Search Results

Search found 9970 results on 399 pages for 'regular john'.

Page 163/399 | < Previous Page | 159 160 161 162 163 164 165 166 167 168 169 170  | Next Page >

• Dll in both the bin and the gac, which one gets used?

  - by John Boker

  We have a web application that's deployed to many websites with only frontend changes, the shared backend portion has it's DLL in the GAC so we only have to update that one dll and all the sites get the update. Is there a way to override the GAC with a DLL in the /bin folder to test out new features before they get released?

  Read the article

• facebook photo album grouping photos in news feed

  - by John Klingelhoets

  We have a social media "platform" - when we schedule photos to be published to Facebook, if a user schedules photos - they all go into the same album, as they schedule photos throughout the day - the photos become grouped and do not appear as a large photo - but rather a bunch of photos in a album. Is there any way to prevent photos from being grouped in the new feed and it just showing the newest uploaded photo in stream? I do not see an option.

  Read the article

• Just when I thought my site was working right, it screws up in IE7

  - by John

  I thought I'd done quite well, my site passed XHTML1.0 strict validation and worked flawlessly in IE6 as well as looking fine in IE8 & Chrome. I glibly thought that it it worked in IE6 & 8, IE7 was bound to be OK. But on checking I see one of my has a scrollbar in IE7, the seems about 200% as wide as it should be... the content is fine but you can scroll the whole . 2 separate pages have this issue, a 3rd does not, even though all pages use the same layout template - the main difference on the 2 that break is a floated div. Are there known issues specifically in this area with IE7? Or do I have to embarrass myself by posting a link to the site?

  Read the article

• Why Do I See the "In Recovery" Msg, and How Can I Prevent it?

  - by John Hansen

  The project I'm working on creates a local copy of the SQL Server database for each SVN branch you work on. We're running SQL Server 2008 Express with Advanced Services on our local machine to host it. When we create a new branch, the build script will create a new database with the ID of that branch, creates the schema objects, and copies over a selection of data from the production shadow server. After the database is created, it, or other databases on the local machine, will often go into "In Recovery" mode for several minutes. After several refreshes it comes up and is happy, but will occasionally go back into "In Recovery" mode. The database is created in simple recovery mode. The file names aren't specified, so it uses default paths for files. The size of the database after loading data is ~400 megs. It is running in SQL Server 2005 compatibility mode. The command that creates the database is: sqlcmd -S $(DBServer) -Q "IF NOT EXISTS (SELECT [name] FROM sysdatabases WHERE [name] = '$(DBName)') BEGIN CREATE DATABASE [$(DBName)]; print 'Created $(DBName)'; END" ...where $(DBName) and $(DBServer) are MSBuild parameters. I got a nice clean log file this morning. When I turned on my computer it starts all five databases. However, two of them show transactions being rolled forward and backwards. The it just keeps trying to start up all five of the databases. 2010-06-10 08:24:59.74 spid52 Starting up database 'ASPState'. 2010-06-10 08:24:59.82 spid52 Starting up database 'CommunityLibrary'. 2010-06-10 08:25:03.97 spid52 Starting up database 'DLG-R8441'. 2010-06-10 08:25:05.07 spid52 2 transactions rolled forward in database 'DLG-R8441' (6). This is an informational message only. No user action is required. 2010-06-10 08:25:05.14 spid52 0 transactions rolled back in database 'DLG-R8441' (6). This is an informational message only. No user action is required. 2010-06-10 08:25:05.14 spid52 Recovery is writing a checkpoint in database 'DLG-R8441' (6). This is an informational message only. No user action is required. 2010-06-10 08:25:11.23 spid52 Starting up database 'DLG-R8979'. 2010-06-10 08:25:12.31 spid36s Starting up database 'DLG-R8441'. 2010-06-10 08:25:13.17 spid52 2 transactions rolled forward in database 'DLG-R8979' (9). This is an informational message only. No user action is required. 2010-06-10 08:25:13.22 spid52 0 transactions rolled back in database 'DLG-R8979' (9). This is an informational message only. No user action is required. 2010-06-10 08:25:13.22 spid52 Recovery is writing a checkpoint in database 'DLG-R8979' (9). This is an informational message only. No user action is required. 2010-06-10 08:25:18.43 spid52 Starting up database 'Rls QA'. 2010-06-10 08:25:19.13 spid46s Starting up database 'DLG-R8979'. 2010-06-10 08:25:23.29 spid36s Starting up database 'DLG-R8441'. 2010-06-10 08:25:27.91 spid52 Starting up database 'ASPState'. 2010-06-10 08:25:29.80 spid41s Starting up database 'DLG-R8979'. 2010-06-10 08:25:31.22 spid52 Starting up database 'Rls QA'. In this case it kept trying to start the databases continuously until I shut down SQL Server at 08:48:19.72, 23 minutes later. Meanwhile, I actually am able to use the databases much of the time.

