Search Results

Search found 7897 results on 316 pages for 'generate'.

Page 191/316 | < Previous Page | 187 188 189 190 191 192 193 194 195 196 197 198  | Next Page >

  • XSD file, where to get xmlns argument?

    - by Daok
    <?xml version="1.0" encoding="utf-8"?> <xs:schema id="abc" targetNamespace="http://schemas.businessNameHere.com/SoftwareNameHere" elementFormDefault="qualified" xmlns="http://schemas.businessNameHere.com/SoftwareNameHere" xmlns:mstns="http://schemas.businessNameHere.com/SoftwareNameHere" xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:element name="..." type="..." /> <xs:complexType name="..."> I am working on a project using XSD to generate .cs file. My question is concerning the string "http://schemas.businessNameHere.com/SoftwareNameHere" If I change it, it doesn't work. But the http:// is not a valid one... what is the logic behind and where can I can information about what to put there or how to change it?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Generating Graph with 2 Y Values from Text File

    - by Joey jie
    Hi all, I have remade my original post as it was terribly formatted. Basically I would like some advice / tips on how to generate a line graph with 2 Y Axis (temperature and humidity) to display some information from my text file. It is contained in a textfile called temperaturedata.txt I have included a link to one of my posts from the JpGrapher forum only because it is able to display the code clearly. I understand that since it is JpGraph problem I shouldn't post here however the community here is a lot more supportive and active. Many thanks for all your help guys in advance! my code

    Read the article

  • ASP.NET MVC: Problem generating thumbnails...need help!

    - by Ryan Pitts
    Ok, so i'm new to asp.net mvc and i'm trying to make a web application photo gallery. I've posted once on here about this issue i am having of trying to generate thumbnails on-the-fly on the page instead of the actual full-size images. Basically, the functionality i am looking for is to be able to have thumbnails on the page and then be able to click the images to see the full-size version. I am pulling the images and images info from an XML file. So, i did this so i could display them dynamically and so it would be easier to make changes later. Later, i am going to add functionality to upload new images to specific galleries (when i figure out how to do that as well). I am providing a link to download the project i am working on so you can see the code. I would appreciate any help with this! Thanks! URL to project: http://www.diminished4th.com/TestArtist.zip Ryan

    Read the article

  • Adding file of the same name into the same list and unable to update name of the SPFile

    - by BeraCim
    Hi all: I'm having difficulties adding file of the same name in the same list and subsequently updating/changing/modifying the name of a SPFile. Basically, this is what I'm trying to do: string fileName = "something"; // obtained from a loop -- loop omitted here. SPFile file = folder.Files.Add(fileName, otherFile.OpenBinary()); The Add method will generate a runtime exception when it finds another file of the same name in the same list/folder. So I thought of changing the file name later in the process: string newGuid = Guid.NewGuid().ToString(); SPFile file = folder.Files.Add(newGuid, otherFile.OpenBinary()); // some other processing... afterwards, rename the file file.name = fileName; file.Item.Update(); A few minute of googling indicated I need to either move the file around, or update the name field by using ["Name"] instead. I was wondering are there any other better ways to get around this problem? Thanks.

    Read the article

  • Jquery autocomplete for input form, using Textpattern category list as a source

    - by John Stephens
    I'm using the Textpattern CMS to build a discussion site-- I have a firm grasp of XHTML and CSS, as well as Textpattern's template language, but PHP and Javascript are a bit beyond my cunning. On the input form to begin a new topic, users need to select a category from a list of over 5,000 options. Using the HTML select-type input element is very unwieldy, but it works. I would like to use some kind of Javascript magic to display a text-type input element that will read user input and display matches or autocomplete from the available categories, passing the required option's value into the appropriate database field. I've seen several autocomplete plugins for jquery, but the instructions presuppose that you understand how Javascript works. As I mentioned above, it's easy for me to generate the category list as a select-type input element, and I can hide that element using CSS. Is it possible to control select-list input using an autocomplete mechanism in a text-type input element? How would I do that?

    Read the article

  • wrapp a function whose parameters are out type pointer to structure using swig

    - by pierr
    I have following function : typedef struct tagT{ int a ; int b ; }Point; int lib_a_f_5(Point *out_t) { out_t->a = 20; out_t->b = 30; return 0; } How should I direct the SWIG to generate the correct code for ruby (or lua)? When putting following statement to the interface file : %apply SWIGTYPE Point* {Point *out_t}; I got a warning : liba.i:7: Warning(453): Can't apply (Point *OUTPUT). No typemaps are defined. Did i need to write a typemap? How should I do it?

