Search Results

Search found 7897 results on 316 pages for 'generate'.

Page 193/316 | < Previous Page | 189 190 191 192 193 194 195 196 197 198 199 200  | Next Page >

  • Image surrounded by text in WPF

    - by niao
    Greetings, I have some control which display bunch of textblocks and image. I would like the image to be surrounded by text. I have already implemented some functionality by using FlowDocument and custom bindable run control. (These controls are included inside user control). When I generate lots of these controls in treeview, application goes into infinite loop. I asked on forums before about this problem and the answer was that it can be WPF issue. Howver when I removed bindable run from my user control, problem dissappeared. Now I am trying to implement other solution where image will be surrounded by text. Can someone please help me? EDIT: Generally i would like to achieve something like this

    Read the article

  • How to reference a specific object in an array of objects using jTemplates

    - by Travis
    I am using the excellent jTemplates plugin to generate content. Given a data object like this... var data = { name: 'datatable', table: [ {id: 1, name: 'Anne'}, {id: 2, name: 'Amelie'}, {id: 3, name: 'Polly'}, {id: 4, name: 'Alice'}, {id: 5, name: 'Martha'} ] }; ..I'm wondering if it is possible to directly specify an object in an array of objects using $T. (I'm hoping there is something like $T.table:3 available) Currently the only way I can think of to access a specific object in an array is to do something like this... {#foreach $T.table as record} {#if $T.record$iteration == 3} This is record 3! Name: {$T.record.name} {#/if} {#/for} However that seems clumsy... Any suggestions? Thanks

    Read the article

  • .NET chart Datamanipulator

    - by peter
    In .NET C#4.0 with the .NET Chart control I have this code to generate a pie chart: chart.Series[0].ChartType = SeriesChartType.Pie; foreach (Order order in orderCollection) { // If I set point.LegendText = order.UserName, .Group will erase it chart.Series[0].Points.AddXY(order.UserName, order.Total); } chart.DataManipulator.Sort(PointSortOrder.Ascending, "X", "Series1"); chart.DataManipulator.Group("SUM", 1, IntervalType.Months, "Series1"); This works well, it generates a pie chart with the top 10 users showing their total order sum. I would like to set the DataPoints' legendtext to the order.UserName property. The problem is, DataManipulator.Group overwrites the series DataPoints. So if I set the legendtext in the foreach loop, they will be erased after the Group call. And after the Group call, I don't see a way to retrieve the correct UserName for a DataPoint to set the legendtext. What is the best approach for this situation?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to store or share live data between PHP Requests?

    - by Devyn
    Hi, I want to start a project for facebook and the application will be like real-time multiplayer chess game. The problem I'm having is I have no idea how to store the data when a player moves one piece and update the new position in player2 browser. I'm gonna use PHP, MySQL for server side and jQuery for Client Rendering. The simplest idea is to store the data in XML or MySQL and re-generate the result to player2 browser. But I know that when thousand of players are playing, it will not be an efficient way. Since I don't have time to study new language for this project, I'm gonna have to stick with PHP. I'm not going to use flash either because I want my client side light-weight and flash-free. So is there any way that will solve my problems?

    Read the article

  • Thread Proc for an instancable class?

    - by user146780
    Basically I have a class and it is instincable (not static). Basically I want the class to be able to generate its own threads and manage its own stuff. I don't want to make a global callback for each instance I make, this doesnt seem clean and proper to me. What is the proper way of doing what I want. If I try to pass the threadproc to CreateThread and it is the proc from a class instance the compiler says I cannot do this. What is the best way of achieving what I want? Thanks

    Read the article

  • How to get link_to in Rails output an SEO friendly url?

    - by Jason
    Hi, My link_to tag is: <%= link_to("My test title",{:controller=>"search", :action=>"for-sale", :id=> listing.id, :title => listing.title, :search_term => search_term}) %> and produces this ugly URL: http://mysite.com/search/for-sale/12345?title=premium+ad+%2B+photo+%5Btest%5D How can I get link_to to generate: http://mysite.com/search/for-sale/listing-title/search-term/12345 Been trying this a few different ways and cannot find much online, really appreciate any help!

