Search Results

Search found 9970 results on 399 pages for 'regular john'.

Page 167/399 | < Previous Page | 163 164 165 166 167 168 169 170 171 172 173 174  | Next Page >

  • How to understand other people's CSS architectures?

    - by John
    I am reasonably good with CSS. However, when working with someone else's CSS, it's difficult for me to see the "bigger picture" in their architecture (but i have no problem when working with a CSS sheet I wrote myself). For example, I have no problems using Firebug to isolate and fix cross browser compatibility issues, or fixing a floating issue, or changing the height on a particular element. But if I'm asked to do something drastic such as, "I want the right sidebars of pages A, B, C and D to have a red border. I want the right side bars of pages E, F and G to have a blue border if and only if the user mouses over", then it takes me time a long time to map out all the CSS inheritance rules to see the "bigger picture". For some reason, I don't encounter the same difficulty with backend code. After a quick debriefing of how a feature works, and a quick inspection of the controller and model code, I will feel comfortable with the architecture. I will think, "it's reasonable to assume that there will be an Employee class that inherits from the Person Class that's used by a Department controller". If I discover inconvenient details that aren't consistent with overall architectural style, I am confident that I can hammer things back in place. With someone else's CSS work, it's much harder for me to see the "relationships" between different classes, and when and how the classes are used. When there are many inheritance rules, I feel overwhelmed. I'm having trouble articulating my question and issues... All I want to know is, why is it so much harder for me to see the bigger picture in someone else's CSS architecture than compared to someone else's business logic layer? **Does it have any thing to do with CSS being a relatively new technology, and there aren't many popular design patterns?

    Read the article

  • Winforms - How to allow user to increase font size of listview with hidden controls?

    - by John M
    I am creating an winform application that will run on a tablet PC. One form for this app will have a listview control. I would like to allow the user to change the font size based on preference (ie did they remember their glasses today). A few ways that I can think of would be a numeric-up-down or +/- button controls. Both of these ways require screen real estate that is very limited. Is there a control or technique that would allow font size changes with a hidden-when-not-used control?

    Read the article

  • How do I use grep to extract a specific field value from lines

    - by Stormshadow
    I have lines in a file which look like the following ....... DisplayName="john" .......... where .... represents variable number of other fields. Using the following grep command, I am able to extract all the lines which have a valid 'DisplayName' field grep DisplayName="[0-9A-Za-z[:space:]]*" e:\test However, I wish to extract just the name (ie "john") from each line instead of the whole line which is returned by grep. I tried pipelining the output to the cut command but it does not accept string delimiters.

    Read the article

  • What is on the 68000 stack when classic MacOS enters a program?

    - by John Källén
    I'm trying to understand an old classic Mac application's entry point. I've disassembled the first CODE resource (not CODE#0, which is the jump table). The code refers to some variables off the stack: a word at 0004(A7), an array of long words of starting at 000C(A7) whose length is the value at 0004(A7), and a final long word beyond that array that seems to be a pointer to a character string. The array of long words looks like strings at first glance, so it looks superficially like we're dealing with an (int argc, char ** argv) situation, except the "argv" array is inline in the stack frame. What should a program be expecting on its stack / registers when it first gets called by the Mac OS?

    Read the article

  • Serving large generated files using Google App Engine?

    - by John Carter
    Hiya, Presently I have a GAE app that does some offline processing (backs up a user's data), and generates a file that's somewhere in the neighbourhood of 10 - 100 MB. I'm not sure of the best way to serve this file to the user. The two options I'm considering are: Adding some code to the offline processing code that 'spoofs' it as a form upload to the blob store, and going thru the normal blobstore process to serve the file. Having the offline processing code store the file somewhere off of GAE, and serving it from there. Is there a much better approach I'm overlooking? I'm guessing this is functionality that isn't well suited to GAE. I had thought of storing in the datastore as db.Text or Dd.Blob but there I encounter the 1 MB limit. Any input would be appreciated,

    Read the article

  • Why do you have to call URLConnection#getInputStream to be able to write out to URLConnection#getOutputStream?

