public class B { public delegate void myDel(string); public event myDel myEvent; B(object obj) { ----------------- ------------------ } } class A { A objA; class XYZ objXYZ; void func() { objA.myEvent+=new myDel(); objA=new A(objXYZ); // hw to attain this? } }

    Read the article

  • jQuery UI Dialog Error: b("<div></div>").addClass("ui-widget-overlay") is undefined

    - by Mithun
    I have the below code for my a Dialog box for a which contains a dropdown field KPMS.ServiceRequests.Status = { showOptions : function(requestId, userId, requestType) { var url = BASE_URL+'service_requests/status_options/'; $("#dialog-modal").dialog("destroy"); $("#dialog-modal").load(url, {"request_id": requestId, "user_id": userId, "request_type":requestType}).dialog( { modal: true, title: "Update Status", buttons: { Cancel : function() { $(this).dialog('close'); }, Update: function() { alert(1); } } } ); } } There is an anchor tag to populate the Dialog <a onclick="KPMS.ServiceRequests.Status.showOptions(9, 11, 'SR'); return false;" title="Update status" href="http://localhost/kitco/pms/#9"><img alt="[E]" title="Update" src="http://localhost/kitco/pms/images/edit.png"></a> My problem is When i click the link for the first time the dialog box is populating properly. Then I closed the dialog using the cancel button, then again clicked the link to open the dialog and closed it. For the third click on the link I'm getting the below Javascript error, and Dialog box is not opened Error: b("<div></div>").addClass("ui-widget-overlay") is undefined Source File: http://localhost/kitco/pms/js/jquery-ui-1.8rc3.custom.min.js Line: 199 How to solve this problem?

    Read the article

  • jQuery Youtube URL Validation with regex

    - by Mithun
    I know there is plenty of question answered over here http://stackoverflow.com/questions/tagged/youtube+regex, but not able find a question similar to me. Any body has the JavaScript Regular expression for validating the YouTube VIDEO URL's line below listed. Just want to know where such a URL can be possible http://www.youtube.com/watch?v=bQVoAWSP7k4 http://www.youtube.com/watch?v=bQVoAWSP7k4&feature=popular http://www.youtube.com/watch?v=McNqjYiFmyQ&feature=related&bhablah http://youtube.com/watch?v=bQVoAWSP7k4

    Read the article

  • jQuery UI dialog and Ajax POST, JSON

    - by Mithun
    Is it possible to combine Ajax post with jQuery UI dialog? And I want to process the ajax reponse in JSON to HTML for showing inside the Dialog box var url = AJAX_URL+requestId+'/'+userId; // Need to POST the requestId and userId instead of GET $("body").append("<div id='dialog-modal'>Loading...</div>"); $("#dialog-modal").dialog("destroy"); $("#dialog-modal").load(url).dialog( { modal: true, title: "Update Status", buttons: { Cancel : function() { $(this).dialog('close'); }, Update: function() { // Do something } } } );

    Read the article

1 2 3 4  | Next Page >