Search Results

Search found 7897 results on 316 pages for 'generate'.

Page 195/316 | < Previous Page | 191 192 193 194 195 196 197 198 199 200 201 202  | Next Page >

• MVC Implementation PHP Zend PDF generation

  - by zod

  Am using Zend framework and PHP Am going to generate a PDF using Zend . So the View is PDF.There is no PHTML. But if i dont use PHTML in view , is it a perfect MVC? if i want to be a perfect MVC shall i do the db retrieval and variable declaration and assigning in controller and use view and use all pdf functions in view phtml file will it make a perfect MVC? What is the advantage of MVC in this case? :-) can i do the include of zend pdf in phtml file or controller php file? what is the difference ?

  Read the article

• NHibernate WCF Bidirectional and Lazy loading

  - by ChrisKolenko

  Hi everyone, I'm just looking for some direction when it comes to NHibernate and WCF. At the moment i have a many to one association between a person and address. The first problem. I have to eager load the list of addresses so it doesn't generate a lazy loaded proxy. Is there a way to disable lazy loading completely? I never want to see it generated. The second problem. The bidirectional association between my poco's is killing my standard serialization. What's the best way forward. Should I remove the Thanks for all your help

  Read the article

• Math with interpolated variables?

  - by Idan Gazit

  Consider the following sass: $font-size: 18; $em: $font-size; $column: $font-size * 3; // The column-width of my grid in pixels $gutter: $font-size * 1; // The gutter-width of my grid in pixels $gutter-em: #{$gutter / $em}em; // The gutter-width in ems. $column-em: #{$column / $em}em; // The column-width in ems; $foo = $gutter-em / 2; // This results in a value like "1em/2". :( $bar = ($gutter-em / 2); // this doesn't work either, same as above. How can I generate a $foo that works, and that I can reuse further in other expressions?

  Read the article

• Creating combinations that have no more one intersecting element

  - by khuss

  I am looking to create a special type of combination in which no two sets have more than one intersecting element. Let me explain with an example: Let us say we have 9 letter set that contains A, B, C, D, E, F, G, H, and I If you create the standard non-repeating combinations of three letters you will have 9C3 sets. These will contain sets like ABC, ABD, BCD, etc. I am looking to create sets that have at the most only 1 common letter. So in this example, we will get following sets: ABC, ADG, AEI, AFH, BEH, BFG, BDI, CFI, CDH, CEG, DEF, and GHI - note that if you take any two sets there are no more than 1 repeating letter. What would be a good way to generate such sets? It should be scalable solution so that I can do it for a set of 1000 letters, with sub set size of 4. Any help is highly appreciated. Thanks

  Read the article

• md5hash performance with big files for check copy files in shared folder

  - by alhambraeidos

  Hi all, My app Windows forms .NET in Win XP copy files pdfs in shared network folder in a server win 2003. Admin user in Win2003 detects some corrupt files pdfs, in that shared folder. I want check if a fileis copied right in shared folder Andre Krijen says me the best way is to create a MD5Hash of original file. When the file is copied, verify the MD5Hash file of the copied one with the original one. I have big pdf files. apply md5 hash about big file, any performance problem ?? If I only check (without generate md5 hash) Length of files (original and copied) ?? Thanks in advanced.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• tcpdf - HTML table showing up way too small

  - by LinuxGnut

  Hi folks. I'm using tcpdf (http://www.tcpdf.org/) to generate PDFs of some tables and images. The images are loaded without an issue, but I'm having issues with the writeHTML() function. I can't seem to control the font sizes or table width/height through the HTML, so I end up with a tiny, tiny, tiny table that you have to print of and squint at to even attempt reading. I've tried editing the table itself, CSS, even putting the table itself inside an h1, but nothing is changing the font size. I have the font size in tcpdf set to 16, but this also has no affect. Has anyone else run into this issue?