    Read the article

  • Future proof Primary Key design in postgresql

    - by John P
    I've always used either auto_generated or Sequences in the past for my primary keys. With the current system I'm working on there is the possibility of having to eventually partition the data which has never been a requirement in the past. Knowing that I may need to partition the data in the future, is there any advantage of using UUIDs for PKs instead of the database's built-in sequences? If so, is there a design pattern that can safely generate relatively short keys (say 6 characters instead of the usual long one e6709870-5cbc-11df-a08a-0800200c9a66)? 36^6 keys per-table is more than sufficient for any table I could imagine. I will be using the keys in URLs so conciseness is important.

    Read the article

  • Annoying struts 2 problem

    - by Parhs
    Hello... I am using this code to include some menus to my code... <s:action namespace="/" name="get_header" executeResult="true" /> <jsp:include page="/get_menu" > <jsp:param name="menuKey" value="configuration"></jsp:param> <jsp:param name="subMenuKey" value="user.add"></jsp:param> </jsp:include> THe problem is that the menus are generated dynamically... So suppose that we have 2 Actions ActionA and get_menu Action The jsp page for the result of ActionA calls get_menu to generate the menus. So suppose that ActionA sets a variable groups and get_menu also uses a groups variable... ActionA's variable will overtake get_menu's variable. I tried many solutions and even jsp:inculde doesnt help:(...

    Read the article

  • git hooks - regenerate a file and add it to each commit ?

    - by egarcia
    I'd like to automatically generate a file and add it to a commit if it has changed. Is it possible, if so, what hooks should I use? Context: I'm programming a CSS library. It has several CSS files, and at the end I want to produce a compacted and minimized version. Right now my workflow is: Modify the css files x.css and y.css git add x.css y.css Execute minimize.sh which parses all the css files on my lib, minimizes them and produces a min.css file git add min.css git commit -m 'modified x and y doing foo and bar' I would like to have steps 3 and 4 done automatically via a git hook. Is that possible? I've never used git hooks before. After reading the man page, I think I need to use the @pre-commit@ hook. But can I invoke git add min.css, or will I break the internet?

    Read the article

  • NHibernate WCF Bidirectional and Lazy loading

    - by ChrisKolenko
    Hi everyone, I'm just looking for some direction when it comes to NHibernate and WCF. At the moment i have a many to one association between a person and address. The first problem. I have to eager load the list of addresses so it doesn't generate a lazy loaded proxy. Is there a way to disable lazy loading completely? I never want to see it generated. The second problem. The bidirectional association between my poco's is killing my standard serialization. What's the best way forward. Should I remove the Thanks for all your help

    Read the article

  • How can I programatically convert SQL data-types to .Net data-types?

    - by Simon
    Can anyone show me a way of converting SQL Server data-types (varchar for example) to .Net data-types (String for example). I'm assuming that automatic conversion is not possible? I have an 'EntityProperty' object and would like it to have an appropriate 'Type' property (string, decimal, int32 etc), at the moment this property is just a string - 'int32' for example. A little background: I'm using SQL DMO in an internal code generation app to query a database and generate a stored procedure based DAL from the database. Being an internal app I can take quite a few shortcuts and make quite a few assumptions. To get the app working at the moment this data-type conversion is handled by a Select Case statement which just converts the types to strings and generates a set of properties based on these strings but I would prefer a little more flexibility in being able to handle the types (use of TypeOf etc). Anyone worked on something similar? I know EF, nHibernate, Subsonic etc could do all this for me but in this case, for various reasons, I am having to roll my own. :)

    Read the article

  • Please suggest some alternative to Drupal

    - by abovesun
    Drupal propose completely different approach in web development (comparing with RoR like frameworks) and it is extremely good from development speed perspective. For example, it is quite easy to clone 90% of stackoverflow functionality using Drupal. But it has several big drawbacks: it is f''cking slow (100-400 requests per page) db structure very complicated, need at least 2 tables for easy content (entity) type, CCK fields very easy generate tons of new db tables anti-object oriented, rather aspect-oriented bad "view" layer implementation, no strange forward layouts and so on. After all this items I can say I like Drupal, but I would like something same, but more elegant and more object oriented. Probably something like http://drupy.net/ - drupal emulation on the top of django. P.S. I wrote this question not for new holy word flame, just write if you know alternative that uses something similar approach.

