Search Results

Search found 21947 results on 878 pages for 'static import'.

Page 291/878 | < Previous Page | 287 288 289 290 291 292 293 294 295 296 297 298  | Next Page >

  • Whats wrong with this code.Runtime error

    - by javacode
    Hi I am writing this application in eclipse I added all the jar files.I am pasting the code and error.Please let me know what changes I should make to run the application properly. import javax.mail.*; import javax.mail.internet.*; import java.util.*; public class SendMail { public static void main(String [] args) { SendMail sm=new SendMail(); try{ sm.postMail(new String[]{"[email protected]"},"hi","hello","[email protected]"); } catch(MessagingException e) { e.printStackTrace(); } } public void postMail( String recipients[ ], String subject, String message , String from) throws MessagingException { boolean debug = false; //Set the host smtp address Properties props = new Properties(); props.put("mail.smtp.starttls.enable","true"); props.put("mail.smtp.host", "smtp.gmail.com"); props.setProperty("mail.smtp.port", "25"); // create some properties and get the default Session Session session = Session.getDefaultInstance(props, null); session.setDebug(debug); // create a message Message msg = new MimeMessage(session); // set the from and to address InternetAddress addressFrom = new InternetAddress(from); msg.setFrom(addressFrom); InternetAddress[] addressTo = new InternetAddress[recipients.length]; for (int i = 0; i < recipients.length; i++) { addressTo[i] = new InternetAddress(recipients[i]); } msg.setRecipients(Message.RecipientType.TO, addressTo); // Optional : You can also set your custom headers in the Email if you Want msg.addHeader("MyHeaderName", "myHeaderValue"); // Setting the Subject and Content Type msg.setSubject(subject); msg.setContent(message, "text/plain"); Transport.send(msg); } } Error: com.sun.mail.smtp.SMTPSendFailedException: 530 5.7.0 Must issue a STARTTLS command first. 13sm646598ewy.13 at com.sun.mail.smtp.SMTPTransport.issueSendCommand(SMTPTransport.java:1829) at com.sun.mail.smtp.SMTPTransport.mailFrom(SMTPTransport.java:1368) at com.sun.mail.smtp.SMTPTransport.sendMessage(SMTPTransport.java:886) at javax.mail.Transport.send0(Transport.java:191) at javax.mail.Transport.send(Transport.java:120) at SendMail.postMail(SendMail.java:54) at SendMail.main(SendMail.java:10)

    Read the article

  • Cannot instantiate abstract class or interface : problem while persisting

    - by sammy
    i have a class campaign that maintains a list of AdGroupInterfaces. im going to persist its implementation @Entity @Table(name = "campaigns") public class Campaign implements Serializable,Comparable<Object>,CampaignInterface { private static final long serialVersionUID = 1L; @Id @GeneratedValue(strategy = GenerationType.IDENTITY) private Long id; @OneToMany ( cascade = {CascadeType.ALL}, fetch = FetchType.EAGER, targetEntity=AdGroupInterface.class ) @org.hibernate.annotations.Cascade( value = org.hibernate.annotations.CascadeType.DELETE_ORPHAN ) @org.hibernate.annotations.IndexColumn(name = "CHOICE_POSITION") private List<AdGroupInterface> AdGroup; public Campaign() { super(); } public List<AdGroupInterface> getAdGroup() { return AdGroup; } public void setAdGroup(List<AdGroupInterface> adGroup) { AdGroup = adGroup; } public void set1AdGroup(AdGroupInterface adGroup) { if(AdGroup==null) AdGroup=new LinkedList<AdGroupInterface>(); AdGroup.add(adGroup); } } AdGroupInterface's implementation is AdGroups. when i add an adgroup to the list in campaign, campaign c; c.getAdGroupList().add(new AdGroups()), etc and save campaign it says"Cannot instantiate abstract class or interface :" AdGroupInterface its not recognizing the implementation just before persisting... Whereas Persisting adGroups separately works. when it is a member of another entity, it doesnt get persisted. import java.io.Serializable; import java.util.List; import javax.persistence.*; @Entity @DiscriminatorValue("1") @Table(name = "AdGroups") public class AdGroups implements Serializable,Comparable,AdGroupInterface{ /** * */ private static final long serialVersionUID = 1L; private Long Id; private String Name; private CampaignInterface Campaign; private MonetaryValue DefaultBid; public AdGroups(){ super(); } public AdGroups( String name, CampaignInterface campaign) { super(); this.Campaign=new Campaign(); Name = name; this.Campaign = campaign; DefaultBid = defaultBid; AdList=adList; } @Id @GeneratedValue(strategy = GenerationType.IDENTITY) @Column(name="AdGroup_Id") public Long getId() { return Id; } public void setId(Long id) { Id = id; } @Column(name="AdGroup_Name") public String getName() { return Name; } public void setName(String name) { Name = name; } @ManyToOne @JoinColumn (name="Cam_ID", nullable = true,insertable = false) public CampaignInterface getCampaign() { return Campaign; } public void setCampaign(CampaignInterface campaign) { this.Campaign = campaign; } } what am i missing?? please look into it ...