  Read the article

• Override Django inlineformset_factory has_changed() to always return True

  - by John

  Hi, I am using the django inlineformset_factory function. a = get_object_or_404(ModelA, pk=id) FormSet = inlineformset_factory(ModelA, ModelB) if request.method == 'POST': metaform = FormSet (instance=a, data=request.POST) if metaform.is_valid(): f = metaform.save(commit=False) for instance in f: instance.updated_by = request.user instance.save() else: metaform = FormSet(instance=a) return render_to_response('nodes/form.html', {'form':metaform}) What is happening is that if I change any of the data then everything works ok and all the data gets updated. However if I don't change any of the data then the data is not updated. i.e. only entries which are changed go through the for loop to be saved. I guess this makes sense as there is no point saving data if it has not changed. However I need to go through and save every object in the form regardless of whether it has any changes on not. So my question is how do I override this so that it goes through and saves every record whether it has any changes or not? Hope this makes sense Thanks

  Read the article

• Make a mouse pointer do a hyper-jump?

  - by John M

  I run a dual monitor setup. To get from monitor 1 to 2 (or vice-versa) requires lots of unnecessary mouse movement. My thought was to leverage a extra mouse button (I have two) and have the mouse hyper-jump (apologies to Star Trek) from the XY coordinates on monitor 1 to the same XY coordinates on monitor 2. How would I go about doing this? Could it be done via C#?

  Read the article

• Is is possible to do an end-run around generics covariance in C# < 4 in this hypothetical situation?

  - by John Feminella

  Suppose I have a small inheritance hierarchy of Animals: public interface IAnimal { string Speak(); } public class Animal : IAnimal { public Animal() {} public string Speak() { return "[Animal] Growl!"; } } public class Ape : IAnimal { public string Speak() { return "[Ape] Rawrrrrrrr!"; } } public class Bat : IAnimal { public string Speak() { return "[Bat] Screeeeeee!"; } } Next, here's an interface offering a way to turn strings into IAnimals. public interface ITransmogrifier<T> where T : IAnimal { T Transmogrify(string s); } And finally, here's one strategy for doing that: public class Transmogrifier<T> : ITransmogrifier<T> where T : IAnimal, new() { public T Transmogrify(string s) { T t = default(T); if (typeof(T).Name == s) t = new T(); return t; } } Now, the question. Is it possible to replace the sections marked [1], [2], and [3] such that this program will compile and run correctly? If you can't do it without touching parts other than [1], [2], and [3], can you still get an IAnimal out of each instance of a Transmogrifier in a collection containing arbitrary implementations of an IAnimal? Can you even form such a collection to begin with? static void Main(string[] args) { var t = new Transmogrifier<Ape>(); Ape a = t.Transmogrify("Ape"); Console.WriteLine(a.Speak()); // Works! // But can we make an arbitrary collection of such animals? var list = new List<Transmogrifier< [1] >>() { // [2] }; // And how about we call Transmogrify() on each one? foreach (/* [3] */ transmogrifier in list) { IAnimal ia = transmogrifier.Transmogrify("Bat"); } } }

  Read the article

• Should I move client to Lamp or develop on Wamp?

