Search Results

Search found 13288 results on 532 pages for 'print expression'.

Page 170/532 | < Previous Page | 166 167 168 169 170 171 172 173 174 175 176 177  | Next Page >

• css got number at the last url

  - by every

  <link href="/stylesheets/blueprint/screen.css?1268721265" media="screen, projection" rel="stylesheet" type="text/css" /> <link href="/stylesheets/blueprint/print.css?1268721265" media="print" rel="stylesheet" type="text/css" /> why the css got 1268721265 ? any idea?thanks

  Read the article

• NZEC Run time Error Occured

  - by madan

  import math def gen_caller(a): for z in a: x,y=z if x==1: x=2 if y>=x and y-x<=100000: for i in range(x,y+1): flag=0 for j in range(2,(long(math.sqrt(i))+1)): if(i%j==0): flag=1 break if flag==0: print i print "" n=(int(raw_input())) gen_caller([[(long(raw_input())) for j in range(0,2)] for i in range(0,n) if n<=10])

  Read the article

• PDF printing in java

  - by Julia

  Hello, is there a way to print pdf files from a java webapplication on the local printer of the end user (connected via vpn)? The simple lookup of a printer via Java Printing Service always returns printer which are not able to print pdfs. Are there other libs which can be used for printing in java? By the way, just opening the pdf in the browser is not an option, though it must be possible to run scheduled batch printing without user interaction. Thanks in advance

  Read the article

• Why does this method throw an IllegalMonitorStateException?

  - by kunjaan

  public static synchronized void main(String[] args) throws InterruptedException { Thread t = new Thread(); t.start(); System.out.print("X"); t.wait(10000); System.out.print("Y"); } What is the problem with this method? How can I avoid such problems from now on?

  Read the article

• Logger vs. System.out.println

  - by Amir Rachum

  Hi all, I'm using the PMD plugin for eclipse and it gives me an error when using System.out.println() with the explanation: System.(out|err).print is used, consider using a logger. My question is - What is a Logger? How is it used to print to the screen? Why is it better? Thanks.

  Read the article

• Perl chomp backwording the string

  - by joe

  my $cmd = "grep -h $text $file2 $file1 | tail -1 | awk '{print \$NF }' "; my $port_number; $port_number =`$cmd`; print "port No : ==$port_number=="; the output is : "port No :== 2323 == and i tried chomp its not working

  Read the article

• Rewrite code from Threads to AnyEvent

  - by user1779868

  I wrote a code: use LWP::UserAgent; use HTTP::Cookies; use threads; use threads::shared; $| = 1; $threads = 50; my @urls : shared = loadf('url.txt'); my @thread_list = (); $thread_list[$_] = threads->create(\&thread) for 0 .. $threads - 1; $_->join for @thread_list; thread(); sub thread { my ($web, $ck) = browser(); while(1) { my $url = shift @urls; if(!$url) { last; } $code = $web->get($url)->code; print "[+] $url - code: $code\n"; if($code == 200) { open F, ">>200.txt"; print F $url."\n"; close F; } elsif($code == 301) { open F, ">>301.txt"; print F $url."\n"; close F; } else { open F, ">>else.txt"; print F "$url code - $code\n"; close F; } } } sub loadf { open (F, "<".$_[0]) or erroropen($_[0]); chomp(my @data = <F>); close F; return @data; } sub browser { my $web = new LWP::UserAgent; my $ck = new HTTP::Cookies; $web->cookie_jar($ck); $web->agent('Opera/9.80 (Windows 7; U; en) Presto/2.9.168 Version/11.50'); $web->timeout(5); return $web, $ck; } After its working for some time physical storage is full. Can u help me to re-write it with AnyEvent. I tried but my code didn't work. I read that it will help me to safe some memory. Thanks a lot to any helpers.

