Search Results

Search found 10194 results on 408 pages for 'raw types'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 101/408 | < Previous Page | 97 98 99 100 101 102 103 104 105 106 107 108  | Next Page >

  • strange Problem with WPF Textbox stringformat - Cursor moves back

    - by Emad
    I am using WPF 4.0 TextBox and binding. I am using StringFormat to format the number as currency. the XAML looks like this: <TextBox Text="{Binding Path=ValueProperty, ValidatesOnDataErrors=True, ValidatesOnExceptions=True, StringFormat={}{0:C}, UpdateSourceTrigger=PropertyChanged}"> </TextBox> Everything seems to work correctly except for a strange behavior: When for example a user types in 12: right after typing 1, the value in the textbox becomes $1.00 and the weird thing is the the cursor is moved to be between the $ and the 1. So when a user simply types in 12, the result becomes $21.00. How can I fix this strange behavior?

    Read the article

  • Shouldn't ObjectInputStream extend FilterInputStream?

    - by Vaibhav Bajpai
    The block quotes are from the Java Docs - A FilterInputStream contains some other input stream, which it uses as its basic source of data, possibly transforming the data along the way or providing additional functionality. A DataInputStream lets an application read primitive Java data types from an underlying input stream in a machine-independent way. The DataInputStream therefore extends FilterInputStream An ObjectInputStream deserializes primitive data and objects previously written using an ObjectOutputStream. However, for some reason the ObjectInputStream does NOT extend FilterInputStream even though it is also reading objects (this time and not primitive types) from the underlying input stream. Here is the branching of the concerned classes. Is there is a design reasoning for the same?

    Read the article

  • What to pass to UserType, BlobType.setPreparedStatement session parameter

    - by dlots
    http://blog.xebia.com/2009/11/09/understanding-and-writing-hibernate-user-types/ I am attempting to defined a customer serialization UserType that mimics, the XStreamUserType referenced and provided here: http://code.google.com/p/aphillips/source/browse/commons-hibernate-usertype/trunk/src/main/java/com/qrmedia/commons/persistence/hibernate/usertype/XStreamableUserType.java My serializer outputs a bytearray that should presumably written to a Blob. I was going to do: public class CustomSerUserType extends DirtyCheckableUserType { protected SerA ser=F.g(SerA.class); public Class<Object> returnedClass() { return Object.class; } public int[] sqlTypes() { return new int[] {Types.BLOB}; } public Object nullSafeGet(ResultSet resultSet,String[] names,Object owner) throws HibernateException,SQLException { if() } public void nullSafeSet(PreparedStatement preparedStatement,Object value,int index) throws HibernateException,SQLException { BlobType.nullSafeSet(preparedStatement,ser.ser(value),index); } } Unfortunetly, the BlobType.nullSafeSet method requires the session. So how does one define a UserType that gets access to a servlet requests session? EDIT: There is a discussion of the issue here and it doesn't appear there is a solution: Best way to implement a Hibernate UserType after deprecations?

    Read the article

  • Ubuntu says FAT16, windows says NTF?

    - by myforwik
    I created a partition on USB harddisk in windows and it reports to be an NTFS partition. Yet in ubuntu 9.10 fdisk says it a FAT16 partition. If I mount with -t ntfs I see nothing, but if I mount without it I see all the files. Can anyone tell me whats going on here? Windows computer disk management definately says its NTFS, and a quick look at the raw data suggests it is NTFS, as I know the FAT16 very well.

    Read the article

  • How to serialize Java primitives using Jersey REST

    - by Olvagor
    In my application I use Jersey REST to serialize complex objects. This works quite fine. But there are a few method which simply return an int or boolean. Jersey can't handle primitive types (to my knowledge), probably because they're no annotated and Jersey has no default annotation for them. I worked around that by creating complex types like a RestBoolean or RestInteger, which simply hold an int or boolean value and have the appropriate annotations. Isn't there an easier way than writing these container objects?