    Read the article

  • return an ArrayList method

    - by Bopeng Liu
    This is a drive method for two other classes. which i posted here http://codereview.stackexchange.com/questions/33148/book-program-with-arraylist I need some help for the private static ArrayList getAuthors(String authors) method. I am kind a beginner. so please help me finish this drive method. or give me some directions. Instruction some of the elements of the allAuthors array contain asterisks “*” between two authors names. The getAuthors method uses this asterisk as a delimiter between names to store them separately in the returned ArrayList of Strings. import java.util.ArrayList; public class LibraryDrive { public static void main(String[] args) { String[] titles = { "The Hobbit", "Acer Dumpling", "A Christmas Carol", "Marley and Me", "Building Java Programs", "Java, How to Program" }; String[] allAuthors = { "Tolkien, J.R.", "Doofus, Robert", "Dickens, Charles", "Remember, SomeoneIdont", "Reges, Stuart*Stepp, Marty", "Deitel, Paul*Deitel, Harvery" }; ArrayList<String> authors = new ArrayList<String>(); ArrayList<Book> books = new ArrayList<Book>(); for (int i = 0; i < titles.length; i++) { authors = getAuthors(allAuthors[i]); Book b = new Book(titles[i], authors); books.add(b); authors.remove(0); } Library lib = new Library(books); System.out.println(lib); lib.sort(); System.out.println(lib); } private static ArrayList<String> getAuthors(String authors) { ArrayList books = new ArrayList<String>(); // need help here. return books; } }

    Read the article

  • Video with QML Video plays choppy on Mac OS X

    - by avida
    I’m trying to create simple video player with QML. I have QtSdk installed and QtMobility compiled and installed from source. Then I put this simple video playing code to main qml file: import QtQuick 1.0 import QtMultimediaKit 1.1 Item{ width: 400; height: 300 Video { id: video source: "d:/Projects/Serenity - HD DVD Trailer.mp4" anchors.fill: parent MouseArea { anchors.fill: parent onClicked: { video.play() } } } } After compiling and running application, video plays choppy and on exiting application it puts this in log: 2011-06-07 11:13:44.055 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x10225ea60 of class NSCFNumber autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.007 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x10264f030 of class __NSCFDate autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.007 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a409000 of class NSCFTimer autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.008 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a43e550 of class NSCFArray autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.008 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a462560 of class __NSFastEnumerationEnumerator autoreleased with no pool in place - just leaking If any way to make it playing smoothly and to prevent memory?

    Read the article

  • Why does my program crash when given negative values?