  - by John Isaacks

  I have never developed for WAMP, the hosting guy for my new client says they are using Windows servers, they can setup PHP and MySQL for me, but they cannot switch to a *nix server. He said there are some nuances from PHP on *nix Vs. win. So my question is, if I have never programmed PHP on win, should I go through the hassle of switching hosts (since they cannot do *nix themselves), or are the differences slight enough that it shouldn't be too big a problem for me? (side note: the state of the clients website has no effect since it is a static all-flash site and is going to be completely rebuilt) Thanks!

  Read the article

• OSGi bundle imports packages from non-bundle jars: create bundles for them?

  - by John Simmons

  I am new to OSGi, and am using Equinox. I have done several searches and can find no answer to this. The discussion at OSGI - handling 3rd party JARs required by a bundle helps somewhat, but does not fully answer my question. I have obtained a jar file, rabbitmq-client.jar, that is already packaged as an OSGi bundle (with Bundle-Name and other such properties in its MANIFEST.MF), that I would like to install as a bundle. This jar imports packages org.apache.commons.io and org.apache.commons.io.input from commons-io-1.2.jar. The RabbitMQ client 2.7.1 distribution also includes commons-cli-1.1.jar, so I presume that it is required as well. I examined the manifests of these commons jars and found that they do not appear to be packaged as bundles. That is, their manifests have none of the standard bundle properties. My specific question is: if I install rabbitmq-client.jar as a bundle, what is the proper way to get access to the packages that it needs to import from the commons jars? There are only three alternatives that I can think of, without rebuilding rabbitmq-client.jar. The packages from the commons jars are already included in the Equinox global classpath, and rabbitmq-client.jar will get them automatically from there. I must make another bundle with the two commons jars, export the needed packages, and install that bundle in Equinox. I must put these two commons jars in the global classpath when I start Equinox, and they will be available to rabbitmq-client.jar from there. I have read that one normally does not use the global classpath in an OSGi container. I am not clear on whether items from the global classpath are even available when building individual bundle classpaths. However, I note that rabbitmq-client.jar also imports other packages such as javax.net, which I presume come from the global classpath. Or is there some other bundle that exports them? Thanks for any assistance!

  Read the article

• How to understand existing projects

  - by John

  Hi. I am a trainee developer and have been writing .NET applications for about a year now. Most of the work I have done has involved building new applications (mainly web apps) from scratch and I have been given more or less full control over the software design. This has been a great experience however, as a trainee developer my confidence about whether the approaches I have taken are the best is minimal. Ideally I would love to collaborate with more experienced developers (I find this the best was I learn) however in the company I work for developers tend to work in isolation (a great shame for me). Recently I decided that a good way to learn more about how experienced developers approach their design might be to explore some open source projects. I found myself a little overwhelmed by the projects I looked at. With my level of experience it was hard to understand the body of code I faced. My question is slight fuzzy one. How do developers approach the task of understanding a new medium to large scale project. I found myself pouring over lots of code and struggling to see the wood for the trees. At any one time I felt that I could understand a small portion of the system but not see how its all fits together. Do others get this same feeling? If so what approaches do you take to understanding the project? Do you have any other advice about how to learn design best practices? Any advice will be very much appreciated. Thank you.

  Read the article

• how to display data in NSoutlineview?

  - by john

  I am new in cocoa framework.I want to disply data in NSOutlineView (static data).But i dont know how to use.Please advice me

  Read the article

• Help. WebResource.axd is leading to a exploit site

  - by John Prado

  I've a site hosted in a shared enviroment. Every time I do a and add some validation controls the ASP.Net generate a script call to a WebResource.axd who leads to a exploit site: www2.shopezlive.com/main.php?..... How the hacker could compromise the assemblies of .Net and how can I get rid of this mess?

  Read the article

• Is it possible to open a context menu from a map overlay item in android?