    Read the article

  • Stop duplicate icmp echo replies when bridging to a dummy interface?

    - by mbrownnyc
    I recently configured a bridge br0 with members as eth0 (real if) and dummy0 (dummy.ko if). When I ping this machine, I receive duplicate replies as: # ping SERVERA PING SERVERA.domain.local (192.168.100.115) 56(84) bytes of data. 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=1 ttl=62 time=113 ms 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=1 ttl=62 time=114 ms (DUP!) 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=2 ttl=62 time=113 ms 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=2 ttl=62 time=113 ms (DUP!) Using tcpdump on SERVERA, I was able to see icmp echo replies being sent from eth0 and br0 itself as follows (oddly two echo request packets arrive "from" my Windows box myhost): 23:19:05.324192 IP myhost.domain.local > SERVERA.domain.local: ICMP echo request, id 512, seq 43781, length 40 23:19:05.324212 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 23:19:05.324217 IP myhost.domain.local > SERVERA.domain.local: ICMP echo request, id 512, seq 43781, length 40 23:19:05.324221 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 23:19:05.324264 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 23:19:05.324272 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 It's worth noting, testing reveals that hosts on the same physical switch do not see DUP icmp echo responses (a host on the same VLAN on another switch does see a dup icmp echo response). I've read that this could be due to the ARP table of a switch, but I can't find any info directly related to bridges, just bonds. I have a feeling my problem lay in the stack on linux, not the switch, but am opened to any suggestions. The system is running centos6/el6 kernel 2.6.32-71.29.1.el6.i686. How do I stop ICMP echo replies from being sent in duplicate when dealing with a bridge interface/bridged interfaces? Thanks, Matt [edit] Quick note: It was recommended in #linux to: [08:53] == mbrownnyc [gateway/web/freenode/] has joined ##linux [08:57] <lkeijser> mbrownnyc: what happens if you set arp_ignore to 1 for the dummy interface? [08:59] <lkeijser> also set arp_announce to 2 for that interface [09:24] <mbrownnyc> lkeijser: I set arp_annouce to 2, arp_ignore to 2 in /etc/sysctl.conf and rebooted the machine... verifying that the bits are set after boot... the problem is still present I did this and came up empty. Same dup problem. I will be moving away from including the dummy interface in the bridge as: [09:31] == mbrownnyc [gateway/web/freenode/] has joined #Netfilter [09:31] <mbrownnyc> Hello all... I'm wondering, is it correct that even with an interface in PROMISC that the kernel will drop /some/ packets before they reach applications? [09:31] <whaffle> What would you make think so? [09:32] <mbrownnyc> I ask because I am receiving ICMP echo replies after configuring a bridge with a dummy interface in order for ipt_netflow to see all packets, only as reported in it's documentation: http://ipt-netflow.git.sourceforge.net/git/gitweb.cgi?p=ipt-netflow/ipt-netflow;a=blob;f=README.promisc [09:32] <mbrownnyc> but I do not know if PROMISC will do the same job [09:33] <mbrownnyc> I was referred here from #linux. any assistance is appreciated [09:33] <whaffle> The following conditions need to be met: PROMISC is enabled (bridges and applications like tcpdump will do this automatically, otherwise they won't function). [09:34] <whaffle> If an interface is part of a bridge, then all packets that enter the bridge should already be visible in the raw table. [09:35] <mbrownnyc> thanks whaffle PROMISC must be set manually for ipt_netflow to function, but [09:36] <whaffle> promisc does not need to be set manually, because the bridge will do it for you. [09:36] <whaffle> When you do not have a bridge, you can easily create one, thereby rendering any kernel patches moot. [09:36] <mbrownnyc> whaffle: I speak without the bridge [09:36] <whaffle> It is perfectly valid to have a "half-bridge" with only a single interface in it. [09:36] <mbrownnyc> whaffle: I am unfamiliar with the raw table, does this mean that PROMISC allows the raw table to be populated with packets the same as if the interface was part of a bridge? [09:37] <whaffle> Promisc mode will cause packets with {a dst MAC address that does not equal the interface's MAC address} to be delivered from the NIC into the kernel nevertheless. [09:37] <mbrownnyc> whaffle: I suppose I mean to clearly ask: what benefit would creating a bridge have over setting an interface PROMISC? [09:38] <mbrownnyc> whaffle: from your last answer I feel that the answer to my question is "none," is this correct? [09:39] <whaffle> Furthermore, the linux kernel itself has a check for {packets with a non-local MAC address}, so that packets that will not enter a bridge will be discarded as well, even in the face of PROMISC. [09:46] <mbrownnyc> whaffle: so, this last bit of information is quite clearly why I would need and want a bridge in my situation [09:46] <mbrownnyc> okay, the ICMP echo reply duplicate issue is likely out of the realm of this channel, but I sincerely appreciate the info on the kernels inner-workings [09:52] <whaffle> mbrownnyc: either the kernel patch, or a bridge with an interface. Since the latter is quicker, yes [09:54] <mbrownnyc> thanks whaffle [edit2] After removing the bridge, and removing the dummy kernel module, I only had a single interface chilling out, lonely. I still received duplicate icmp echo replies... in fact I received a random amount: http://pastebin.com/2LNs0GM8 The same thing doesn't happen on a few other hosts on the same switch, so it has to do with the linux box itself. I'll likely end up rebuilding it next week. Then... you know... this same thing will occur again. [edit3] Guess what? I rebuilt the box, and I'm still receiving duplicate ICMP echo replies. Must be the network infrastructure, although the ARP tables do not contain multiple entries. [edit4] How ridiculous. The machine was a network probe, so I was (ingress and egress) mirroring an uplink port to a node that was the NIC. So, the flow (must have) gone like this: ICMP echo request comes in through the mirrored uplink port. (the real) ICMP echo request is received by the NIC (the mirrored) ICMP echo request is received by the NIC ICMP echo reply is sent for both. I'm ashamed of myself, but now I know. It was suggested on #networking to either isolate the mirrored traffic to an interface that does not have IP enabled, or tag the mirrored packets with dot1q.

