Search Results

Search found 7897 results on 316 pages for 'generate'.

Page 195/316 | < Previous Page | 191 192 193 194 195 196 197 198 199 200 201 202  | Next Page >

  • Are TestContext.Properties read only ?

    - by DBJDBJ
    Using Visual Studio generate Test Unit class. Then comment out class initialization method. Inside it add your property, using the testContext argument. //Use ClassInitialize to run code before running the first test in the class [ClassInitialize()] public static void MyClassInitialize(TestContext testContext) { /* * Any user defined testContext.Properties * added here will be erased upon this method exit */ testContext.Properties.Add("key", 1 ) ; // above works but is lost } After leaving MyClassInitialize, properties defined by user are lost. Only the 10 "official" ones are left. This effectively means TestContext.Properties is read only, for users. Which is not clearly documented in MSDN. Please discuss. --DBJ

    Read the article

  • DocProject vs Sandcastle Help File Builder GUI

    - by Nathan
    I have several C# projects along with some internal library components that I'm trying to document together. Sandcastle seems to be the place to go to generate documentation from C#. I would like to know which of the two, DocProject or Sandcastle Help File Builder GUI is better and supports the features I need. I would like to compile only each projects own part of the document and then have it all integrated together in the end. (i.e. the library components in one documentation project and each project in it's own documentation project, then all of the above in a single root using the Help 2 viewer)

    Read the article

  • MVC3 Razor DropDownListFor Enums

    - by jordan.baucke
    Trying to get my project updated to MVC3, something I just can't find: I have a simple datatype of ENUMS: public enum States() { AL,AK,AZ,...WY } Which I want to use as a DropDown/SelectList in my view of a model that contains this datatype: public class FormModel() { public States State {get; set;} } Pretty straight forward: when I go to use the auto-generate view for this partial class, it ignores this type. I need a simple select list that sets the value of the enum as the selected item when I hit submit and process via my AJAX - JSON POST Method. And than the view (???!): <div class="editor-field"> @Html.DropDownListFor(model => model.State, model => model.States) </div> thanks in advance for the advice!

    Read the article

  • Future proof Primary Key design in postgresql

    - by John P
    I've always used either auto_generated or Sequences in the past for my primary keys. With the current system I'm working on there is the possibility of having to eventually partition the data which has never been a requirement in the past. Knowing that I may need to partition the data in the future, is there any advantage of using UUIDs for PKs instead of the database's built-in sequences? If so, is there a design pattern that can safely generate relatively short keys (say 6 characters instead of the usual long one e6709870-5cbc-11df-a08a-0800200c9a66)? 36^6 keys per-table is more than sufficient for any table I could imagine. I will be using the keys in URLs so conciseness is important.

    Read the article

  • How to delete data in DB efficiently using LinQ to NHibernate (one-shot-delete)

    - by kastanf
    Hello, producing software for customers, mostly using MS SQL but some Oracle, a decision was made to plunge into Nhibernate (and C#). The task is to delete efficiently e.g. 10 000 rows from 100 000 and still stay sticked to ORM. I've tried named queries - link already, IQuery sql = s.GetNamedQuery("native-delete-car").SetString(0, "Kirsten"); sql.ExecuteUpdate(); but the best I have ever found seems to be: using (ITransaction tx = _session.BeginTransaction()) { try { string cmd = "delete from Customer where Id < GetSomeId()"; var count = _session.CreateSQLQuery(cmd).ExecuteUpdate(); ... Since it may not get into dB to get all complete rows before deleting them. My questions are: If there is a better way for this kind of delete. If there is a possibility to get the Where condition for Delete like this: Having a select statement (using LinQ to NHibernate) = which will generate appropriate SQL for DB = we get that Where condition and use it for Delete. Thanks :-)

    Read the article

  • What algorithm can calculate the power set of a given set?