  - by John Nicholson

  This below code works fine opening an alert dialog. I was wondering if it's possible to open a context menu from within a map overlay class? @Override protected boolean onTap(int index) { OverlayItem item = mOverlays.get(index); AlertDialog.Builder dialog = new AlertDialog.Builder(mContext); dialog.setTitle(item.getTitle()); dialog.setMessage(item.getSnippet()); dialog.show(); return true; }

  Read the article

• Setting Environment Variables For NMAKE Before Building A 'Makefile Solution'

  - by John Dibling

  I have an MSVC Makefile Project in which I need to set an environment variable before running NMAKE. For x64 builds I needs to set it to one value, and for x86 builds I need to set it to something else. So for example, when doing a build I would want to SET PLATFORM=win64 if I'm building a 64-bit compile, or SET PLATFORM=win32 if I'm building 32-bit. There does not appear to be an option to set environment variables or add a pre-build even for makefile projects. How do I do this? EDIT: Running MSVC 2008

  Read the article

• How do I perform this XPath query with Linq?

  - by John Hansen

  In the following code I am using XPath to find all of the matching nodes using XPath, and appending the values to a StringBuilder. StringBuilder sb = new StringBuilder(); foreach (XmlNode node in this.Data.SelectNodes("ID/item[@id=200]/DAT[1]/line[position()>1]/data[1]/text()")) { sb.Append(node.Value); } return sb.ToString(); How do I do the same thing, except using Linq to XML instead? Assume that in the new version, this.Data is an XElement object.

  Read the article

• Oracle performance report

  - by John

  Hi, Is there any way of running the $ORACLE_HOME/rdbms/admin/awrrpt.sql so that it doesn't require any input parameters, as in automatically collects a report for the previous hour? /j

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• A Surface view and a canvas to move Bitmap

  - by John Apple Sim

  I have a SurfaceView and I want the Bitmap Logo inside it in the canvas to be movable What I'm doing wrong ? static float x, y; Bitmap logo; SurfaceView ss = (SurfaceView) findViewById(R.id.svSS); logo = BitmapFactory.decodeResource(getResources(), R.drawable.logo); x = 40; y = 415; ss.setOnTouchListener(new View.OnTouchListener() { @Override public boolean onTouch(View v, MotionEvent me) { try { Thread.sleep(50); } catch (InterruptedException e) { e.printStackTrace(); } switch(me.getAction()) { case MotionEvent.ACTION_DOWN: x = me.getX(); y = me.getY(); break; case MotionEvent.ACTION_UP: x = me.getX(); y = me.getY(); break; case MotionEvent.ACTION_MOVE: x = me.getX(); y = me.getY(); break; } return true; } }); public class OurView extends SurfaceView implements Runnable{ Thread t = null; SurfaceHolder holder; boolean isItOK = false; public OurView(Context context) { super(context); holder = getHolder(); } public void run (){ while (isItOK == true){ //canvas DRAWING if (!holder.getSurface().isValid()){ continue; } Canvas c = holder.lockCanvas(); c.drawARGB(255, 200, 100, 100); c.drawBitmap(logo, x,y,null); holder.unlockCanvasAndPost(c); } } public void pause(){ isItOK = false; while(true){ try { t.join(); } catch (InterruptedException e) { e.printStackTrace(); } break; } t = null; } public void resume(){ isItOK = true; t = new Thread(this); t.start(); } } Now the surface view is just black .. nothing happens also its not colored 200, 100, 100

  Read the article

• Nested custom configuration section

  - by John

  Hello, I'm trying to access my app.config file which has nested element and I'm unable to do so. I will appreciate any help...

  Read the article

• Is my code really not unit-testable?

  - by John

  A lot of code in a current project is directly related to displaying things using a 3rd-party 3D rendering engine. As such, it's easy to say "this is a special case, you can't unit test it". But I wonder if this is a valid excuse... it's easy to think "I am special" but rarely actually the case. Are there types of code which are genuinely not suited for unit-testing? By suitable, I mean "without it taking longer to figure out how to write the test than is worth the effort"... dealing with a ton of 3D math/rendering it could take a lot of work to prove the output of a function is correct compared with just looking at the rendered graphics.

  Read the article

• How to display only selected data in combo box at run time from database?