    Read the article

  • How to find a programmer for my project?

    - by Al
    I'm building a web application to generate monthly subscription fees, but I've quickly realised I'm going to need some help with the project to finish it this century. I don't have any money upfront for a freelancer and every website I've found takes bids for project work. The tasks that need doing are flexible too because I can do whatever the other coder doesn't want to. I'm also happy to guide the developer and offer tips for performance/security/etc etc. My question is; how do I go about finding someone to work with on a profit-share basis? I'm sure there are a billion people like me with the "next killer app" but I genuinely believe in it. Can anyone offer some advice? Thanks in advance! EDIT: I guess the trick is to find someone passionate enough about the subject as I am. Where would I find someone? Are there websites that broker profit-share deals on programming work?

    Read the article

  • .NET interop COM DLL behaves differently in VB6 debugger

    - by Aheho
    I have a .NET v2.0 Dll that exposes a few classes to COM. The assembly is called BLogic.DLL I'm calling these classes from a legacy visual basic 6.0 application. I can generate and EXE file and if I have Blogic.dll in the same folder as the EXE, the program runs without a hitch. However If I try and launch the same program within the VB6 debugger I get a: Automation Error The system cannot find the file specified I assume when I'm running in the debugger, the PLogic.dll file can't be found. I tried putting it in the System32 folder, and the same folder as the VB6.EXE file, but I still get the same error. Other facts that may help: PLogic.dll is NOT a strongly-named assembly. It depends on a 3rd party reference that isn't strongly signed so VS doesn't let me strongly sign it. However the 3rd party functionality isn't being called by the VB6 code, and it is not ComVisible.

    Read the article

  • Question regarding XST bitstream generation

    - by Richi
    Hi all, I have a very simple VHDL module, consisting of a few lines of code. The thing is, when I generate the bitstream, I end up with a huge bitstream. The reason for this is, I guess, that XST adds lots of extra information so that the bitstream can run standalone on a FPGA. However, for my purpose it would be interesting to see the size of the bitstream of the module alone without any extra bits and pieces, just the vaniall module alone. Is there an option in Xilinx ISE 12.1 that allows me to do that? Many thanks, Richi

    Read the article

  • How to delete data in DB efficiently using LinQ to NHibernate (one-shot-delete)

    - by kastanf
    Hello, producing software for customers, mostly using MS SQL but some Oracle, a decision was made to plunge into Nhibernate (and C#). The task is to delete efficiently e.g. 10 000 rows from 100 000 and still stay sticked to ORM. I've tried named queries - link already, IQuery sql = s.GetNamedQuery("native-delete-car").SetString(0, "Kirsten"); sql.ExecuteUpdate(); but the best I have ever found seems to be: using (ITransaction tx = _session.BeginTransaction()) { try { string cmd = "delete from Customer where Id < GetSomeId()"; var count = _session.CreateSQLQuery(cmd).ExecuteUpdate(); ... Since it may not get into dB to get all complete rows before deleting them. My questions are: If there is a better way for this kind of delete. If there is a possibility to get the Where condition for Delete like this: Having a select statement (using LinQ to NHibernate) = which will generate appropriate SQL for DB = we get that Where condition and use it for Delete. Thanks :-)

    Read the article

  • Prevent Visual Studio Web Test from changing request details

    - by keithwarren7
    I have a service that accepts Xmla queries for Analysis services, often times those queries themselves will have a string that contains a fragment that looks something like {{[Time].[Year].[All]}} Recording these requests works fine but when I try to re-run the test I get an error from the test runner... Request failed: Exception occurred: There is no context parameter with the name ' [Time].[Year].[All]' in the WebTestContext This was confusing for some time but when I asked VS to generate a coded version of the test I was able to see the problem a bit better. VS searches for the '{{' and '}}' tokens and makes changes, considering those areas to refer to Context parameters, the code looks like this.Context["\n\t[Time].[Year].[All]"].ToString() Anyone know how to instruct Visual Studio to not perform this replacement operation? Or another way around this issue?

    Read the article

  • how to run javascript from c# code ?

    - by dotnetcoder
    I have a webrequest that returns a html response which has form inside with hidden fields with some javascript that submits the form automatically on pageload ( if this was run in a browser). If I save this file as *.html and run this file in browser , the java script code automatically posts the form and the output is excel file. I want to be able to generate this file from a c# code which is not running in broswer. I tried mocking thr form post but its complicated and has various scenarios based on the original webrequest querystring. any pointers.... i know its not possible to probably run JS code that posts the form - from within c# code but still thought of chekcing if someone has done that.

