Search Results

Search found 3541 results on 142 pages for 'idiomatic perl'.

Page 109/142 | < Previous Page | 105 106 107 108 109 110 111 112 113 114 115 116  | Next Page >

  • Descending list ordered by file modification time

    - by user62367
    How can i generate a list of files in a directory [e.g.: "/mnt/hdd/PUB/"] ordered by the files modification time? [in descending order, the oldest modified file is at the lists end] ls -A -lRt would be great: https://pastebin.com/raw.php?i=AzuSVmrJ but if a file is changed in a directory it lists the full directory...so the pastebined link isn't good [i don't want a list ordered by "directories", i need a "per file" ordered list] os: openwrt..[no perl - not enough space for it :( + no "stat", or "file" command] Thank you!

    Read the article

  • Determine if PowerShell function is running as part of a pipeline?

    - by Richard Cook
    Can a PowerShell function determine if it is being run as part of a pipeline? I have a function which populates an array with instances of FileInfo which I would like to "yield" to the pipeline if the function is being run this way or produce some pretty output if the function is being invoked by itself from the command line. function Do-Something { $file_infos = @() # Populate $file_infos with FileInfo instances... if (INVOKED_IN_PIPELINE) { return $file_infos } else { foreach ($file_info in $file_infos) { write-host -foregroundcolor yellow $file_info.fullname } } } Basically, I'm trying to figure out how to implement INVOKED_IN_PIPELINE. If it is run in a pipeline (e.g. Do-Something | format-table fullname), I would simply yield the array, but if run directly (e.g. Do-Something), it would simply pretty-print the output. Is there a way to do this? If there is a more "idiomatic" way to achieve this kind of thing, I would also be interested to know.

    Read the article

  • Can mod_fcgid maintain a hard-minimum number of available appserver processes?

    - by user9795
    ...and if so, how? I'm using Apache2 + mod_fcgid to serve a perl Catalyst application, on a box that I own, and I'd like for mod_fcgid to maintain a minimum number of spun-up processes ready to go. The docs say that FcgidMinProcessesPerClass only enforces a minimum number of processes that will be retained in a process class after finishing requests How do I get apache to start up with a certain number of appserver subprocesses on an idle server without using artificial load to get there?

    Read the article

  • Is there an equivalent for the Zip function in Clojure Core or Contrib?

    - by John Kane
    In Clojure, I want to combine two lists to give a list of pairs, > (zip '(1 2 3) '(4 5 6)) ((1 4) (2 5) (3 6)) In Haskell or Ruby the function is called zip. Implementing it is not difficult, but I wanted to make sure I wasn't missing a function in Core or Contrib. There is a zip namespace in Core, but it is described as providing access to the Zipper functional technique, which does not appear to be what I am after. Is there an equivalent function for combining 2 or more lists, in this way, in Core? If there is not, is it because there is an idiomatic approach that renders the function unneeded?

    Read the article

  • Utility for extracting MIME attachments

    - by tripleee
    I am looking for a command-line tool for Unix (ideally, available in a Debian / Ubuntu package) for extracting all MIME parts from a multipart email message (or the body from a singlepart with an interesting content-type, for that matter). I have been using the mimeexplode tool which ships with the Perl MIME::Tools package, but it's not really production quality (the script is included as an example only, and has issues with what it regards as "evil" character sets) and I could certainly roll my own script based on that, but if this particular wheel has already been innovated, perhaps I shouldn't.

    Read the article

  • How do you update an Excel file (Data Refresh and update formulas) WITHOUT opening the file?

    - by Alex
    I have an Excel file that want to update and save automatically with out having to open it or manually interact with. Manually, I open the file up and hit data refresh which goes and does a SQL query and then hit F9 for the formulas to update and then I just close/save. (I then would mail the file out to people using a perl script or use SAS JMP to run some numbers/charts and also mail them out. Basically I need to script some things which require the XLS file to be updated.)

    Read the article

  • How does one reduce a list of boolean values in Common Lisp?

    - by postfuturist
    Given a list of values, I want to reduce the list to T if all the elements are not NIL, NIL if not. This gives me an error: (apply #'and (get-some-list)) As does this: (reduce #'and (get-some-list)) This is the best I've come up with: [11]> (defun my-and (x y) (and x y)) MY-AND [12]> (reduce #'my-and '(T T T T T)) T [13]> (reduce #'my-and '(T T T T NIL)) NIL Why is "#'and" invalid? Is there a more idiomatic way to do this in Common Lisp?