  Read the article

• How can I calculate data for a boxplot (quartiles, median) in a Rails app on Heroku? (Heroku uses Po

  - by hadees

  I'm trying to calculate the data needed to generate a box plot which means I need to figure out the 1st and 3rd Quartiles along with the median. I have found some solutions for doing it in Postgresql however they seem to depend on either PL/Python or PL/R which it seems like Heroku does not have either enabled for their postgresql databases. In fact I ran "select lanname from pg_language;" and only got back "internal". I also found some code to do it in pure ruby but that seems somewhat inefficient to me. I'm rather new to Box Plots, Postgresql, and Ruby on Rails so I'm open to suggestions on how I should handle this. There is a possibility to have a lot of data which is why I'm concerned with performance however if the solution ends up being too complex I may just do it in ruby and if my application gets big enough to warrant it get my own Postgresql I can host somewhere else. *note: since I was only able to post one link, cause I'm new, I decided to share a pastie with some relevant information

  Read the article

• Override transparency color when converting transparent PNG to JPG

  - by Alexander Malfait

  I'm using Dragonfly to generate thumbnail images in a Rails app. I'm serving all picture images as JPG's. Now the client is uploading transparent PNG files, like this one: http://www.ibanez.co.jp/products/images/eg2010/ART120_TRF_12_02.png Dragonfly uses RMagick to convert these images to JPG. The problem is that it converts the PNG images to JPG with a black background, and my site's design requires a white background. I've tried to override it like this: encoded_image = Magick::Image.from_blob(image.data).first if encoded_image.format.downcase == format image # do nothing else encoded_image.format = format encoded_image.background_color = "white" encoded_image.transparent_color = "white" encoded_image.to_blob end But the produced JPG images still contain a black background. Does anyone know how to beat RMagick into using a white background when converting the transparent layer? I know I could just serve as PNG, but then the images are 10 times as large, and the site is already pretty bandwidth heavy.

  Read the article

• How can I get JavaDoc into a JunitReport?

  - by benklaasen

  Hi - I'm a tester, with some Java and plenty of bash coding experience. My team is building an automated functional test harness using JUnit 4 and ant. Testers write automated tests in Java and use JavaDoc to document these tests. We're using ant's JunitReport task to generate our test result reports. This works superbly for reporting. What we're missing, however, is a way to combine those JavaDoc free-text descriptions of what the test does along with the JunitReport results. My question is, what's involved to get the JavaDoc into the JunitReport output? I'd like to be able to inject the JavaDoc for a given test method into the JunitReport at the level of each method result. regards Ben

  Read the article

• Generating code for service proxies

  - by Hadi Eskandari

  I'm trying to generate some additional code base on the auto-generated webservice proxies in my VS2010 solution, I'm using a T4 template to do so. The problem is, automatically generated proxies are added in "Service Reference" folder but ProjectItems (files) are hidden by default and the following code does not find them in the project structure: var sr = GetProjectItem(project, "Service References"); if(sr != null) { foreach(ProjectItem item in sr.ProjectItems) { foreach(var file in item.ProjectItems) { //Services.Add(new ServiceInfo { Name = file.Name }); } } } The above code runs and although service reference is found, and there are ProjectItems under that node (named by the webservice reference name), under object under that node is of type System.__ComObject and I'm not sure how to progress. Any help is appreciated.

  Read the article

• Qt QTextEdit Qt4.2 Valid HTML String

  - by Matthew Hoggan

  I am trying to generate the correct HTML to render to a QTextEdit Using Qt 4.2 on RHEL 5.3. So far my algorithm generates the following html. I am not an expert web developer, but to me this string seems valid. 319:14:27:22: <font color="rgb(255,0,0)" bgcolor="rgb(255,0,0)">Message</font><br> What needs to change to get the colours to render. Currently it just renders as black text on a white background.

  Read the article

• SQL Server 2008 - Script Data as Insert Statements from SSIS Package

  - by Brandon King

  SQL Server 2008 provides the ability to script data as Insert statements using the Generate Scripts option in Management Studio. Is it possible to access the same functionality from within a SSIS package? Here's what I'm trying to accomplish... I have a scheduled job that nightly scripts out all the schema and data for a SQL Server 2008 database and then uses the script to create a "mirror copy" SQLCE 3.5 database. I've been using Narayana Vyas Kondreddi's sp_generate_inserts stored procedure to accomplish this, but it has problems with some datatypes and greater-than-4K columns (holdovers from SQL Server 2000 days). The Script Data function looks like it could solve my problems, if only I could automate it. Any suggestions?

