Search Results

Search found 3856 results on 155 pages for 'io'.

Page 101/155 | < Previous Page | 97 98 99 100 101 102 103 104 105 106 107 108  | Next Page >

  • How to acces File over the Network

    - by Polo
    Hi! I am having a hard time on this one, I have à folder over the network wit public accès (no credential restriction). I am trying to do à File.Exist or Directory.Exist and I keep on having a exception. Can somewone tell me the good way to do IO over the network. EDIT 1 FOR DETAILS: if i do execture = \agoodip\Public\test.txt I get the file etc etc In my code it look like a basic Directory.Exist(@"\agoodip\Public") or File.exist(@"\agoodip\Public\test.txt") The exception I get is Path not found. Thanks!

    Read the article

  • java checked exception in a catch clause compilation error

    - by srandpersonia
    Hi, I was expecting an compilation error in the following program because of the throw statement in the catch block as IOException is a checked exception and it is not caught by another try block within the catch block. But I am getting "Hurray!" printed. Any explanation would be much appreciated. According to JLS 11.2.3, http://java.sun.com/docs/books/jls/third_edition/html/exceptions.html It is a compile-time error if a method or constructor body can throw some exception type E when both of the following hold: * E is a checked exception type * E is not a subtype of some type declared in the throws clause of the method or constructor. import java.io.*; public class Test{ public static void main(String args[]) { System.out.println(method()); } public static int method() { try{ throw new Exception(); } catch(Exception e){ throw new IOException(); //No compile time error } finally{ System.out.println("Hurray!"); } } } Thanks in advance.

    Read the article

  • Why is there a seemingly identical copy of the JDK 1.5 core runtime in org.osgi.foundation-1.0.0.jar?

    - by Jonathan Neufeld
    I am maintaining a web application that depends on OSGi and Maven pulls-in a jar called org.osgi-foundation-1.0.0.jar that seems to contain the same classes as part of the JDK core runtime such as: java.util.*; java.io.*; etc. and so on. This seems very strange and I have to ask why this is necessary. More-over, my web-application fails to deploy on JBoss 6 because these are "illegal package names" for a third-party library. What is the purpose of org.osgi-foundation-1.0.0.jar ? is it necessary?

    Read the article

  • Java object caching, which is faster, reading from a file or from a remote machine?

    - by Kumar225
    I am at a point where I need to take the decision on what to do when caching of objects reaches the configured threshold. Should I store the objects in a indexed file (like provided by JCS) and read them from the file (file IO) when required or have the object stored in a distributed cache (network, serialization, deserialization) We are using Solaris as OS. ============================ Adding some more information. I have this question so as to determine if I can switch to distributed caching. The remote server which will have cache will have more memory and better disk and this remote server will only be used for caching. One of the problems we cannot increase the locally cached objects is , it stores the cached objects in JVM heap which has limited memory(using 32bit JVM). ======================================================================== Thanks, we finally ended up choosing Coherence as our Cache product. This provides many cache configuration topologies, in process vs remote vs disk ..etc.

    Read the article

  • WiX: Extracting Binary-string in Custom Action yields string like "???good data"

    - by leiflundgren
    I just found a weird behaviour when attempting to extract a string from the Binary-table in the MSI. I have a file containing "Hello world", the data I get is "???Hello world". (Literary question mark.) Is this as intended? Will it always be exactly 3 characters in the beginning? Regards Leif Sample code: [CustomAction] public static ActionResult CustomAction2(Session session) { View v = session.Database.OpenView("SELECT `Name`,`Data` FROM `Binary`"); v.Execute(); Record r = v.Fetch(); int datalen = r.GetDataSize("Data"); System.IO.Stream strm = r.GetStream("Data"); byte[] rawData = new byte[datalen]; int res = strm.Read(rawData, 0, datalen); strm.Close(); String s = System.Text.Encoding.ASCII.GetString(rawData); // s == "???Hello World" return ActionResult.Success; }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • how do I get the IP of incoming ICMP due to UDP-send to dead client in Ruby?

    - by banister
    so.. I'm doing a small multiplayer game with blocking UDP and IO.select. To my problem.. (In the server) reading from a UDP socket (packet, sender = @socket.recvfrom(1000)) which have just sent a packet to a dead client results in a ICMP unreachable (and exception Errno::ECONNRESET in ruby). The problem is that I can't find any way whatsoever to extract the IP of that ICMP.. so I can clean out that dead client. Anyone know how to achieve this? thanks

    Read the article

  • Why doesn't this code using the ruby-mbox gem parse mbox files?