    - by John
    I'm trying to write out to URLConnection#getOutputStream, however, no data is actually sent until I call URLConnection#getInputStream. Even if I set URLConnnection#doInput to false, it still will not send. Does anyone know why this is? There's nothing in the API documentation that describes this. Java API Documentation on URLConnection: http://download.oracle.com/javase/6/docs/api/java/net/URLConnection.html Java's Tutorial on Reading from and Writing to a URLConnection: http://download.oracle.com/javase/tutorial/networking/urls/readingWriting.html import java.io.IOException; import java.io.OutputStreamWriter; import java.net.URL; import java.net.URLConnection; public class UrlConnectionTest { private static final String TEST_URL = "http://localhost:3000/test/hitme"; public static void main(String[] args) throws IOException { URLConnection urlCon = null; URL url = null; OutputStreamWriter osw = null; try { url = new URL(TEST_URL); urlCon = url.openConnection(); urlCon.setDoOutput(true); urlCon.setRequestProperty("Content-Type", "text/plain"); //////////////////////////////////////// // SETTING THIS TO FALSE DOES NOTHING // //////////////////////////////////////// // urlCon.setDoInput(false); osw = new OutputStreamWriter(urlCon.getOutputStream()); osw.write("HELLO WORLD"); osw.flush(); ///////////////////////////////////////////////// // MUST CALL THIS OTHERWISE WILL NOT WRITE OUT // ///////////////////////////////////////////////// urlCon.getInputStream(); ///////////////////////////////////////////////////////////////////////////////////////////////////////// // If getInputStream is called while doInput=false, the following exception is thrown: // // java.net.ProtocolException: Cannot read from URLConnection if doInput=false (call setDoInput(true)) // ///////////////////////////////////////////////////////////////////////////////////////////////////////// } catch (Exception e) { e.printStackTrace(); } finally { if (osw != null) { osw.close(); } } } }

    Read the article

  • Do most web 'programmers' (not designers) use WYSIWYG editors or hand code their HTML?

    - by John MacIntyre
    When I started programming web pages, it became immediately obvious that the WYSIWYG editors sucked. The HTML output was difficult to maintain, did things in ways you may not have agreed with, completely messed up existing pages if opened, couldn't handle code in the page, and was polluted with dead or irrelevant code like <font ...></font>. At that time, I didn't know a single programmer with more than 6 months experience who didn't hand code their HTML. Even now, most of the developers I know hand code their HTML. But, I also realize this was a decade ago, WYSIWYG editors have improved, and I may be seriously underproductive hand coding my HTML. Do you, as a web programmer, use WYSIWYG editors for your HTML? PS-I'm kind of thinking we can just vote either YES or NO, and put comments below.

    Read the article

  • what else to do to establish many-to-many associations in Ruby on Rails? thanks!

    - by john
    Hi, I have two classes and I want to establish a many-to-many assications, here is the code: class Category < ActiveRecord::Base has_and_belongs_to_many :events has_and_belongs_to_many :tips end class Tip < ActiveRecord::Base has_and_belongs_to_many :categories However, I kept getting the following errors and I would appreciate it if some one could educate me what is going wrong: PGError: ERROR: relation "categories_tips" does not exist : SELECT "categories".id FROM "categories" INNER JOIN "categories_tips" ON "categories".id = "categories_tips".category_id WHERE ("categories_tips".tip_id = NULL ) the viewer part: 4: <%= text_field :tip, :title %></label></p> 5: 6: <p><label>Categories<br/> 7: <%= select_tag('categories[]', options_for_select(Category.find(:all).collect {|c| [c.name, c.id] }, @tip.category_ids), :multiple => true ) %></label></p> 8: 9: <p><label>Location<br/> 10: <%= text_field_with_auto_complete :tip, :abstract %></label></p>

    Read the article

  • WPF WrapPanel - all items should have the same width

    - by John
    I have a ListBox whose ItemsPanel I have replaces with a WrapPanel. The WrapPanel now hosts the databound ListboxItems. Each item has a variable sized text in it, giving each item a different width. However, I want the width to be constant so that all items have the same width as the item with the longest text. Is that possible?

