Search Results

Search found 7253 results on 291 pages for 'adam short'.

Page 148/291 | < Previous Page | 144 145 146 147 148 149 150 151 152 153 154 155  | Next Page >

• Make the recycle bin of the SSD on a RAID0 drive?

  - by Rolnik

  I don't know about you folks, but I hate the idea of junk sitting on my tiny 30GB SSD. Any way to designate another drive to be the host of the Recycle Bin for items formerly on the SSD? Basically, I need to know how to make a lower-priority drive receive the recycled materials from the 'main' drive, which happens to be short on space. The best thing I can think of is a batch file that a) syncs 'recycle' to another drive; and b) empties the recycle bin. ... but that's too much work for me.

  Read the article

• Shortcut for enabling / disabling Greasemonkey (or specific script)

  - by ldigas

  talking about firefox here ... I don't use Greasemonkey on any other browser, but if you know, do add info for those as well I use Greasemonkey daily ... having some 20 scripts loaded all the time which save me a ton of grief. But, some of them I sometimes don't need ... few examples: - I use Google Image Status Reporter & Direct Images (links you directly to image file) ... but sometimes I want to go to the page where the image is ... - GReader Minimalist Style ... until I actually need to check the trends and some stuff it hides - there are other examples but these two first sprang to mind, since I just were thinking about that ... To put the long story short ... sometimes I would like a shortcut to disable Greasemonkey, so I don't have to go into the menubar and so on (which I also have half hidden for space) ... anyone knows of any, or how one could create one ?

  Read the article

• WD Elements Desktop External - Not recognised on a single computer

  - by Aelexe

  My WD Elements Desktop External is no longer recognised on my main computer. It has worked fine in the past, but now all of a sudden is not detected. It does not prompt when plugged in, nor does it show up in the disc management interface or the device manager. It appears to be aware that it is plugged in however as the light on the external blinks rapidly for a short while after being plugged in. The strangest thing however is that it works fine on other computers, including my family computers and my laptop. I have attempted to troubleshoot the issue by trying various USB devices in multiple ports on each system to see if there is any correlation with the issue, but have come up with nothing that gives me an idea of what is going on. I have also attempted to format the external using my laptop, but that has not helped either. If anyone has had a similar issue, or knows of any potential solutions, please post your advice. Thanks for your time.

  Read the article

• Apache web server: "proxying" a webapp from another server?

  - by Riddler

  Sorry for the lame terminology - I'm no way a sysadmin... So here's the deal. I have two Linux boxes in the same network, let's refer to those boxes by their IPs, a.b.c.d and e.f.g.h. Each box runs some webapp, normally available like http://a.b.c.d/ and http://e.f.g.h/. What I want to accomplish is this: with some Apache web server (which by the way lives on both boxes) configuration voodoo, the first app would be available via http://a.b.c.d/whatever1/, and the 2nd app would be available as http://a.b.c.d/whatever2/ - but would still reside on another server (e.f.g.h). Long story short - is it at all possible to do this with Apache configuration magic and without touching the webapps and their configuration? If so - how? :) Thanks in advance!

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Migrating users and IIS settings from a workgroup win2k3 machine to a new win2k8r2

  - by amber

  I am retiring my old Windows Server 2003 Standard 32bit machine to a new machine with Windows Server 2008 R2 Standard. The two sticking points are migrating user accounts (and there are a lot of them) and IIS settings/websites (again, there are a lot). The new machine has not been provisioned yet. I'm at that point where I'm about install the OS on it. The old machibe is configured with a mirrored set for its OS and data partitions. I have broken the mirror set, replicated all of the data to an external drive, and then rebuilt the mirror set. In short, I have an image of the old machine to play with while safely leaving it up and running. Thanks!

  Read the article

• Computer freezes, wireless network icon disappears

  - by Heidi

  As you can see I have two problems. I have a Toshiba Tecra A3 computer. It is 5-6 years old and it is connected to a D-link router. For a period now it has not been working correctly. The computer freezes either when i try turning it on or when I have been using the computer for a short period of time. The times the computer works normally I have a problem with a disappearing wireless network icon, and so I have no internet. Can this be fixed or do I have to buy a new computer? I only use the computer for internet surfing and easy tasks like word etc, so I would like to keep it as long as possible.