    Read the article

  • Looping an executable to get the result from Python script

    - by fx
    In my python script, I need to call within a for loop an executable, and waiting for that executable to write the result on the "output.xml". How do I manage to use wait() & how do I know when one of my executable is finished generating the result to get the result? How do I close that process and open a new one to call again the executable and wait for the new result? import subprocess args = ("bin/bar") popen = subprocess.Popen(args) I need to wait for the output from "bin/bar" to generate the "output.xml" and from there, read it's content. for index, result in enumerate(results): myModule.callSubProcess(index) #this is where the problem is. fileOutput = open("output.xml") parseAndStoreInSQLiteFileOutput(index, file)

    Read the article

  • How can I write a file on an ftps-server with PHP?

    - by Daniel
    Hi, I hope someone here could help me, because I couldn't find any solution with Google. What I have to do is to generate a XML-string (that works) an save that directly into a file on an ftps-server. So far, so good... I used the following code with ftp and it works to, but not with ftps. So I either need another options-configuration for the stream or a different way to solve that task. Here my current code: $host = 'ftp.example.com'; $port = 22; $user = 'xxxxxx'; $pass = 'xxxxxx'; $file = 'test_' . time() . '.txt'; $ftpPath = sprintf('ftp://%s:%s@%s:%d/%s', $user, $pass, $host, $port, $file); $context = stream_context_create(array('ftp' = array('overwrite' = true))); file_put_contents($ftpPath, 'test', 0, $context);

    Read the article

  • Best solution for exporting Word documents to PDF programatically (without using a "software printer

    - by mbmccormick
    I'm looking for a way to export a Word document as a PDF. I would like to do this without the use of a "software printer" (such as CutePDF, etc.) and stick to reference assemblies if at all possible. I'm using Microsoft Office Interop Assemblies to generate a Word Document which I save to a temporary directory. So its not necessary for this solution to interact directly with Microsoft Office, unless it needs to. Any help or feedback you might have would be greatly appreciated! Thanks!

    Read the article

  • SharePoint filtered column that only allows item to be used once

    - by Jason
    I have a WSS 3.0 site that I use for change management. There are three primary lists on it -- a bug list, an enhancement list, and a release list. The release list has two lookup columns that provide a list of bugs and enhancements that are included in that particular release. I am trying to figure out how to filter the bug and enhancement list to include only items that have not already been included in another release. All the docs and examples I have seen regarding filtered lookups deal with a query on the list itself. For my situation, and if this was a SQL query, I would need to use a LEFT JOIN to generate the list.

    Read the article

  • Unique element ID to reference later

    - by Hanpan
    I'm trying to figure out a method of storing a unique reference to each tag on a particular page. I won't have any ability to edit the page content and I'll the generated UID to stay the same on every page refresh. Since browsers don't generate any kind of UID for elements, I was thinking that the only method to do this would be to execute a script which walks the DOM and creates a UID for each it comes across. I don't know how accurate this will be, especially considering I'll need to ensure it creates the same UID for the tag each time the script crawls the page. Can anyone think of any other, more accurate ways of mapping a page? Many thanks.

    Read the article

  • draw csv file data as a heatmap using numpy and matplotlib

    - by Schrodinger's Cat
    Hello all, I was able to load my csv file into a numpy array: data = np.genfromtxt('csv_file', dtype=None, delimiter=',') Now I would like to generate a heatmap. I have 19 categories from 11 samples, along these lines: cat,1,2,3... a,0.0,0.2,0.3 b,1.0,0.4,0.2 . . . I wanted to use matplotlib colormesh. but I'm at loss. all the examples I could find used random number arrays. any help and insights would be greatly appreciated. many thanks

    Read the article

  • How to convert a gi-normous integer (in string format) to hex format? (C#)