    - by cartoonfox
    I installed ruby-mbox by doing gem install ruby-mbox Running this: #!/usr/bin/ruby require 'rubygems' require 'mbox' m = IO.read('test.eml') puts m.size m = Mbox.new(m) puts m produces this: 71309505 /Library/Ruby/Gems/1.8/gems/ruby-mbox-0.0.2/lib/mbox/mbox.rb:45:in `initialize': uninitialized constant Mbox::StringIO (NameError) from r.rb:7:in `new' from r.rb:7 I have proved that "m" is assigned a string containing the contents of the file, just before Mbox.new(m) is called. It looks as though the Mbox::StringIO should have been defined by hasn't been. What's going wrong here? Ruby version: ruby 1.8.7 (2009-06-12 patchlevel 174) [universal-darwin10.0] (That's the default ruby installed on OS X 10.6.6)

    Read the article

  • Better data stream reading in Haskell

    - by Tim Perry
    I am trying to parse an input stream where the first line tells me how many lines of data there are. I'm ending up with the following code, and it works, but I think there is a better way. Is there? main = do numCases <- getLine proc $ read numCases proc :: Integer -> IO () proc numCases | numCases == 0 = return () | otherwise = do str <- getLine putStrLn $ findNextPalin str proc (numCases - 1) Note: The code solves the Sphere problem https://www.spoj.pl/problems/PALIN/ but I didn't think posting the rest of the code would impact the discussion of what to do here.

    Read the article

  • How can I get to the value of my WPF UserControl DependencyProperty from UI Automation Framework?

    - by Surfbutler
    Hi, I'm having trouble getting access to my WPF UserControl DependencyProperty values through the UI Automation Framework. I've used James McCaffreys article in MSDN as a starting point (Automating IO Tests in WPF Applications, MSDN March 2009), but I can only see properties etc in standard controls such as buttons. I'm assuming there's some Automation interface I have to implement on my UserControl, but what and how? I can already see my control fine e.g. in UISpy, but I can't see the dependency properties within it. Here's what my usercontrol looks like currently in UISpy: AutomationElement General Accessibility AccessKey: "" AcceleratorKey: "" IsKeyboardFocusable: "False" LabeledBy: "(null)" HelpText: "Switches 48v Phantom Power On/Off (for Mic inputs only)." State IsEnabled: "True" HasKeyboardFocus: "False" Identification ClassName: "" ControlType: "ControlType.Custom" Culture: "(null)" AutomationId: "V48SwL" LocalizedControlType: "custom" Name: "" ProcessId: "5684 (VirtualSix)" RuntimeId: "7 5684 40026340" IsPassword: "False" IsControlElement: "True" IsContentElement: "True" Visibility BoundingRectangle: "(140, 457, 31, 20)" ClickablePoint: "155,467" IsOffscreen: "False" ControlPatterns

    Read the article

  • Writing my own iostream utility class: Is this a good idea?

    - by Alex
    I have an application that wants to read word by word, delimited by whitespace, from a file. I am using code along these lines: std::istream in; string word; while (in.good()) { in>>word; // Processing, etc. ... } My issue is that the processing on the words themselves is actually rather light. The major time consumer is a set of mySQL queries I run. What I was thinking is writing a buffered class that reads something like a kilobyte from the file, initializes a stringstream as a buffer, and performs extraction from that transparently to avoid a great many IO operations. Thoughts and advice?

    Read the article

  • Need help with displaying the message correctly in the pole display

    - by SA
    Hi, I am using an HP RS232 pole display with the following setting: Char type: USA/Europe (default) Command mode: EPSON (default) Baud rate: 9600, n , 8, 1 (default?) Passthru None (Default) Here's the code using System.IO.Ports; private SerialPort port; port = new SerialPort("COM2", 9600, Parity.None, 8, StopBits.One); port.Handshake = Handshake.None; Port.WriteLine("Welocome to something something"); It has 2 lines consisting of 20 characters each with a total of 40 characters. I have no control how and where the characters get displayed. I have set it to accept ASCII char set and so I am able to type as is visble in the Writeline message

    Read the article

  • [grails] attaching multiple files to a domain class

    - by Emyr
    I've seen various Grails plugins which allow easier handling of file uploads, however these tend only to support a single file per form-submit. I'd like a multi-attach form where as soon as you pick one file, an extra field and button is added using JS (various sites do it like this). Do you know of any good plugins which provide elegant uploading of multiple files without excessive coding? A progress bar either per-file of for the whole process would also be very nice. I don't know to what extent I can allow GORM to handle a java.io.File field (or in this case a Collection<File>).