    - by ross
    I would like to efficiently generate a unique list of combinations of numbers based on a starting list of numbers. example start list = [1,2,3,4,5] but the algorithm should work for [1,2,3...n] result = [1],[2],[3],[4],[5] [1,2],[1,3],[1,4],[1,5] [1,2,3],[1,2,4],[1,2,5] [1,3,4],[1,3,5],[1,4,5] [2,3],[2,4],[2,5] [2,3,4],[2,3,5] [3,4],[3,5] [3,4,5] [4,5] Note. I don't want duplicate combinations, although I could live with them, eg in the above example I don't really need the combination [1,3,2] because it already present as [1,2,3]

    Read the article

  • gethostbyname in C

    - by Matic
    I don't know how to write applications in C, but I need a tiny program that does: lh = gethostbyname("localhost"); output = lh->h_name; output variable is to be printed. The above code is used in PHP MongoDB database driver to get the hostname of the computer (hostname is part of an input to generate an unique ID). I'm skeptical that this will return the hostname, so I'd like some proof. Any code examples would be most helpful. Happy day, Matic

    Read the article

  • Web-based document merge solution?

    - by rugcutter
    We are looking for a web-based document merge solution. Our application is a web-based project management tool built using Xataface - PHP on Windows IIS + mySQL. We have a function that allows the user to generate a status report in Microsoft Word format based on data in the tool. Currently this function is implemented using LiveDocX. We have a status report template, and LiveDocX performs the merge into the template using data from our project management tool. The main drawback is LiveDocx is web-service based. We are looking to replace LiveDocX in order to reduce our dependence on the up-time of a third-party web-service that we cannot control. Does anyone have any suggestions on a web based document merge solution that I can install on my IIS or PHP based server?

    Read the article

  • Qt QTextEdit Qt4.2 Valid HTML String

    - by Matthew Hoggan
    I am trying to generate the correct HTML to render to a QTextEdit Using Qt 4.2 on RHEL 5.3. So far my algorithm generates the following html. I am not an expert web developer, but to me this string seems valid. 319:14:27:22: <font color="rgb(255,0,0)" bgcolor="rgb(255,0,0)">Message</font><br> What needs to change to get the colours to render. Currently it just renders as black text on a white background.

    Read the article

  • How can I get JavaDoc into a JunitReport?

    - by benklaasen
    Hi - I'm a tester, with some Java and plenty of bash coding experience. My team is building an automated functional test harness using JUnit 4 and ant. Testers write automated tests in Java and use JavaDoc to document these tests. We're using ant's JunitReport task to generate our test result reports. This works superbly for reporting. What we're missing, however, is a way to combine those JavaDoc free-text descriptions of what the test does along with the JunitReport results. My question is, what's involved to get the JavaDoc into the JunitReport output? I'd like to be able to inject the JavaDoc for a given test method into the JunitReport at the level of each method result. regards Ben

    Read the article

  • R: Using sapply on vector of POSIXct

    - by Chris
    I have what may be a very simple question. I want to process a column of POSIXct objects from a dataframe and generate a vector of datetime strings. I tried to use the following sapply call dt <- sapply(df$datetime, function(x) format(x,"%Y-%m-%dT%H:%M:%S")) but to no avail. I keep getting the following error Error in prettyNum(.Internal(format(x, trim, digits, nsmall, width, 3L, : invalid 'trim' argument When I apply this function to a single POSIXct object from the column, I have no problem. So I'm stumped at the moment about what the problem is. Do I need to do something special with POSIXct objects?

    Read the article

  • Creating combinations that have no more one intersecting element

    - by khuss
    I am looking to create a special type of combination in which no two sets have more than one intersecting element. Let me explain with an example: Let us say we have 9 letter set that contains A, B, C, D, E, F, G, H, and I If you create the standard non-repeating combinations of three letters you will have 9C3 sets. These will contain sets like ABC, ABD, BCD, etc. I am looking to create sets that have at the most only 1 common letter. So in this example, we will get following sets: ABC, ADG, AEI, AFH, BEH, BFG, BDI, CFI, CDH, CEG, DEF, and GHI - note that if you take any two sets there are no more than 1 repeating letter. What would be a good way to generate such sets? It should be scalable solution so that I can do it for a set of 1000 letters, with sub set size of 4. Any help is highly appreciated. Thanks

    Read the article

  • Override transparency color when converting transparent PNG to JPG

    - by Alexander Malfait
    I'm using Dragonfly to generate thumbnail images in a Rails app. I'm serving all picture images as JPG's. Now the client is uploading transparent PNG files, like this one: http://www.ibanez.co.jp/products/images/eg2010/ART120_TRF_12_02.png Dragonfly uses RMagick to convert these images to JPG. The problem is that it converts the PNG images to JPG with a black background, and my site's design requires a white background. I've tried to override it like this: encoded_image = Magick::Image.from_blob(image.data).first if encoded_image.format.downcase == format image # do nothing else encoded_image.format = format encoded_image.background_color = "white" encoded_image.transparent_color = "white" encoded_image.to_blob end But the produced JPG images still contain a black background. Does anyone know how to beat RMagick into using a white background when converting the transparent layer? I know I could just serve as PNG, but then the images are 10 times as large, and the site is already pretty bandwidth heavy.