  Read the article

• want to run c program from php using exec() function

  - by Abhimanyu

  hi i m trying to run one c executable file using php exec(). when c contains a simple program like print hello i m using exec('./print.out') its working fine.but when i need to pass a argument to my c program i m uing exec('./arugment.out -n 1234') it not working .can any body tell me how to pass arugment using exec to c program.

  Read the article

• Function overloading

  - by makcoozi

  I found this code , and i m not sure that whether overloading should happen or not. void print( int (*arr)[6], int size ); void print( int (*arr)[5], int size ); what happens if I pass pointer to an array of 4 elements , to it should come... any thread will be helpful.

  Read the article

• Python function argument scope (Dictionaries v. Strings)

  - by Shaun Meyer

  Hello, given: foo = "foo" def bar(foo): foo = "bar" bar(foo) print foo # foo is still "foo"... foo = {'foo':"foo"} def bar(foo): foo['foo'] = "bar" bar(foo) print foo['foo'] # foo['foo'] is now "bar"? I have a function that has been inadvertently over-writing my function parameters when I pass a dictionary. Is there a clean way to declare my parameters as constant or am I stuck making a copy of the dictionary within the function? Thanks!

  Read the article

• Easy Python input question

  - by Josh K

  I'd like to have something similar to the following pseudo code: while input is not None and timer < 5: input = getChar() timer = time.time() - start if timer >= 5: print "took too long" else: print input Anyway to do this without threading? I would like an input method that returns whatever has been entered since the last time it was called, or None (null) if nothing was entered.

  Read the article

• How to retrieve items from a django queryset?

  - by sharataka

  I'm trying to get the video element in a queryset but am having trouble retrieving it. user_channel = Everything.objects.filter(profile = request.user, playlist = 'Channel') print user_channel[0] #returns the first result without error print user_channel[0]['video'] #returns error Models.py: class Everything(models.Model): profile = models.ForeignKey(User) playlist = models.CharField('Playlist', max_length = 2000, null=True, blank=True) platform = models.CharField('Platform', max_length = 2000, null=True, blank=True) video = models.CharField('VideoID', max_length = 2000, null=True, blank=True) video_title = models.CharField('Title of Video', max_length = 2000, null=True, blank=True) def __unicode__(self): return u'%s %s %s %s %s' % (self.profile, self.playlist, self.platform, self.video, self.video_title)

  Read the article

• Why are my two date fields not identical when I copy them?

  - by Hobhouse

  I use django, and have two models with a models.DateTimeField(). Sometimes I need a copy of a date - but look at this: >>>myobject.date = datetime.datetime.now() >>>print myobject.date >>>2010-04-27 12:10:43.526277 >>>other_object.date_copy = myobject.date >>>print other_object.date_copy >>>2010-04-27 12:10:43 Why are these two dates not identical, and how do I make an excact copy of myobject.date?

  Read the article

• Executing Multiple Lines in Python

  - by metashockwave

  When Python is first installed, the default setting executes users' code input line-by-line. But sometimes I need to write programs that executes multiple lines at once. Is there a setting in Python where I can change the code execution to one block at once? Thanks if (n/2) * 2 == n:; print 'Even'; else: print 'Odd' SyntaxError: invalid syntax When I tried to run the above code, I got an invalid syntax error on ELSE

  Read the article

• What happens when I instantiate class in Python?

  - by Konstantin

  Could you clarify some ideas behind Python classes and class instances? Consider this: class A(): name = 'A' a = A() a.name = 'B' # point 1 (instance of class A is used here) print a.name print A.name prints: B A if instead in point 1 I use class name, output is different: A.name = 'B' # point 1 (updated, class A itself is used here) prints: B B Even if classes in Python were some kind of prototype for class instances, I'd expect already created instances to remain intact, i.e. output like this: A B Can you explain what is actually going on?