    Read the article

  • exim4, avoid emails end up in spam folder

    - by MultiformeIngegno
    I have a VPS: I set up exim, problem is emails always go in the spam folder.. this is a sample header: http://pastebin.com/raw.php?i=4NJ2ZaUs As you can see it PASSes SPF test but still emails don't pass spam filters (I tried with Gmail).. Here's my exim config: dc_eximconfig_configtype='internet' dc_other_hostnames='MY_DOMAIN' dc_local_interfaces='' dc_readhost='MY_DOMAIN' dc_relay_domains='MY_DOMAIN' dc_minimaldns='false' dc_relay_nets='' dc_smarthost='MY_DOMAIN' CFILEMODE='644' dc_use_split_config='false' dc_hide_mailname='' dc_mailname_in_oh='true' dc_localdelivery='mail_spool' Why does this happen?

    Read the article

  • Storing Templates and Object-Oriented vs Relational Databases

    - by syrion
    I'm designing some custom blog software, and have run into a conundrum regarding database design. The software requires that there be multiple content types, each of which will require different entry forms and presentation templates. My initial instinct is to create these content types as objects, then serialize them and store them in the database as JSON or YAML, with the entry forms and templates as simple strings attached to the "contentTypes" table. This seems cumbersome, however. Are there established best practices for dealing with this design? Is this a use case where I should consider an object database? If I should be using an object database, which should I consider? I am currently working in Python and would prefer a capable Python library, but can move to Java if need be.