    Read the article

  • gwt internationalization

    - by blub
    Hello guys, there are three (open) questions about the internationalization of GWT, I have: 1) Is it a (huge) performance issue, to use only "Messages" for constant and parameterized text (that's possible), where you would use both "Messages" and "Constants" usually? 2) Is there a way to specify the original text in the source code, whose translations can then be specified somewhere? (e.g. Translate("Hello") in the source code and than in a properties file for e.g. spanish: Hello = ¡Hola!) 3) Do you know any translation-tools, which generate the properties and interfaces for you? Thanks in Advance!

    Read the article

  • Modeling software for network serialization protocol design

    - by Aurélien Vallée
    Hello, I am currently designing a low level network serialization protocol (in fact, a refinement of an existing protocol). As the work progress, pen and paper documents start to show their limits: i have tons of papers, new and outdated merged together, etc... And i can't show anything to anyone since i describe the protocol using my own notation (a mix of flow chart & C structures). I need a software that would help me to design a network protocol. I should be able to create structures, fields, their sizes, their layout, etc... and the software would generate some nice UMLish diagrams.

    Read the article

  • Linking IronPython to WPF

    - by DonnyD
    I just installed VS2010 and the great new IronPython Tools extension. Currently this extension doesn't yet generate event handlers in code upon double-clicking wpf visual controls. Is there anyone that can provide or point me to an example as to how to code wpf event handlers manually in python. I've had no luck finding any and I am new to visual studio. Upon generating a new ipython wpf project the auto-generated code is: import clr clr.AddReference('PresentationFramework') from System.Windows.Markup import XamlReader from System.Windows import Application from System.IO import FileStream, FileMode app = Application() app.Run(XamlReader.Load(FileStream('WpfApplication7.xaml', FileMode.Open))) and the XAML is: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="WpfApplication7" Height="300" Width="300"> <Button>Click Me</Button> </Window> Any help would be appreciated.

    Read the article

  • is there a such thing as a randomly accessible pseudo-random number generator? (preferably open-sour

    - by lucid
    first off, is there a such thing as a random access random number generator, where you could not only sequentially generate random numbers as we're all used to, assuming rand100() always generates a value from 0-100: for (int i=0;i<5;i++) print rand100() output: 14 75 36 22 67 but also randomly access any random value like: rand100(0) would output 14 as long as you didn't change the seed rand100(3) would always output 22 rand100(4) would always output 67 and so on... I've actually found an open-source generator algorithm that does this, but you cannot change the seed. I know that pseudorandomness is a complex field; I wouldn't know how to alter it to add that functionality. Is there a seedable random access random number generator, preferably open source? or is there a better term for this I can google for more information? if not, part 2 of my question would be, is there any reliably random open source conventional seedable pseudorandom number generator so I could port it to multiple platforms/languages while retaining a consistent sequence of values for each platform for any given seed?

    Read the article

  • How to design a class for managing file path ?

    - by remi bourgarel
    Hi All In my app, I generate some xml file for instance : "/xml/product/123.xml" where 123 is the product's id and 123.xml contains informations about this product. I also have "/xml/customer/123.xml" where 123.xml contains informations about the client ... 123 How can I manage these file paths : 1/ - I create the file path directly in the seralization method ? 2/ I create 2 static class : CustomerSerializationPathManager and ProductSerializationPathManager with 1 method : getPath(int customerID) and getPath(int productID) 3/ I create one static class : SerializationPathManager with 2 method : getCustomerPath(int customerID) and getProductPath(int productID) 4/ something else I'd prefer the solution 3 cause if I think there's only one reason to change this class : I change the root directory. So I'd like to have your thoughts about it... thx

    Read the article

  • Problem with migrating a model in ruby

    - by Shreyas Satish
    I run script/generate model query edit query.rb in models.. class Query < ActiveRecord::Base #I even tried Migrations instead of Base def sef.up create table :queries do|t| t.string :name end end def self.down drop_table :queries end end ,run rake db:migrate. and what I see in db is this: mysql> desc queries; +------------+----------+------+-----+---------+----------------+ | Field | Type | Null | Key | Default | Extra | +------------+----------+------+-----+---------+----------------+ | id | int(11) | NO | PRI | NULL | auto_increment | | created_at | datetime | YES | | NULL | | | updated_at | datetime | YES | | NULL | | +------------+----------+------+-----+---------+----------------+ Where is the "name" field? HELP ! Cheers !