  - by Joy1979

  I am new to .Net and I am working on one task. Below is my scenario. I have 2 tables: Table 1: Students StudentID StudentDetail 1 StudentName 2 StudentGrade Table 2: Student_data StudentDetail StudentRecords StudentName John (Default) StudentName Jacob StudentName Smith StudentGrade A (default) StudentGrade B StudentGrade C Question: When window form loads (run time) I need to display StudentRecords in combo box with StudentName = "John" and StudentGrade = "A" as default followed by other values. StudentName and StudentRecords are in Labels and values are in a ComboBox. I am using VB.Net and VS 2010 with SQL 2008r2. I would appreciate any step by step help. Apologies If my request is simple.

  Read the article

• Type of member is not CLS-compliant

  - by John Galt

  Using Visual Studio 2008 and VB.Net: I have a working web app that uses an ASMX web service which is compiled into its separate assembly. I have another class library project compiled as a separate assembly that serves as a proxy to this web service. This all seems to work at runtime but I am getting this warning at compile time which I don't understand and would like to fix: Type of member 'wsZipeee' is not CLS-compliant I have dozens of webforms in the main project that reference the proxy class with no compile time complaints as this snippet shows: Imports System.Data Partial Class frmZipeee Inherits System.Web.UI.Page Public wsZipeee As New ProxyZipeeeService.WSZipeee.Zipeee Dim dsStandardMsg As DataSet Private Sub Page_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load And yet I have one webform (also in the root of the main project) which gives me the "not CLS-compliant" message but yet attempts to reference the proxy class just like the other ASPX files. I get the compile time warning on the line annoted by me with 'ERROR here.. Imports System.Data Partial Class frmHome Inherits System.Web.UI.Page Public wsZipeee As New ProxyZipeeeService.WSZipeee.Zipeee ERROR here Dim dsStandardMsg As DataSet Private Sub Page_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load This makes no sense to me. The file with the warning is called frmHome.aspx.vb; all others in the project declare things the same way and have no warning. BTW, the webservice itself returns standard datatypes: integer, string, and dataset.

  Read the article

• Sorting issues in flexigrid with "json" data

  - by John Sieber

  I'm currently using flexigrid to display data in a current project, but am running into issues with its ability to properly sort certain columns that contain dates or numbers. The data is being sent from a ColdFusion CFC that selects the appropriate data and then delivers it in the proper "json" format. As the date/time stamps and other fields containing numbers are sent as "strings" they do not sort properly in the data grid. Is this a limitation of Flexigrid or am I sending the data improperly to Flexigrid? I can provide examples of my code if that is helpful.

  Read the article

• Problem deleting .svn directories on Windows XP

  - by John L

  I don't seem to have this problem on my home laptop with Windows XP, but then I don't do much work there. On my work laptop, with Windows XP, I have a problem deleting directories when it has directories that contain .svn directories. When it does eventually work, I have the same issue emptying the Recycle bin. The pop-up window says "Cannot remove folder text-base: The directory is not empty" or prop-base or other folder under .svn This continued to happen after I changed config of TortoiseSVN to stop the TSVN cache process from running and after a reboot of the system. Multiple tries will eventually get it done. But it is a huge annoyance because there are other issues I'm trying to fix, so I'm hoping it is related. 'Connected Backup PC' also runs on the laptop and the real problem is that cygwin commands don't always work. So I keep thinking the dot files and dot directories have something to do with both problems and/or the backup or other process scanning the directories is doing it. But I've run out of ideas of what to try or how to identify the problem further.

  Read the article

• Web app implementation question.

  - by John Berryman

  I would like to create a web app similar to Stack Overflow in that the users will have different "point" levels and that their capabilities within the web app will be different based upon their point level. Question: How can this best be implemented? How can it be implemented in a way that is un-hackable (i.e. accessing capabilities that should not be available)? I figure there are two ways to do this: server-side and client-side. For the server-side solution, for each page request you check who the user is and have the CGI rewrite the page so that the client only gets a web page with the intended capabilities. For the client-side solution, the server gives the client the fully capable app and it is the client's job to check the point level and to handicap the app appropriately. It seems like the client-side solution would be easier on the server, (which is really important for my app), but more susceptible to someone hacking and using capabilities unwarranted by their point level.

  Read the article

< Previous Page | 159 160 161 162 163 164 165 166 167 168 169 170  | Next Page >