    Read the article

  • How many hours of use before I need to clean a tape drive?

    - by codeape
    I do backups to a HP Ultrium 2 tape drive (HP StorageWorks Ultrium 448). The drive has a 'Clean' LED that supposedly will light up or blink when the drive needs to be cleaned. The drive has been in use since october 2005, and still the 'Clean' light has never been lit. The drive statistics are: Total hours in use: 1603 Total bytes written: 19.7 TB Total bytes read: 19.3 TB My question is: How many hours of use can I expect before I need to clean the drive? Edit: I have not encountered any errors using the drive. I do restore tests every two months, and every backup is verified. Edit 2: The user manual says: "HP StorageWorks Ultrium tape drives do not require regular cleaning. An Ultrium universal cleaning cartridge should only be used when the orange Clean LED is flashing." Update: It is now May 2010 (4.5 years of use), and the LED is still off, I have not cleaned, backups verify and regular restore tests are done.

    Read the article

  • PHP - MySQL - Select runs indefinitely

    - by John
    I have three tables listings: id, pid, beds, baths, etc, etc, etc, db locations: id, pid, zip, lat, lon, etc, etc, etc, db images id, pid, height, width, raw, etc, etc, db id, pid & db are indexed. db just references the mls provider a particular item came from. in images the raw column holds raw image data there are about 15k rows in listings/locations, and about 120k rows in images so there are multiple rows that have the same pid. when i do "select pid from listings" or "select pid from locations" the query completes successfully in about 100ms. when i do "select pid from images" it just hangs in sqlyog and never completes... i was thinking since the raw column contains alot of information that it might be trying to select that too, but my query doesn't try to select that so I can't imagine why it's taking so long... any idea why this is happening??

    Read the article

  • VB.NET FileSystemWatcher Multiple Change Events

    - by John
    Hi. I have the following code: Imports System.IO Public Class Blah Public Sub New() InitializeComponent() Dim watcher As New FileSystemWatcher("C:\") watcher.EnableRaisingEvents = True AddHandler watcher.Changed, AddressOf watcher_Changed End Sub Private Sub watcher_Changed(ByVal sender As Object, ByVal e As FileSystemEventArgs) MsgBox(e.FullPath) End Sub End Class When I run it and save changes to a file on my C drive, the code works great, except it executes the watcher_Changed() method four times. Any idea why? The changeType is "4" every time. Thanks.

    Read the article

  • TSQL - compare tables

    - by Rya
    I want to create a stored procedure that compares the results of two queries. If the results of the 2nd table can be found in the first, print 'YES', otherwise, print 'No'. Table 1: SELECT dbo.Roles.RoleName, dbo.UserRoles.RoleID FROM dbo.Roles LEFT OUTER JOIN dbo.UserRoles ON dbo.Roles.RoleID = dbo.UserRoles.RoleID WHERE (dbo.Roles.PortalID = 0) AND (dbo.UserRoles.UserID = 2) Table 2: Declare @RowData as nvarchar(2000) Set @RowData = ( SELECT EditPermissions FROM vw_XMP_DMS_Documents where DocumentID = 2) Select Data from dbo.split(@RowData, ',') For example. Table 1: John Jack James Table 2: John Sally Jane Print 'YES' Is this possible??? Thank you all very much. -R

    Read the article

  • Web app implementation question.

    - by John Berryman
    I would like to create a web app similar to Stack Overflow in that the users will have different "point" levels and that their capabilities within the web app will be different based upon their point level. Question: How can this best be implemented? How can it be implemented in a way that is un-hackable (i.e. accessing capabilities that should not be available)? I figure there are two ways to do this: server-side and client-side. For the server-side solution, for each page request you check who the user is and have the CGI rewrite the page so that the client only gets a web page with the intended capabilities. For the client-side solution, the server gives the client the fully capable app and it is the client's job to check the point level and to handicap the app appropriately. It seems like the client-side solution would be easier on the server, (which is really important for my app), but more susceptible to someone hacking and using capabilities unwarranted by their point level.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • C++ arrays select square number and make new vector