  Read the article

• Link two or more text boxes in Visio

  - by Dan

  I am working on creating a template in Visio 2007 (Professional). Each page should reflect a document number and a revision number (two text boxes). I would like to make the template such that entering or changing text in one of these boxes on one page will automatically update the equivalent text boxes on all other pages. Is there an easy way to link two (or more) text boxes to show the same data (mirror each other)? I've looked into creating a ShapeData set and then using the ShapeData field in place of each box, but this will require training others to access and adjust the ShapeData field. In short - I want the issue that was attempting to be solved in Changing Text in Visio Org Chart Shape Changes Multiple Shapes' Text .

  Read the article

• HP Pavillion dv6 laptop - 15 beeps on startup and a black screen?

  - by dunc

  Usual story - girlfriend's step-brother's laptop is broken. I don't know a huge amount about what occurred before it broke, but I do know the following: When you try to turn the laptop on, it beeps 15 times exactly. The screen remains black. The LED on the Caps Lock key flashes continuously. If left on, the laptop never boots - as far as I can see. If left on, on a stable surface with decent ventilation for a relatively short period of time, the laptop (below keyboard, but not where the RAM/HDD are) gets very hot. I've tried doing what most websites appear to recommend for similar problems, which is to disconnect AC and battery then hold the power button down for a minute before reconnecting the AC and trying to turn the laptop on - no difference. EDIT I've also tried re-seating the RAM, to no avail. Any ideas? Thanks in advance,

  Read the article

• VPN PPTPD with MPPE Support for Debian or Ubuntu

  - by user78395

  Having an unencrypted vpn connection from a windows client to linux is pretty easy by using pptpd. When I was looking for an solution for encrypted (per MPPE) connection, I found a lot of information about patching the kernel etc. - so it definitly works after some work. But all these information is pretty old (2005-2006). Is it the same solution nowadays? I am not asking for a complete instruction (only if it's short) - I am more asking for a link to the right solution.

  Read the article

• Upgrade Subversion 1.6 to 1.7 on CentOS? (can't find yum repository)

  - by user743919

  I want to upgrade my SVN Server from 1.6 to 1.7. Unfortunately I can't find anything on the internet how to do this with yum. I have checked rpmforge-extras but it has only svn 1.6 and not 1.7 I wanted to update with yum because this is the most secure way for me. I'm not an experienced Linux user. Is there a yum repository that contains 1.7 (subversion.x86_64 0:1.7.xxxxx.el5.rfx) I hope somebody can help me out? If there is non, perhaps a short explenation how to update with just step by step.

  Read the article

• Bringing my Dell XPS 13 ultrabook back to factory state

  - by TysHTTP

  I have a brand new Dell XPS 13 ultra book. After i picked it up at the store, i wiped the exising partitions which also contained the restore/rescue data, which you need to reinstall the factory version of Windows 8 that comes with this machine. I did this because we have a different MS partner edition of Windows which i prefer to run. After doing all this, i noticed that there was something wrong with machine. No real damage, but the specs are not completely as they should be. Turned out that a simple mistake while ordering. Now, long story short, the shop says that it has no problem with taking the product back, as long as it is in it's original state. And this is the problem i'm having, because i formatted the original partitions that contain that rescue option / windows 8 setup, i don't have a clue whether it's possible to get back to that original. Does anyone have an idea on how to get this fixed?

  Read the article

• How to force Windows XP to rename a file with a special character?

  - by codeLes

  I have a song that Windows can't play because there is a question mark in the name of the file. "Where Have All the Cowboys Gone?.ogg" // as an example So I try to rename it and Windows complains whether I try it in Explorer or from command prompt. Error I get when trying to copy, rename, or move is: The Filename, directory name, or volume label syntax is incorrect Is there a Windows way to force a rename in this case? Update I'll keep an eye on this question, but after 13 answers and many attempts (aside form 3rd party solutions) it seems that Windows can't do this (or at least my windows can't, no short names). So I'm accepting the answer which was my original solution anyway of using Linux. It would be nice to see Windows handle this somehow, so don't stop just because I've accepted this answer, the question still stands!