  Read the article

• SQLServer - Test the result of a stored procedure

  - by Melursus

  In Microsoft SQLServer, it is possible to test the result of a stored procedure to know if the result return rows or nothing ? Example : EXEC _sp_MySp 1, 2, 3 IF @@ROWCOUNT = 0 BEGIN PRINT('Empty') END ELSE BEGIN PRINT(@@ROWCOUNT) END But @@ROWCOUNT always return 0 so maybe is there another way of doing this ?

  Read the article

• foo and _foo - about variables inside a class

  - by kame

  class ClassName(object): """ """ def __init__(self, foo, bar): """ """ self.foo = foo # read-write property self.bar = bar # simple attribute def _set_foo(self, value): self._foo = value def _get_foo(self): return self._foo foo = property(_get_foo, _set_foo) a = ClassName(1,2) #a._set_foo(3) print a._get_foo() When I print a._get_foo() the function _get_foo prints the variable self._foo . But where does it come from? self._foo and self.foo are different, aren't they?

  Read the article

• Partial PHP code refresh

  - by Tom

  Is it possible to refresh only the part of the page? How? the part: if (checkExpiry($member->expires)==true) { print timeLeft($leftts); } else { print "expired"; } I have table which is showing name, email, time until membership ends and I need to refresh 'time until membership ends' every second.

  Read the article

• Perl replace slash in variable

  - by cc96ai

  How can I replace the slash inside the variable? $string = 'a\cc\ee'; $re = 'a\\cc'; $rep = "Work"; #doesnt work in variable $string =~ s/$re/$rep/og; print $string."\n"; #work with String $string =~ s/a\\cc/$rep/og; print $string."\n"; output: a\cc\ee Work\ee

  Read the article

• How can c let a function declaration with any parameter type ?

  - by kamil çakir

  I forgot to write void parameter but it works the i put void it gives error it lets this: print(int size,int table[size][size]){ int i,j; printf("-------TABLE-------\n"); for(i = 0;i it says"previos implicit declaration was here " (means the call in main) void print(int size,int table[size][size]){ int i,j; printf("-------TABLE-------\n"); for(i = 0;i

  Read the article

• prints line number in both txtfile and list????

  - by jad

  i have this code which prints the line number in infile but also the linenumber in words what do i do to only print the line number of the txt file next to the words??? d = {} counter = 0 wrongwords = [] for line in infile: infile = line.split() wrongwords.extend(infile) counter += 1 for word in infile: if word not in d: d[word] = [counter] if word in d: d[word].append(counter) for stuff in wrongwords: print(stuff, d[stuff]) the output is : hello [1, 2, 7, 9] # this is printing the linenumber of the txt file hello [1] # this is printing the linenumber of the list words hello [1] what i want is: hello [1, 2, 7, 9]

  Read the article

• How to add a constructor to a subclassed numeric type?

  - by abbot

  I want to subclass a numeric type (say, int) in python and give it a shiny complex constructor. Something like this: class NamedInteger(int): def __init__(self, value): super(NamedInteger, self).__init__(value) self.name = 'pony' def __str__(self): return self.name x = NamedInteger(5) print x + 3 print str(x) This works fine under Python 2.4, but Python 2.6 gives a deprecation warning. What is the best way to subclass a numeric type and to redefine constructors for builtin types in newer Python versions?

  Read the article

• Why am I seeing different results for two expressions in Ruby, one uses '&&', other uses 'and' opera

  - by Shekhar

  print (-1 == -1) and (myobj.nil?) true= nil print (-1 == -1) && (myobj.nil?) false= nil

  Read the article

• How to write a Python 2.6+ script that does gracefully fail with older pyhton?

  - by Sorin Sbarnea

  I'm using the new print from Python 3.x and I observed that the following code does not compile due to the end=' '. from __future__ import print_function import sys if sys.hexversion < 0x02060000: raise Exception("py too old") ... print("x",end=" ") # fails to compile with py24 How can I continue using the new syntax but make the script fails nicely? Is it mandatory to call another script and use only safe syntax in this one?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

< Previous Page | 166 167 168 169 170 171 172 173 174 175 176 177  | Next Page >