    - by John Smith
    I have to see which of the following from a vector is a square number then make another vector with only the square numbers For example: (4,15,6,25,7,81) the second will be (4,25,81) 4,25,81 because 2x2=4 5x5=25 and 9x9=81 I started like this: { int A[100],n,r,i; cout<<"Number of elements="; cin>>n; for(i=1;i<=n;i++) { cout<<"A["<<i<<"]="; cin>>A[i]; } for(i=1;i<=n;i++) { r=sqrt(A[i]); if(r*r==A[i]) } return 0; } but I am not really sure how to continue

    Read the article

  • How deep are your unit tests?

    - by John Nolan
    The thing I've found about TDD is that its takes time to get your tests set up and being naturally lazy I always want to write as little code as possible. The first thing I seem do is test my constructor has set all the properties but is this overkill? My question is to what level of granularity do you write you unit tests at? ..and is there a case of testing too much?

    Read the article

  • Better code for accessing fields in a matlab structure array?

    - by John
    I have a matlab structure array Modles1 of size (1x180) that has fields a, b, c, ..., z. I want to understand how many distinct values there are in each of the fields. i.e. max(grp2idx([foo(:).a])) The above works if the field a is a double. {foo(:).a} needs to be used in the case where the field a is a string/char. Here's my current code for doing this. I hate having to use the eval, and what is essentially a switch statement. Is there a better way? names = fieldnames(Models1); for ix = 1 : numel(names) className = eval(['class(Models1(1).',names{ix},')']); if strcmp('double', className) || strcmp('logical',className) eval([' values = [Models1(:).',names{ix},'];']); elseif strcmp('char', className) eval([' values = {Models1(:).',names{ix},'};']); else disp(['Unrecognized class: ', className]); end % this line requires the statistics toolbox. [g, gn, gl] = grp2idx(values); fprintf('%30s : %4d\n',names{ix},max(g)); end

    Read the article

  • Foreign Keys Duplicated in DataGridView

    - by John Doe
    I created a Windows Forms Application to which I added a DataGridView and LINQ to SQL Classes from one of my databases. I can successfully bind one of my database's tables to my DataGridView: var dataSource = from c in _db.NetworkedEquipments select c; dataGridView1.DataSource = dataSource; However, the foreign keys get duplicated, that is, the columns appear twice. How can I prevent this?

    Read the article

  • whats wrong with this piece of code for saving contacts

    - by Shadow
    Hi, i am using the latest Nokia Qt SDK. i have tried to add the contacts, its not getting added.. what is missing here.. // Construct contact manager for default contact backend QContactManager* cm = new QContactManager("simulator"); // QContactManager* cm = new QContactManager("memory"); // i tried this, its also not working // Create example contact QContact example; // Add contact name QContactName name; name.setFirstName("John"); name.setLastName("Doe"); example.saveDetail(&name); // Add contact email address //QContactEmailAddress email; // email.setContexts(QContactDetail::ContextHome); //email.setEmailAddress(“[email protected]”); // example.saveDetail(&email); // Finally, save the contact details cm->saveContact(&example); delete cm; Thanks

    Read the article

  • Java 7 New Features

    - by John W.
    I have done some good reading on the new java.util.concurrent features being introduced with the java 7 release. For instance, Phaser, TransferQueue and the more exciting Fork Join Framework. I recently saw a power point made by Josh Bloch about even more features that are going to be introduced however that link has been lost. For example I remember one change is being able to build a Map the same way you can build an array for: Map myMap = {"1,Dog","2,Cat"}; and so forth (this may not be 100% correct but the idea is there) Does anyone know of a list or just can name some new things to look forward to? Note: I did see a question asked http://stackoverflow.com/questions/213958/new-features-in-java-7 however it was asked ~2 years ago and I am sure the list of updates are more concrete. Thanks!

    Read the article

< Previous Page | 163 164 165 166 167 168 169 170 171 172 173 174  | Next Page >