  Read the article

• What's a good tool for collecting statistics on filesystem usage?

  - by Kamil Kisiel

  We have a number of filesystems for our computational cluster, with a lot of users that store a lot of really large files. We'd like to monitor the filesystem and help optimize their usage of it, as well as plan for expansion. In order to this, we need some way to monitor how these filesystems are used. Essentially I'd like to know all sorts of statistics about the files: Age Frequency of access Last accessed times Types Sizes Ideally this information would be available in aggregate form for any directory so that we could monitor it based on project or user. Short of writing something up myself in Python, I haven't been able to find any tools capable of performing these duties. Any recommendations?

  Read the article

• Open application in background without losing current window focus. Fedora 17, Gnome 3

  - by Ishan

  I'm running a script in the background which loads an image with feh depending on which application is currently in focus. However, whenever the script opens the image, window focus is lost to feh. I was able to circumvent this by using xdotool to switch back to the application that was originally in focus, but this introduces a short annoying period of time where the focus is switched from feh to the application. My question is this: is there any way to launch feh in the background such that window focus is NOT lost? System: Fedora 17, Gnome 3, Bash Thanks a ton!

  Read the article

• TrueCrypt - "Warning! Password locked: Fixed disk0" error message on boot

  - by Tibi

  TrueCrypt - "Warning! Password locked: Fixed disk0" error message on boot. When i start my laptop (Acer TravelMate 2410). after the starting memory check, the screen goes full black, and a message appears for about 3 seconds: Warning! Password locked: Fixed disk0 and after that, disappears, and next message comes out: Operating System Not Found and all stops here. Windows Xp was installed on it, before this came. TrueCrypt cd (witch was made during the process of full encryption) is not working, not in restoring MBR, no even in decrypting my drive - completely useless. Note: I detected some short of boot sector errors (i dont know the amount) on my drive before this happened. Please, i would greatfully thank every comment, or suggestion, because my computer is unusable now. The HDD is a Samsung HDD, 160Gb. Other preferences: Acer TravelMate 2410 Notebook, 2 Gb RAM, 1500 Mhz Intel Celeron M processor. Regards

  Read the article

• Fusion 3, Windows 7, frequent blue screens

  - by kenny6127

  Is anyone else seeing this problem? A solution would be great (hey, it's Windows, it's gonna blue screen, just gotta deal with it), but it's also nice to know if it's something specific to my configuration, or if a lot of folks are having the same issue. Here's the details: * MacBook Pro 15" unibody, 4 GB, 2.4 GHz, 10.5.8 * Fusion 3.0.1 * Windows 7 Pro, 32-bit (clean install, not migrated from Boot Camp or anything) Blue screens happen nearly every time the MBP cover is closed for a short period of time (< 3 minutes). If the cover is closed for a half hour or longer, the VM is fine. I'm guessing it might be related to sleep, but that's hard to tell, and the Windows crash dump logs are pretty useless. Thanks!

  Read the article

• Why can't email clients create rules for moving dates like "yesterday"?

  - by Morgan

  I've never seen an email client that I could easily create a rule to do something like "Move messages from yesterday to a folder?" Is there some esoteric reason why this would be difficult? I know I can easily create rules around specific dates, but that isn't the same thing by a long shot; am I missing something? In Outlook 2010 I can create search folders that do sort of this type of thing, but you can't create rules around a search folder... seems like either I am missing something major, or this is terribly short-sided.

  Read the article

• Optimize Windows file access over network

  - by Djizeus

  At my company I frequently need to access shared files over a Windows network. These files are located on the other side of the planet, so I guess the file share goes through some kind of VPN over Internet, but I don't control this and it is supposed to be "transparent" for me. However it is extremely slow. Displaying the content of a directory in the file explorer takes about 10s. Even if over the Internet, I did not expect that retrieving a list of file names would be that long. Are there any settings to optimize this from my Windows XP workstation, or is it mostly related to the way the network is configured? The only thing I have found so far is to cache all file names, while by default only short file names are cached (http://support.microsoft.com/kb/843418).

  Read the article

• Will 5 Terabyte NAS drive be compatible with Windows XP SP3 32 bit?