    Read the article

  • seeking VPS Hosting advice

    - by jergw
    What is the best price, best value, for Linux VPS hosting in British Columbia, Canada? looking for something that can handle Perl/PHP, and admin user control of library/module installation. BTW: Is it possible to get a dual setup...half windows mode server, half Linux mode server? Thanks in advance for all your responses.

    Read the article

  • apt: how to search using package tags?

    - by depesz
    Some (most?) packages in Debian, have tags. For example: =# apt-cache show squirrelmail | perl -lne 'print if /^Tag:/.../^\S/' Tag: implemented-in::php, interface::web, mail::imap, mail::smtp, mail::user-agent, network::server, protocol::http, protocol::imap, protocol::smtp, role::program, scope::application, use::browsing, use::editing, use::searching, use::transmission, use::viewing, web::TODO, web::application, works-with::mail Section: web But, I can't find a way, to list all packages with given tag. Is it possible?

    Read the article

  • Spamassassin command to tag & move mail with an X-Spam-Score of 10+ to a new directory?

    - by ane
    Have a maildir with tens of thousands of messages in it, about 70% of which are spam. Would like to: Run /usr/local/bin/spamassassin against it, tagging each message if the score is 10 or greater Have a tcsh shell or perl one-liner grep all mails with a spam score of over 10 and move those mails to /tmp/spam What commands can I run to accomplish this? Pseudocode: /usr/local/bin/spamassassin ./Maildir/cur/* -tagscore10 grep "X-Spam-Score: [10-100]" ./Maildir/cur/* | mv %1 /tmp/spam

    Read the article

  • Filtering subsets using Linq

    - by Nathan Matthews
    Hi All, Imagine a have a very long enunumeration, too big to reasonably convert to a list. Imagine also that I want to remove duplicates from the list. Lastly imagine that I know that only a small subset of the initial enumeration could possibly contain duplicates. The last point makes the problem practical. Basically I want to filter out the list based on some predicate and only call Distinct() on that subset, but also recombine with the enumeration where the predicate returned false. Can anyone think of a good idiomatic Linq way of doing this? I suppose the question boils down to the following: With Linq how can you perform selective processing on a predicated enumeration and recombine the result stream with the rejected cases from the predicate?

    Read the article

  • How to change password hashing algorithm when using spring security?

    - by harry
    I'm working on a legacy Spring MVC based web Application which is using a - by current standards - inappropriate hashing algorithm. Now I want to gradually migrate all hashes to bcrypt. My high level strategy is: New hashes are generated with bcrypt by default When a user successfully logs in and has still a legacy hash, the app replaces the old hash with a new bcrypt hash. What is the most idiomatic way of implementing this strategy with Spring Security? Should I use a custom Filter or my on AccessDecisionManager or …?

    Read the article

  • negative regexp in Squirm (for Squid). Possible ?

    - by alex8657
    Did someone achieve to do negative regexp (or part of) with Squirm ? I tried negative lookahead things and ifthenelse regexps, but Squirm 1.26 fails to understand them. What i want to do is simply: * If the url begins by 'http://' and contains 'account', then rewrite/redirect to 301:https:// * It the url begins by 'https://' and does NOT contains 'account, then rewrite/redirect to 301:http:// So far, i do that using 2 lines of perl, but squirm redirectors would take less memory

    Read the article

  • reading a line, tokenizing and assigning to struct in C

    - by Dervin Thunk
    line is fgets'd, and running in a while loop with counter n, d is a struct with 2 char arrays, p and q. Basically, in a few words, I want to read a line, separate it into 2 strings, one up until the first space, and the rest of the line. I clean up afterwards (\n from the file becomes \'0'). The code works, but is there a more idiomatic way to do this? What errors am I running into "unknowingly"? int spc = strcspn(line," "); strncpy(d[n].p, line, spc); d[n].p[spc+1]='\0'; int l = strlen(line)-spc; strncpy(d[n].q, line+spc+1, l); char* nl = strchr(d[n].q, '\n'); if(nl){ *nl='\0'; } n++; Thanks.

    Read the article

  • better for-loop syntax for detecting empty sequences?