    - by eviljack
    Given a potentially huge integer value (in c# string format), I want to be able to generate it's hex equivalent. Normal methods don't apply here as we are talking arbitrarily large numbers, 50 digits or more. The techniques I've seen which use a technique like this: // Store integer 182 int decValue = 182; // Convert integer 182 as a hex in a string variable string hexValue = decValue.ToString("X"); // Convert the hex string back to the number int decAgain = int.Parse(hexValue, System.Globalization.NumberStyles.HexNumber); won't work because the integer to convert is too large. For example I need to be able to convert a string like this: 843370923007003347112437570992242323 to it's hex equivalent. these don't work: http://stackoverflow.com/questions/1139957/c-convert-int-to-hex-and-back-again http://stackoverflow.com/questions/74148/how-to-convert-numbers-between-hex-and-decimal-in-c

    Read the article

  • Best way to implement keywords for image upload gallery

    - by Dan Berlyoung
    I'm starting to spec out an image gallery type system similar to Facebook's. Members of the site will be able to create image galleries and upload images for others to view. Images will have keywords the the uploader can specify. Here's the question, what's the best way to model this? With image and keyword tables linked vi a HABTM relation? Or a single image table with the keywords saved as comma delimited values in a text field in the image record? Then search them using a LIKE or FULL TEXT index function? I want to be able to pull up all images containing a given keyword as well as generate a keyword cloud. I'm leaning toward the HABTM setup but I wanted to see what everyone else though. Thanks!!

    Read the article

  • RDF Usage Rates for Syndication

    - by David in Dakota
    Is RDF still used widely for content syndication? Specifically, I know only of Slashdot as a large scale website syndicating content in that format (say versus RSS). Understandably this might seem vague to answer so more specifically: Can anyone list any larger sites similar in scale to Amazon or CNN using it? Any web based publishing platforms (Wordpress, Joomla, etc...) that generate syndication feeds with this xml vocabulary. Any other more quantifiable evidence that it is used for syndication online. I understand that RDF may be a parent specification but in this case I'm talking about sites that syndicate content using <rdf as a root element and heavily leveraging elements from the RDF namespace: http://www.w3.org/1999/02/22-rdf-syntax-ns#

    Read the article

  • MVC3 Razor DropDownListFor Enums

    - by jordan.baucke
    Trying to get my project updated to MVC3, something I just can't find: I have a simple datatype of ENUMS: public enum States() { AL,AK,AZ,...WY } Which I want to use as a DropDown/SelectList in my view of a model that contains this datatype: public class FormModel() { public States State {get; set;} } Pretty straight forward: when I go to use the auto-generate view for this partial class, it ignores this type. I need a simple select list that sets the value of the enum as the selected item when I hit submit and process via my AJAX - JSON POST Method. And than the view (???!): <div class="editor-field"> @Html.DropDownListFor(model => model.State, model => model.States) </div> thanks in advance for the advice!

    Read the article

  • Simple ADO.NET C# Stored Procedure Generator

    - by Ron
    I am using Visual Studio 2005, Sql Server 2005, C#, ADO.NET. We have a very large database and routinely adding new stored procedures. I am tired of writing the C# wrapper code for these stored procedures, seems like there should be some simple utility or Add In that would allow me to simply point to a stored procedure and generate some generic C# code. I am not looking for some big ORM or data access layer framework. The company I am doing this for is not interested in moving to something like that right now. Just wanting something to take the grunt work out of writing the C# wrappers around stored procedures. Again, prefer that we do not have to include in other 3rd party libraries, etc. Any ideas?

    Read the article

  • Adding ivars to NSManagedObject subclass

    - by The Crazy Chimp
    When I create an entity using core data then generate a subclass of NSManagedObject from it I get the following output (in the .h): @class Foo; @interface Foo : NSManagedObject @property (nonatomic, retain) NSString *name; @property (nonatomic, retain) NSSet *otherValues; @end However, in my .m file I want to make use of the name and otherValues values. Normally I would simply create a couple of ivars and then add the properties for them as I required. That way I can access them in my .m file easily. In this situation would it be acceptable to do this? Would adding ivars to the .h (for name and otherValues) cause any unusual behaviour in the persistance & retrieval of objects?

    Read the article

< Previous Page | 189 190 191 192 193 194 195 196 197 198 199 200  | Next Page >