    Read the article

  • Symfony: Weird routing issue

    - by Tom
    Hi, I've got following URL in symfony (specifics not important): /frontend_dev.php/something/25/apple ... and a routing rule: /something/:id/:word The URL works fine when clicked through to on the site, but not when I type in the URL. Instead, symfony says: Unable to find a matching route to generate url for params "NULL". The weird thing is that I can navigate to this page and it works, but when hitting Enter in the browser address bar, it no longer finds it. Any thoughts on what might be the cause of something like this generally? I should also add that the URL was working fine when typed in the address bar earlier, but doesn't anymore, and I'm not sure what's there that might be interfering with it. Thanks in advance.

    Read the article

  • How to get the original variable name of variable passed to a function

    - by Acorn
    Is it possible to get the original variable name of a variable passed to a function? E.g. foobar = "foo" def func(var): print var.origname So that: func(foobar) Returns: >>foobar EDIT: All I was trying to do was make a function like: def log(soup): f = open(varname+'.html', 'w') print >>f, soup.prettify() f.close() .. and have the function generate the filename from the name of the variable passed to it. I suppose if it's not possible I'll just have to pass the variable and the variable's name as a string each time.

    Read the article

  • Is there an "extended" UIHint attribute to apply CSS styles for DisplayFor - EditorFor templates?

    - by AJ
    Intro: After reading Brad Wilson Metadata series and searching unsuccesfully on google, I was wondering: Question: Has any OS project / code been created that allows you to tag CSS styles in the Meta information, for example in my (buddy) Model, I want to be able to decorate a property with multiple CSS styles (a single style you can fake with UIHint, I want to set many possible styles - and be able to "cross-utilise") eg. public class MyModel { [DisplayCssHint("h5")] [DisplayCssHint("color:#777;")] [EditorCssHint(".myCoolTextClass")] [EditorCssHint(".myOtherCoolTextClass")] public string Title{ get;set; } [DisplayCssHint(".normaltext")] [EditorCssHint(".myCoolTextClass")] [EditorCssHint(".myOtherCoolTextClass")] public string Message {get;set;} } Thoughts: I know that this does not seem like a logical place to put styling information, however as it is metadata and is discriptive... besides it would be nice to do this while prototyping - (especially being able to apply class styles and extending it further - to generate .Less files would really be cool! more to the point I would hate to write it, if its already been done ;). Any links/pointers/idea's would be appreciated. Thanks,

    Read the article

  • Stack trace in website project, when debug = false

    - by chandmk
    We have a website project. We are logging unhanded exceptions via a appdomain level exception handler. When we set debug= true in web.config, the exception log is showing the offending line numbers in the stack trace. But when we set debug = false, in web.config, log is not displaying the line numbers. We are not in a position to convert the website project in to webapplication project type at this time. Its legacy application and almost all the code is in aspx pages. We also need to leave the project in 'updatable' mode. i.e. We can't user pre-compile option. We are generating pdb files. Is there anyway to tell this kind of website projects to generate the pdb files, and show the line numbers in the stack trace?

    Read the article

  • Is there a standard practice for synchronizing SQL Server tables?

    - by EngineeringAutomation
    I've written an application that retrieves pricing and part options from a SQL database to generate a 3D Model of the product and create a sales proposal. My client likes it so much they want to be able to use it on laptops in the field now. The catch is, they won't have an internet connection. I'm considering setting up a SQLite database as part of the standard installation. The SQLite database on each laptop will synchronize with the main database when the internet connection is re-established. Are there best practices regarding synchronizing SQL tables like this? Are there any pitfalls I should consider? I'm open to all options. Thank you.

    Read the article

  • What is the difference between building a WSDL in Eclipse and using WCF?

    - by myermian
    I'm somewhat familiar with WCF in that I can build Web Services in VS.Net ... I understand some of the concepts... But, the other day I cam across this option in Eclipse (I also use Java to code) to create a WSDL. Playing around with it it looks great since it has a GUI method of building itself. I guess I just wanna know what the difference is. 1) Are they different technologies like WSDL vs WCF? Or, is it that WCF uses WSDLs? 2) I read that WSDLs are a top-down approach... so what about WCF, is that top-down or is that bottom-up? 3) Will this WSDL in Eclipse actually be able to generate CSharp code for my server and client efficiently, or will it require a lot of fixing?

    Read the article

< Previous Page | 187 188 189 190 191 192 193 194 195 196 197 198  | Next Page >