    Read the article

  • Type patterns and generic classes in Haskell

    - by finnsson
    I'm trying to understand type patterns and generic classes in Haskell but can't seem to get it. Could someone explain it in laymen's terms? In [1] I've read that "To apply functions generically to all data types, we view data types in a uniform manner: except for basic predefined types such as Float, IO, and ?, every Haskell data type can be viewed as a labeled sum of possibly labeled products." and then Unit, :*: and :+: are mentioned. Are all data types in Haskell automatically versions of the above mentioned and if so how do I figure out how a specific data type is represented in terms of :*:, etc? The users guide for generic classes (ch. 7.16) at haskell.org doesn't mention the predefined types but shouldn't they be handled in every function if the type patterns should be exhaustive? [1] Comparing Approaches to Generic Programming in Haskell, Ralf Hinze, Johan Jeuring, and Andres Löh

    Read the article

  • TCPClient in C# (Error).

    - by CSharp
    using System; using System.Text; using System.IO; using System.Net.Sockets; namespace ConsoleApp01 { class Program { public static void Main(string[] args) { TcpClient client = new TcpClient("python.org",80); NetworkStream ns = client.GetStream(); StreamWriter sw = new StreamWriter(ns); sw.Write("HEAD / HTTP/1.1\r\n" + "User-Agent: Test\r\n" + "Host: www.python.org\r\n" + "Connection: Close\r\n"); sw.Flush(); Console.ReadKey(true); } } } System.Net.Sockets.SocketException: Unable to make a connection because the target machine actively refused it at System.Net.Sockets.TcpClient..ctor at ConsoleApp01.Program.Main :line 12 Why do i get this error message?

    Read the article

  • The system cannot find the file specified.

    - by Sathish
    Till yesterday my webservice was running fine in my local system today when i run the Webservcie or any webproject from VS2005 i get the below error Server Error in '/MyWebService' Application. The system cannot find the file specified. (Exception from HRESULT: 0x80070002) Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.IO.FileNotFoundException: The system cannot find the file specified. (Exception from HRESULT: 0x80070002) Please help me

    Read the article

  • How to capture a screen shot in .NET from a webapplication?

    - by CodeToGlory
    In Java we can do it as follows: import java.awt.Dimension; import java.awt.Rectangle; import java.awt.Robot; import java.awt.Toolkit; import java.awt.image.BufferedImage; import javax.imageio.ImageIO; import java.io.File; ... public void captureScreen(String fileName) throws Exception { Dimension screenSize = Toolkit.getDefaultToolkit().getScreenSize(); Rectangle screenRectangle = new Rectangle(screenSize); Robot robot = new Robot(); BufferedImage image = robot.createScreenCapture(screenRectangle); ImageIO.write(image, "png", new File(fileName)); } ... How do we do this in .NET from a webapplication? Capturing the client's screen and sending it to the server all from within the application.

    Read the article

  • Best approach to create a security environment in Java

    - by Tom Brito
    I need to create a desktop application that will run third party code, and I need to avoid the third party code from export by any way (web, clipboard, file io) informations from the application. Somethig like: public class MyClass { private String protectedData; public void doThirdPartyTask() { String unprotedtedData = unprotect(protectedData); ThirdPartyClass.doTask(unprotectedData); } private String unprotect(String data) { // ... } } class ThirdPartyClass { public static void doTask(String unprotectedData) { // Do task using unprotected data. // Malicious code may try to externalize the data. } } I'm reading about SecurityManager and AccessControler, but I'm still not sure what's the best approach to handle this. What should I read about to do this implementation?