  Read the article

• Mac-native text editor that can syntax-highlight diff files?

  - by strawtarget

  I do something like "svn diff /mystuff/current.diff". I want to view this .diff file with syntax highlighting. jEdit does it, but it's a huge beast and it takes a while to start up. I want something lightweight/native. Smultron/Fraise, TextWrangler, TextEdit, Dashcode don't seem to highlight .diff files. FileMerge seems to want to generate diff files, not show you existing ones. TextMate does the trick, but it's not free. I'd feel happier dropping $50 US if I was going to take advantage of it for anything more than a diff viewer. Are there any alternatives to jEdit or TextMate that I should consider?

  Read the article

• gethostbyname in C

  - by Matic

  I don't know how to write applications in C, but I need a tiny program that does: lh = gethostbyname("localhost"); output = lh->h_name; output variable is to be printed. The above code is used in PHP MongoDB database driver to get the hostname of the computer (hostname is part of an input to generate an unique ID). I'm skeptical that this will return the hostname, so I'd like some proof. Any code examples would be most helpful. Happy day, Matic

  Read the article

• [Java] Implement a RSA algorithm

  - by Robin Monjo

  Hello everyone. I want to implement a RSA algorithm to encrypt an image (byte[]). To generate my two keys I used this piece of code : KeyPairGenerator keygen = KeyPairGenerator.getInstance("RSA"); keygen.initialize(512); keyPair = keygen.generateKeyPair(); Once public and private key are generated, I would like to show them to the user so he can distribute the public key and use the private key to decode. How can I get back those key ? Using keygen.getPrivateKey() and keygen.getPublicKey() give me all the information of the RSA algorithm, not only the keys I need. Thanks

  Read the article

• DocProject vs Sandcastle Help File Builder GUI

  - by Nathan

  I have several C# projects along with some internal library components that I'm trying to document together. Sandcastle seems to be the place to go to generate documentation from C#. I would like to know which of the two, DocProject or Sandcastle Help File Builder GUI is better and supports the features I need. I would like to compile only each projects own part of the document and then have it all integrated together in the end. (i.e. the library components in one documentation project and each project in it's own documentation project, then all of the above in a single root using the Help 2 viewer)

  Read the article

• R: Using sapply on vector of POSIXct

  - by Chris

  I have what may be a very simple question. I want to process a column of POSIXct objects from a dataframe and generate a vector of datetime strings. I tried to use the following sapply call dt <- sapply(df$datetime, function(x) format(x,"%Y-%m-%dT%H:%M:%S")) but to no avail. I keep getting the following error Error in prettyNum(.Internal(format(x, trim, digits, nsmall, width, 3L, : invalid 'trim' argument When I apply this function to a single POSIXct object from the column, I have no problem. So I'm stumped at the moment about what the problem is. Do I need to do something special with POSIXct objects?

  Read the article

• MVC3 Razor DropDownListFor Enums

  - by jordan.baucke

  Trying to get my project updated to MVC3, something I just can't find: I have a simple datatype of ENUMS: public enum States() { AL,AK,AZ,...WY } Which I want to use as a DropDown/SelectList in my view of a model that contains this datatype: public class FormModel() { public States State {get; set;} } Pretty straight forward: when I go to use the auto-generate view for this partial class, it ignores this type. I need a simple select list that sets the value of the enum as the selected item when I hit submit and process via my AJAX - JSON POST Method. And than the view (???!): <div class="editor-field"> @Html.DropDownListFor(model => model.State, model => model.States) </div> thanks in advance for the advice!

  Read the article

• Sandcastle setup - Navigation to webpage was canceled.

  - by Prof Plum

  I am try to use Sandcastle Help File Builder, but can't quite get it to work. Here is what I have done: 1) installed the program; works like normal 2) enabled xml in the project I want documentation for that gets generated in the /bin 3) created a new sandcastle help file project 4) added the C# project as (its a WCF service in case that matters) a documentation service 5) ran the "build" to generate the help file 6) went to "documentation"/"view help file"/"view help file" in the GUI 7) The file opens and contains the appopriate "folders", but every page says "Navigation to the webpage was canceled" I have seen the xml file in the /bin and it contains all of my /// comments, so why are they not showing up in the help file? Any ideas?