    Read the article

  • SQL Server 2008 - Script Data as Insert Statements from SSIS Package

    - by Brandon King
    SQL Server 2008 provides the ability to script data as Insert statements using the Generate Scripts option in Management Studio. Is it possible to access the same functionality from within a SSIS package? Here's what I'm trying to accomplish... I have a scheduled job that nightly scripts out all the schema and data for a SQL Server 2008 database and then uses the script to create a "mirror copy" SQLCE 3.5 database. I've been using Narayana Vyas Kondreddi's sp_generate_inserts stored procedure to accomplish this, but it has problems with some datatypes and greater-than-4K columns (holdovers from SQL Server 2000 days). The Script Data function looks like it could solve my problems, if only I could automate it. Any suggestions?

    Read the article

  • Linux, how to capture screen, and simulate mouse movements.

    - by 2di
    Hi All I need to capture screen (as print screen) in the way so I can access pixel color data, to do some image recognition, after that I will need to generate mouse events on the screen such as left click, drag and drop (moving mouse while button is pressed, and then release it). Once its done, image will be deleted. Note: I need to capture whole screen everything that user can see, and I need to simulate clicks outside window of my program (if it makes any difference) Spec: Linux ubuntu Language: C++ Performance is not very important,"print screen" function will be executed once every ~10 sec. Duration of the process can be up to 24 hours so method needs to be stable and memory leaks free (as usuall :) I was able to do in windows with win GDI and some windows events, but I'ev no idea how to do it in Linux. Thanks a lot

    Read the article

  • Nested form using accepts_nested_attributes_for with pre-population from another table

    - by mikeydelamonde
    I'm using Rails 2.3.5 and have a nested structure as follows: Lists has_many Items Items_Features has_many Features Items_Features has_many Items Items_Features has a text field to hold the value of the feature Then I have a nested form with partials to update and display this so that it updates Lists, Items and Items_Features What I want to do is generate input fields for each of the rows in features so that the user can fill in a value and it gets inserted/updated in items_features. I also want a label next to the box to display the feature name. It might look like this: List name: Cheeses Item1 name: Edam Feature, hardness: - fill in - <= this list of features from feature table Feature, smell: - fill in - How can I interrupt the nice and easy accepts_nested_attributes_for system to display this as I want?

    Read the article

  • tcpdf - HTML table showing up way too small

    - by LinuxGnut
    Hi folks. I'm using tcpdf (http://www.tcpdf.org/) to generate PDFs of some tables and images. The images are loaded without an issue, but I'm having issues with the writeHTML() function. I can't seem to control the font sizes or table width/height through the HTML, so I end up with a tiny, tiny, tiny table that you have to print of and squint at to even attempt reading. I've tried editing the table itself, CSS, even putting the table itself inside an h1, but nothing is changing the font size. I have the font size in tcpdf set to 16, but this also has no affect. Has anyone else run into this issue?

    Read the article

  • Looping an executable to get the result from Python script

    - by fx
    In my python script, I need to call within a for loop an executable, and waiting for that executable to write the result on the "output.xml". How do I manage to use wait() & how do I know when one of my executable is finished generating the result to get the result? How do I close that process and open a new one to call again the executable and wait for the new result? import subprocess args = ("bin/bar") popen = subprocess.Popen(args) I need to wait for the output from "bin/bar" to generate the "output.xml" and from there, read it's content. for index, result in enumerate(results): myModule.callSubProcess(index) #this is where the problem is. fileOutput = open("output.xml") parseAndStoreInSQLiteFileOutput(index, file)