    - by Dmitry Beransky
    Hi, Is there a better way to write the following: row_counter = 0 for item in iterable_sequence: # do stuff with the item counter += 1 if not row_counter: # handle the empty-sequence-case Please keep in mind that I can't use len(iterable_sequence) because 1) not all sequences have known lengths; 2) in some cases calling len() may trigger loading of the sequence's items into memory (as the case would be with sql query results). The reason I ask is that I'm simply curious if there is a way to make above more concise and idiomatic. What I'm looking for is along the lines of: for item in sequence: #process item *else*: #handle the empty sequence case (assuming "else" here worked only on empty sequences, which I know it doesn't)

    Read the article

  • What is the pythonic way to add type information to an object's attributes?

    - by Tikitu
    I'm building classes where I know the types of the attributes, but Python of course doesn't. While it's un-pythonic to want to tell it, supposing I do want to, is there an idiomatic way to do so? Why: I'm reading in serialised data (without type information) involving objects-nested-inside-objects. It's easy to put it into nested dictionaries, but I want it in objects of my class-types, to get the right behaviours as well as the data. For instance: suppose my class Book has an attribute isbn which I will fill with an ISBNumber object. My serialised data gives me the isbn as a string; I would like to be able to look at Book and say "That field should be filled by ISBNumber(theString)." Bonus glee for me if the solution can be applied to classes I get from someone else without editing their code.

    Read the article

  • Spamassassin one-liner to tag & move mail with an X-Spam-Flag: YES to a new directory?

    - by ane
    Say you have a directory with tens of thousands of messages in it. And you want to separate the spam from the non-spam. Specifically, you would like to: Run spamassassin against the directory, tagging each message with an X-Spam-Flag: YES if it thinks it's spam Have a tcsh shell or perl one-liner grep all mail with the flag and move those mails to /tmp/spam What command can you run to accomplish this? For example, some pseudocode: /usr/local/bin/spamassassin -eL ./Maildir/cur/* | grep "X-Spam-Flag: YES" | mv %1 /tmp/spam

    Read the article

  • Spamassassin command to tag mail & move mail with a spam score of over 10 to a new folder?

    - by ane
    Have a maildir with tens of thousands of messages in it, about 70% of which are spam. Would like to: Run /usr/local/bin/spamassassin against it, tagging each message if the score is 10 or greater Have a tcsh shell or perl one-liner grep all mails with a spam score of over 10 and move those mails to /tmp/spam What commands can I run to accomplish this? Pseudocode: /usr/local/bin/spamassassin ./Maildir/cur/* -tagscore10 grep "X-Spam-Score: [10-100]" ./Maildir/cur/* | mv %1 /tmp/spam

    Read the article

  • Identify Deprecated Rules on Checkpoint Firewall

    - by Basa
    I've been asked to find the deprecated rules among the thousands of rules in our Checkpoint firewall. I could do it by writing a perl program to analyze the log and lists of objects & rules, but i wanted to know if anybody knows of an easier way before reinventing the wheel. I have access to SmartView Monitor et SmartView Tracker and i wanted to know if anybody knew of a way to achieve my goal with those tools.

    Read the article

  • What is the most efficient functional version of the following imperative code?

    - by justin.r.s.
    I'm learning Scala and I want to know the best way of expressing this imperative pattern using Scala's functional programming capabilities. def f(l: List[Int]): Boolean = { for (e <- l) { if (test(e)) return true } } return false } The best I can come up with is along the lines of: l map { e => test(e) } contains true But this is less efficient since it calls test() on each element, whereas the imperative version stops on the first element that satisfies test(). Is there a more idiomatic functional programming technique I can use to the same effect? The imperative version seems awkward in Scala.

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • What is /com/host?

    - by grawity
    The Perl documentation for Sys::Hostname contains: Attempts several methods of getting the system hostname [...]. It tries the first available of [blah blah] , and the file /com/host. If all that fails it croaks. What systems is this /com/host used on? It's a very ungooglable filename, and this is the first time I have heard of it.

    Read the article

  • how to change ext of a file in Windows?

    - by Tim
    I downloaded a perl file from some webpage by opening it in my browser and saving it. But the saved file has a file name xxx.pl.txt. How can I save it into a file with pl as its ext? Also how to change a file's ext? Can I do these in command line? Thanks and regards!

    Read the article

< Previous Page | 105 106 107 108 109 110 111 112 113 114 115 116  | Next Page >