    Read the article

  • Sorting Table Cells based on data from NSArray

    - by Graeme
    Hi, I have an NSArray which contains information from an RSS feed on dogs, such as [dog types], [dog age] and [dog size]. At the moment my UITableView simply displays each cell on each dog and within the cell lists [dog types], [dog age] and [dog size]. I want to be able to allow users of my app to "sort" this data based on the dog name, dog size or dog age when they press a UIButton in the top nav-bar. I'm struggling to work out how to filter the UITableView based on these factors, so any help is appreciated. Thanks.

    Read the article

  • WCF error service error message with shared classes

    - by sevenalive
    Source code: http://code.google.com/p/sevenupdate/source/browse/#hg/Source/SevenUpdate.Base SevenUpdate.Base.Sui cannot be used since it does not match imported DataContract. Need to exclude this type from referenced types. Now I tried unchecking reuse reference types and I was able to get my project to compile. but when sending a collection from the client it was never received or couldn't be deserialized on the server end. I really need this to work. Any help would be appreciated, the fullsource code is provided by google code.

    Read the article

  • What should layers in dotnet application ? Pleas guide me

    - by haansi
    Hi, I am using layered architecture in dotnet (mostly I work on web projects). I am confuse what layers should I use ? I have small idea that there should be the following layers. user interface customer types (custom entities) business logic layer data access layer My purpose is sure quality of work and maximum re-usability of code. some one suggested to add common types layer in it. Please guide me what should be layers ? and in each layer what part should go ? thanks for your precious time and advice. haansi

    Read the article

  • Identifying that a variable is a new-style class in Python?

    - by Dave Johansen
    I'm using Python 2.x and I'm wondering if there's a way to tell if a variable is a new-style class? I know that if it's an old-style class that I can do the following to find out. import types class oldclass: pass def test(): o = oldclass() if type(o) is types.InstanceType: print 'Is old-style' else: print 'Is NOT old-style' But I haven't been able to find anything that works for new-style classes. I found this question, but the proposed solutions don't seem to work as expected, because simple values as are identified as classes. import inspect def newclass(object): pass def test(): n = newclass() if inspect.isclass(n): print 'Is class' else: print 'Is NOT class' if inspect.isclass(type(n)): print 'Is class' else: print 'Is NOT class' if inspect.isclass(type(1)): print 'Is class' else: print 'Is NOT class' if isinstance(n, object): print 'Is class' else: print 'Is NOT class' if isinstance(1, object): print 'Is class' else: print 'Is NOT class' So is there anyway to do something like this? Or is everything in Python just a class and there's no way to get around that?

    Read the article

  • Recover harddrive data

    - by gameshints
    I have a dell laptop that recently "died" (It would get the blue screen of death upon starting) and the hard drive would make a weird cyclic clicking noises. I wanted to see if I could use some tools on my linux machine to recover the data, so I plugged it into there. If I run "fdisk" I get: Disk /dev/sdb: 20.0 GB, 20003880960 bytes 64 heads, 32 sectors/track, 19077 cylinders Units = cylinders of 2048 * 512 = 1048576 bytes Disk identifier: 0x64651a0a Disk /dev/sdb doesn't contain a valid partition table Fine, the partition table is messed up. However if I run "testdisk" in attempt to fix the table, it freezes at this point, making the same cyclical clicking noises: Disk /dev/sdb - 20 GB / 18 GiB - CHS 19078 64 32 Analyse cylinder 158/19077: 00% I don't really care about the hard drive working again, and just the data, so I ran "gpart" to figure out where the partitions used to be. I got this: dev(/dev/sdb) mss(512) chs(19077/64/32)(LBA) #s(39069696) size(19077mb) * Warning: strange partition table magic 0x2A55. Primary partition(1) type: 222(0xDE)(UNKNOWN) size: 15mb #s(31429) s(63-31491) chs: (0/1/1)-(3/126/63)d (0/1/32)-(15/24/4)r hex: 00 01 01 00 DE 7E 3F 03 3F 00 00 00 C5 7A 00 00 Primary partition(2) type: 007(0x07)(OS/2 HPFS, NTFS, QNX or Advanced UNIX) (BOOT) size: 19021mb #s(38956987) s(31492-38988478) chs: (4/0/1)-(895/126/63)d (15/24/5)-(19037/21/31)r hex: 80 00 01 04 07 7E FF 7F 04 7B 00 00 BB 6F 52 02 So I tried to mount just to the old NTFS partition, but got an error: sudo mount -o loop,ro,offset=16123904 -t ntfs /dev/sdb /mnt/usb NTFS signature is missing. Ugh. Okay. But then I tried to get a raw data dump by running dd if=/dev/sdb of=/home/erik/brokenhd skip=31492 count=38956987 But the file got up to 59885568 bytes, and made the same cyclical clicking noises. Obviously there is a bad sector, but I don't know what to do about it! The data is still there... if I view that 57MB file in textpad... I can see raw data from files. How can I get my data back? Thanks for any suggestions, Solution: I was able to recover about 90% of my data: Froze harddrive in freezer Used Ddrescue to make a copy of the drive Since Ddrescue wasn't able to get enough of my drive to use testdisk to recover my partitions/file system, I ended up using photorec to recover most of my files