    Read the article

  • XML over HTTP with JMS and Spring

    - by Will Sumekar
    I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

    Read the article

  • How to document thrown exceptions in c#/.net

    - by Arnold Zokas
    I am currently writing a small framework that will be used internally by other developers within the company. I want to provide good Intellisense information, but I am not sure how to document thrown exceptions. In the following example: public void MyMethod1() { MyMethod2(); // also may throw InvalidOperationException } public void MyMethod2() { System.IO.File.Open(somepath...); // this may throw FileNotFoundException // also may throw DivideByZeroException } I know the markup for documenting exceptions is: /// <exception cref="SomeException">when things go wrong.</exception> What I don't understand is how to document exceptions thrown by code called by MyMethod1()? Should I document exceptions thrown by MyMethod2() Should I document exceptions thrown by File.Open() ? What would be the best way to document possible exceptions?

    Read the article

  • Websphere CE issue in Eclipse EE

    - by Moev4
    I have downloaded the Websphere 2.1 App Server and verified that it works fine. I now wanted to use eclipse EE to manage it by adding the server to the server tab. Everything seems to work fine when going through the setup but when I go to start the server I get the error message: ERROR [GBeanInstanceState] Error while starting; GBean is now in the FAILED state: abstractName="org.apache.geronimo.framework/j2ee-system/2.1.4/car?ServiceModule=org.apache.geronimo.framework/j2ee-system/2.1.4/car,j2eeType=AttributeStore,name=AttributeManager" java.io.IOException: Unable to write manageable attribute files to directory /opt/IBM/WebSphere/AppServerCommunityEdition/var/config at org.apache.geronimo.system.configuration.LocalAttributeManager.ensureParentDirectory(LocalAttributeManager.java:573) at org.apache.geronimo.system.configuration.LocalAttributeManager.load(LocalAttributeManager.java:327) .... I was wondering if anyone had experience with this particular issue?

    Read the article

  • When opening a file in perl, how can I automatically use STDIN/OUT if the file name is "-"?

    - by Ryan Thompson
    I have a perl program that takes input and output file arguments, and I'd like to support the convention of using "-" to specify standard input/output. The problem is that I can't just open the file name, because open(my $input, '<', '-') opens a file called -, not standard input. So I have to do something like this: my $input_fh; if ($input_filename eq '-') { # Special case: get the stdin handle $input_fh = *STDIN{IO}; } else { # Standard case: open the file open($input_fh, '<', $input_filename); } And similarly for the output file. Is there any way to do this without testing for the special case myself? I know I could hack the ARGV filehandle to do this for input, but that won't work for output.

    Read the article

  • C++ Mock/Test boost::asio::io_stream - based Asynch Handler

    - by rbellamy
    I've recently returned to C/C++ after years of C#. During those years I've found the value of Mocking and Unit testing. Finding resources for Mocks and Units tests in C# is trivial. WRT Mocking, not so much with C++. I would like some guidance on what others do to mock and test Asynch io_service handlers with boost. For instance, in C# I would use a MemoryStream to mock an IO.Stream, and am assuming this is the path I should take here. C++ Mock/Test best practices boost::asio::io_service Mock/Test best practices C++ Async Handler Mock/Test best practices I've started the process with googlemock and googletest.

    Read the article

  • How to access File over the Network

    - by Polo
    Hi! I am having a hard time on this one, I have a folder over the network with public access (no credential restriction). I am trying to do a File.Exist or Directory.Exist and I keep on having a exception. Can someone tell me the good way to do IO over the network. EDIT 1 FOR DETAILS: if i do execture = \agoodip\Public\test.txt I get the file etc etc In my code it look like a basic Directory.Exist(@"\\agoodip\Public") or File.exist(@"\\agoodip\Public\test.txt") The exception I get is Path not found. EDIT 2 : I am using Silverlight 3, Is there any security pattern to be aware of to lookup file on the network? Thanks!

    Read the article

  • What should I do if a IOException is thrown?

    - by Roman
    I have the following 3 lines of the code: ServerSocket listeningSocket = new ServerSocket(earPort); Socket serverSideSocket = listeningSocket.accept(); BufferedReader in = new BufferedReader(new InputStreamReader(serverSideSocket.getInputStream())); The compiler complains about all of these 3 lines and its complain is the same for all 3 lines: unreported exception java.io.IOException; In more details, these exception are thrown by new ServerSocket, accept() and getInputStream(). I know I need to use try ... catch .... But for that I need to know what this exceptions mean in every particular case (how should I interpret them). When they happen? I mean, not in general, but in these 3 particular cases.

    Read the article

< Previous Page | 97 98 99 100 101 102 103 104 105 106 107 108  | Next Page >