  - by TrevorBoydSmith

  (NOTE: The operating system (in this case Windows XP SP3 32 bit) we are using is not a choice.) I am trying to setup a short term storage device. First, I found a large 5 Terabyte NAS drive that would IMO fulfill my storage requirements. Second, I also found that Windows XP seems to have a hard drive size limit (see 'Is there a limit to the size of a hard drive for Windows XP pre-SP1?'): XP should handle up to 2 TB per volume after the service packs are applied. You are correct. There was a 137gb limit on the orginal pre service pack windows xp. This was addressed/fixed in SP1. My question is, will my Windows XP SP3 32 bit machine see the 5 Terabyte NAS and be able to read/write properly to the NAS drive?

  Read the article

• Migrate servers without losing any data / time-limited MySQL dump?

  - by inac

  Is there a way to migrate from an old dedicated server to a new one without losing any data in-between - and with no downtime? In the past, I've had to lose MySQL data between the time when the new server goes up (i.e., all files transferred, system up and ready), and when I take the old server down (data still transferred to old until new one takes over). There is also a short period where both are down for DNS, etc., to refresh. Is there a way for MySQL/root to easily transfer all data that was updated/inserted between a certain time frame?

  Read the article

• Will installing an Ultra ATA cable backwards affect performance?

  - by GMMan

  I've recently purchased a hard drive upgrade for my Xbox 320GB WD Caviar Blue WD3200AAJB and StarTech.com Ultra ATA/66/100/133 cable IDE66 yes I'm crazy When it came to installing the cable, it was too short (my fault), and there wasn't enough space between the master and slave ends to reach both the DVD drive and the hard drive. The only thing I could do was install the cable backwards and twisting it quite a bit to make it fit. The upgrade works, but reading the manual for the hard drive I replaced (10GB Seagate U Series 5), apparently there is a specific way you have to connect the cable. I don't have that option, so the question comes down to, will my drive performance be at Ultra ATA levels, or is it still performing at original ATA speeds? Is there any way I can test this (benchmarking software for Xbox)?

  Read the article

• Error code 2503 - Cannot install software on Windows 7 (64Bit)

  - by SixfootJames

  A short while ago, I had my hard drive die on me and at the same time my 1Tb backup drive! I took it back to the guy I bought the PC from and although the backup drive could not be recovered, he managed to get my machine working again by making a minor change in the BIOS which then got it out of that continuous loop it found itself in after multiple BSOD episodes. Everything seems to be working fine but yesterday when I tried to save something from Google Chrome, I got and insufficient permission problem and when I try to install software, I get an error of 2503. I have already followed the suggestions here but none of this worked for me. Any suggestions would be appreciated. EDIT: This started happening after I tried running a number of tests to get the machine working, including a previous restore point.

  Read the article

• Ubuntu Lucid (10.04) subpixel font rendering crashes Xorg

  - by user36066

  Hi everyone... I really don't know how to solve this on my own so I thought giving this site a chance. After upgrading to Lucid I ran into some problems. With some experimenting I came to a conclusion that if I enable subpixel smoothing on fonts the moment I start any other application not native to GTK+ (wine, openoffice, wxWidgets, ...) my X server crashes the same moment. At first this seemed like something went wrong during installation. To cut the long story short, after 3 clean installations and whole bunch of experimenting the same thing happens all over again. Strange thing is... if I configure any other font smoothing besides subpixel, everything works like it should. Any thoughs?

  Read the article

• Stream computer screen to TV via network instead of a USB wireless link

  - by user24559

  I want to stream my computer screen (not just video or a limited amount of content) to my TV via the network. I know there are wireless devices that use USB to tranfer the screen to the TV. However, these are limited to a short distance. What I want to do is stream the data via the network so I can be anywhere within the network and have the data shown on the tv. I am looking for video and sound to transfer. I want the entire computer screen to transfer just like when you connect the computer to the tv via VGA or HDMI and the sound out using the 3.5mm plug. I have been unable to find a unit that allows for the entire computer screen to transfer via the network. I just find the ability to stream video. I am using Windows 7 Ultimate with a quad processor and 16 GB of memory so I have the power to handle the transfer. My tv is hdtv.

  Read the article

< Previous Page | 144 145 146 147 148 149 150 151 152 153 154 155  | Next Page >