    Read the article

  • Where is the visual studio 2010 setup and deployment project template

    - by Tom Brown
    In VS 2008, when I create a project I can add a setup project easily. File-Add-New Project... then in Project types: select Other Project Types-Setup and Deployment - and there are a whole load of installed templates - including Setup Project to create an MSI installer. But in VS 2010 - there are no templates in the Setup and Deployment - I'm using the Pro edition, not Express or beta: Is this the same for you - or do I have a duff installation of VS 2010? Otherwise how do I create an MSI installer for my projects?

    Read the article

  • Grub Error 18 - Solid State Drive

    - by clint
    I recently used Raw Copy to make an image of my 300gb Raptor Hd to a OCZ Vertex SSD 60GB. And When I pluged in the SSD to boot I get a Grub Error 18. I have tried to changed in the BIOS setting to LBA, Large, Auto, trying different combination's. Any advice. thanks, Clint

    Read the article

  • C# Design Layout/Patterns

    - by wpfwannabe
    I am still fairly new to C# and I am trying to decide the best way to structure a new program. Here is what I want to do and I would like feed back on my idea. Presentation Layer Business Layer (Separate Class Library) Data Layer (Separate Class Library) Model Layer (Separate Class Library) What I am struggling with is if it is ok to have the classes in the Data Layer and Business Layer inherit from the types I define in Model Layer. This way I can extended the types as needed in my Business Layer with any new properties I see fit. I might not use every property from the Model type in my Business Layer class but is that really a big deal? If this isn't clear enough I can try and put together an example.

    Read the article

  • how to disable these logs on the screen?

    - by user62367
    using Fedora 14: http://pastebin.com/raw.php?i=jUvcfugw i mount an anonym Samba share [checks it in every 5 sec] it's working, ok, great! But: when i shut down my Fedora box, i can see the lines containing this scripts lines! Many times, about ~50x on the screen. How could i disable these lines when shutting down? I [and other people] don't want to see those lines for about ~ 5 sec Thank you!