  Read the article

• Random Number on SQL without using NewID()

  - by Angel Escobedo

  Hello I want to generate a Unique Random number with out using the follow statement : Convert(int, (CHECKSUM(NEWID()))*100000) AS [ITEM] Cause when I use joins clauses on "from" it generates double registers by using NEWID() Im using SQL Server 2000 *PD : When I use Rand() it probably repeat on probability 1 of 100000000 but this is so criticall so it have to be 0% of probability to repeat a random value generated My Query with NewID() and result on SELECT statement is duplicated (x2) My QUery without NewID() and using Rand() on SELECT statement is single (x1) but the probability of repeat the random value generated is uncertainly but exists! Thanks!

  Read the article

• Replication - User defined table type not propogating to subscriber

  - by Aamod Thakur

  I created a User defined table type named tvp_Shipment with two columns (id and name) . generated a snapshot and the User defined table type was properly propogated to all the subscribers. I was using this tvp in a stored procedure and everything worked fine. Then I wanted to add one more column created_date to this table valued parameter.I dropped the stored procedure (from replication too) and also i dropped and recreated the User defined table type with 3 columns and then recreated the stored procedure and enabled it for publication When i generate a new snapshot, the changes in user defined table type are not propogated to the subscriber. The newly added column was not added to the subscription. the Error messages: The schema script 'usp_InsertAirSa95c0e23_218.sch' could not be propagated to the subscriber. (Source: MSSQL_REPL, Error number: MSSQL_REPL-2147201001) Get help: http://help/MSSQL_REPL-2147201001 Invalid column name 'created_date'. (Source: MSSQLServer, Error number: 207) Get help: http://help/207

  Read the article

• Linux, how to capture screen, and simulate mouse movements.

  - by 2di

  Hi All I need to capture screen (as print screen) in the way so I can access pixel color data, to do some image recognition, after that I will need to generate mouse events on the screen such as left click, drag and drop (moving mouse while button is pressed, and then release it). Once its done, image will be deleted. Note: I need to capture whole screen everything that user can see, and I need to simulate clicks outside window of my program (if it makes any difference) Spec: Linux ubuntu Language: C++ Performance is not very important,"print screen" function will be executed once every ~10 sec. Duration of the process can be up to 24 hours so method needs to be stable and memory leaks free (as usuall :) I was able to do in windows with win GDI and some windows events, but I'ev no idea how to do it in Linux. Thanks a lot

  Read the article

• Mapping java.util.Date to xs:date instead of xs:dateTime in JAX-WS

  - by Larsing

  Hi all, We hav an EJB, jws-anotated as a web service. It has a pretty complex pojo-model that generates an equally complex xsd. The pojos contain numerous java.util.Date. These all map to xs:dateTime. This service is used as "business service" in Oracle(BEA) OSB(AquaLogic). We also have a "proxy service" which we map to the BS with XQuery (the OSB/AquaLogic way). The proxy service's xsd has xs:date for the corresponding fields. For some reason, Oracle's implementation of XQuery does not support casting from xs:date to xs:dateTime(!). I could solve this by casting to xs:string and concat:ing with "T00:00:00", however, i would rather try to get JAX-WS to generate an xsd with xs:date instead. Only, I can't find any info on how to do this (anotations?). Can anyone give me a hint? Kind regards, Lars

  Read the article

• How do I customise date/time bindings using JAXWS and APT?

  - by Jordan Digby

  Im using JAXWS 2.1.7, using some classes to run through JAXWS's 'apt' to generate the WSDL. For dates, I use @XmlSchemaType(name="time") private Date wakeupTime; and this generates a schema with xs:time, but when this all comes out in XML, the value is something like <wakeupTime>1901-01-01T01:00:00 +10</wakeupTime> I want JUST the time portion to come! I think I want to use a custom converter to say that xs:time + java.util.Date should be printed and parsed in such-and-sucha manner, but I cant see that I can pass a bindings file to the apt routine. I can't (for historical & other reasons) use XMLGregorianCalendar - it has to be a java.util.Date. How do I specify a custom binding for the apt tool in jaxb

  Read the article

< Previous Page | 191 192 193 194 195 196 197 198 199 200 201 202  | Next Page >