    Read the article

  • dvi generation: no bounding box

    - by Akshey
    Hi, I wrote a research paper in latex and generated pdf using kile. It worked perfectly well. Now conference people are asking for dvi file also. But Kile's quick build process does not give a dvi file, but its 'Latex' compile process does. So I tried to compile the document, and it gave errors for includegraphics saying figure not found. When I append the correct extensions to the image names, that errors stopped coming but new errors came "bounding box is missing". I added bounding box values and now DVI file is being generated. My questions are: I have tried giving very high and low bounding box values but there is no deformation in the PDF. Why? Can I generate a DVI without giving bounding box values? Thanks and regards, Akshey

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • MVC Implementation PHP Zend PDF generation

    - by zod
    Am using Zend framework and PHP Am going to generate a PDF using Zend . So the View is PDF.There is no PHTML. But if i dont use PHTML in view , is it a perfect MVC? if i want to be a perfect MVC shall i do the db retrieval and variable declaration and assigning in controller and use view and use all pdf functions in view phtml file will it make a perfect MVC? What is the advantage of MVC in this case? :-) can i do the include of zend pdf in phtml file or controller php file? what is the difference ?

    Read the article

  • Sandcastle setup - Navigation to webpage was canceled.

    - by Prof Plum
    I am try to use Sandcastle Help File Builder, but can't quite get it to work. Here is what I have done: 1) installed the program; works like normal 2) enabled xml in the project I want documentation for that gets generated in the /bin 3) created a new sandcastle help file project 4) added the C# project as (its a WCF service in case that matters) a documentation service 5) ran the "build" to generate the help file 6) went to "documentation"/"view help file"/"view help file" in the GUI 7) The file opens and contains the appopriate "folders", but every page says "Navigation to the webpage was canceled" I have seen the xml file in the /bin and it contains all of my /// comments, so why are they not showing up in the help file? Any ideas?

    Read the article

  • [Sql-Server]what data type to use for password salt and hash values and what length?

    - by Pandiya Chendur
    I am generating salt and hash values from my passwords by using, string salt = CreateSalt(TxtPassword.Text.Length); string hash = CreatePasswordHash(TxtPassword.Text, salt); private static string CreateSalt(int size) { //Generate a cryptographic random number. RNGCryptoServiceProvider rng = new RNGCryptoServiceProvider(); byte[] buff = new byte[size]; rng.GetBytes(buff); // Return a Base64 string representation of the random number. return Convert.ToBase64String(buff); } private static string CreatePasswordHash(string pwd, string salt) { string saltAndPwd = String.Concat(pwd, salt); string hashedPwd = FormsAuthentication.HashPasswordForStoringInConfigFile( saltAndPwd, "sha1"); return hashedPwd; } What datatype you would suggest for storing these values in sql server? Any suggestion... Salt:9GsPWpFD Hash:E778AF0DC5F2953A00B35B35D80F6262CDBB8567

    Read the article

  • Mac-native text editor that can syntax-highlight diff files?

    - by strawtarget
    I do something like "svn diff /mystuff/current.diff". I want to view this .diff file with syntax highlighting. jEdit does it, but it's a huge beast and it takes a while to start up. I want something lightweight/native. Smultron/Fraise, TextWrangler, TextEdit, Dashcode don't seem to highlight .diff files. FileMerge seems to want to generate diff files, not show you existing ones. TextMate does the trick, but it's not free. I'd feel happier dropping $50 US if I was going to take advantage of it for anything more than a diff viewer. Are there any alternatives to jEdit or TextMate that I should consider?

    Read the article

  • Why doesn't GCC produce a warning when assigning a signed literal to an unsigned type?

    - by maerics
    Several questions on this website reveal pitfalls when mixing signed and unsigned types and most compilers seem to do a good job about generating warnings of this type. However, GCC doesn't seem to care when assigning a signed constant to an unsigned type! Consider the following program: /* foo.c */ #include <stdio.h> int main(void) { unsigned int x=20, y=-30; if (x > y) { printf("%d > %d\n", x, y); } else { printf("%d <= %d\n", x, y); } return 0; } Compilation with GCC 4.2.1 as below produces no output on the console: gcc -Werror -Wall -Wextra -pedantic foo.c -o foo The resulting executable generates the following output: $ ./foo 20 <= -30 Is there some reason that GCC doesn't generate any warning or error message when assigning the signed value -30 to the unsigned integer variable y?

    Read the article

< Previous Page | 191 192 193 194 195 196 197 198 199 200 201 202  | Next Page >