    Read the article

  • Rails. Putting update logic in your migrations

    - by Daniel Abrahamsson
    A couple of times I've been in the situation where I've wanted to refactor the design of some model and have ended up putting update logic in migrations. However, as far as I've understood, this is not good practice (especially since you are encouraged to use your schema file for deployment, and not your migrations). How do you deal with these kind of problems? To clearify what I mean, say I have a User model. Since I thought there would only be two kinds of users, namely a "normal" user and an administrator, I chose to use a simple boolean field telling whether the user was an adminstrator or not. However, after I while I figured I needed some third kind of user, perhaps a moderator or something similar. In this case I add a UserType model (and the corresponding migration), and a second migration for removing the "admin" flag from the user table. And here comes the problem. In the "add_user_type_to_users" migration I have to map the admin flag value to a user type. Additionally, in order to do this, the user types have to exist, meaning I can not use the seeds file, but rather create the user types in the migration (also considered bad practice). Here comes some fictional code representing the situation: class CreateUserTypes < ActiveRecord::Migration def self.up create_table :user_types do |t| t.string :name, :nil => false, :unique => true end #Create basic types (can not put in seed, because of future migration dependency) UserType.create!(:name => "BASIC") UserType.create!(:name => "MODERATOR") UserType.create!(:name => "ADMINISTRATOR") end def self.down drop_table :user_types end end class AddTypeIdToUsers < ActiveRecord::Migration def self.up add_column :users, :type_id, :integer #Determine type via the admin flag basic = UserType.find_by_name("BASIC") admin = UserType.find_by_name("ADMINISTRATOR") User.all.each {|u| u.update_attribute(:type_id, (u.admin?) ? admin.id : basic.id)} #Remove the admin flag remove_column :users, :admin #Add foreign key execute "alter table users add constraint fk_user_type_id foreign key (type_id) references user_types (id)" end def self.down #Re-add the admin flag add_column :users, :admin, :boolean, :default => false #Reset the admin flag (this is the problematic update code) admin = UserType.find_by_name("ADMINISTRATOR") execute "update users set admin=true where type_id=#{admin.id}" #Remove foreign key constraint execute "alter table users drop foreign key fk_user_type_id" #Drop the type_id column remove_column :users, :type_id end end As you can see there are two problematic parts. First the row creation part in the first model, which is necessary if I would like to run all migrations in a row, then the "update" part in the second migration that maps the "admin" column to the "type_id" column. Any advice?

    Read the article

  • Sorting based on existing elements in xslt

    - by Teelo
    Hi , I want to sort in xslt based on existing set of pattern . Let me explain with the code: <Types> <Type> <Names> <Name>Ryan</Name> </Names> <Address>2344</Address> </Type> <Type> <Names> </Name>Timber</Name> </Names> <Address>1234</Address> </Type> <Type> <Names> </Name>Bryan</Name> </Names> <Address>34</Address> </Type> </Types> Right now I m just calling it and getting it like (all hyperlinks) Ryan Timber Bryan Now I don't want sorting on name but I have existing pattern how I want it to get displayed.Like Timber Bryan Ryan (Also I don't want to lose the url attached to my names earlier while doing this) I was thinking of putting earlier value in some array and sort based on the other array where I will store my existing pattern. But I am not sure how to achieve that.. My xslt looks like this now(there can be duplicate names also) <xsl:for-each select="/Types/Type/Names/Name/text()[generate-id()=generate-id(key('Name',.)[1])]"> <xsl:call-template name="typename"> </xsl:call-template> </xsl:for-each> <xsl:template name="typename"> <li> <a href="somelogicforurl"> <xsl:value-of select="."/> </a> </li> </xsl:template> I am using xsl 1.0

    Read the article

  • How to Import flip video to Final Cut Pro and edit flip video in Final Cut Pro?

    - by Yinahd
    Final Cut Pro is a professional video editing application for Mac users and it is widely used even by many Hollywood people on professional movie post-production. If you are a flip video fan and you want to give professional editing to your flip videos, Final Cut Pro is a great choice. However, Final Cut Pro does not allow raw flip videos to be imported to Final Cut Pro and you will need to convert flip video to Final Cut Pro supported formats.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Drupal - Counting data in nodes, creating custom statistics

    - by hfidgen
    Hiya, I'm building some custom content types to capture customer data on a website. Admins will enter the data, users will be able to view it, but I also need to be able to bolt on some statistics and infographics to the data. The problem I have is that I can't see any simple way of doing this within Drupal. Are there modules which can produce simple stats on selected node types or will I have to write a complete custom module using the data abstraction layer? Thanks for any insights!

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 97 98 99 100 101 102 103 104 105 106 107 108  | Next Page >