    - by Wayfarer
    Alright, I am very confused, so I hope you friends can help me out. I'm working on a project using Cocos2D, the most recent version (.99 RC 1). I make some player objects and some buttons to change the object's life. But the weird thing is, the code crashes when I try to change their life by -5. Or any negative value for that matter, besides -1. NSMutableArray *lifeButtons = [[NSMutableArray alloc] init]; CCTexture2D *buttonTexture = [[CCTextureCache sharedTextureCache] addImage:@"Button.png"]; LifeChangeButtons *button = nil; //top left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , size.height - 30); [button buttonText:-5]; [lifeButtons addObject:button]; //top right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , size.height - 30); [button buttonText:1]; [lifeButtons addObject:button]; //bottom left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , 30); [button buttonText:5]; [lifeButtons addObject:button]; //bottom right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , 30); [button buttonText:-1]; [lifeButtons addObject:button]; for (LifeChangeButtons *theButton in lifeButtons) { [self addChild:theButton]; } This is the code that makes the buttons. It simply makes 4 buttons, puts them in each corner of the screen (size is the screen) and adds their life change ability, 1,-1,5, or -5. It adds them to the array and then goes through the array at the end and adds all of them to the screen. This works fine. Here is my code for the button class: (header file) // // LifeChangeButtons.h // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "cocos2d.h" @interface LifeChangeButtons : CCSprite <CCTargetedTouchDelegate> { NSNumber *lifeChange; } @property (nonatomic, readonly) CGRect rect; @property (nonatomic, retain) NSNumber *lifeChange; + (id)lifeButton:(CCTexture2D *)texture; - (void)buttonText:(int)number; @end Implementation file: // // LifeChangeButtons.m // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "LifeChangeButtons.h" #import "cocos2d.h" #import "CustomCCNode.h" @implementation LifeChangeButtons @synthesize lifeChange; //Create the button +(id)lifeButton:(CCTexture2D *)texture { return [[[self alloc] initWithTexture:texture] autorelease]; } - (id)initWithTexture:(CCTexture2D *)atexture { if ((self = [super initWithTexture:atexture])) { //NSLog(@"wtf"); } return self; } //Set the text on the button - (void)buttonText:(int)number { lifeChange = [NSNumber numberWithInt:number]; NSString *text = [[NSString alloc] initWithFormat:@"%d", number]; CCLabel *label = [CCLabel labelWithString:text fontName:@"Times New Roman" fontSize:20]; label.position = CGPointMake(35, 20); [self addChild:label]; } - (CGRect)rect { CGSize s = [self.texture contentSize]; return CGRectMake(-s.width / 2, -s.height / 2, s.width, s.height); } - (BOOL)containsTouchLocation:(UITouch *)touch { return CGRectContainsPoint(self.rect, [self convertTouchToNodeSpaceAR:touch]); } - (void)onEnter { [[CCTouchDispatcher sharedDispatcher] addTargetedDelegate:self priority:0 swallowsTouches:YES]; [super onEnter]; } - (void)onExit { [[CCTouchDispatcher sharedDispatcher] removeDelegate:self]; [super onExit]; } - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; if ( ![self containsTouchLocation:touch] ) return NO; NSLog(@"Button touch event was called returning yes. "); //this is where we change the life to each selected player NSLog(@"Test1"); NSMutableArray *tempArray = [[[UIApplication sharedApplication] delegate] selectedPlayerObjects]; NSLog(@"Test2"); for (CustomCCNode *aPlayer in tempArray) { NSLog(@"we change the life by %d.", [lifeChange intValue]); [aPlayer changeLife:[lifeChange intValue]]; } NSLog(@"Test3"); return YES; } - (void)ccTouchMoved:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; NSLog(@"You moved in a button!"); } - (void)ccTouchEnded:(UITouch *)touch withEvent:(UIEvent *)event { NSLog(@"You touched up in a button"); } @end Now, This function: - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event Is where all the shit goes down. It works for all of the buttons except the -5 one. And then, it gets to: NSLog(@"we change the life by %d.", [lifeChange integerValue]); And it crashes at that statement. It only crashes when given anything less than -1. -1 works, but nothing smaller does. Here is the code in the CustomCCNode Class, "changeLife" that is being called. - (void)changeLife:(int)lifeChange { NSLog(@"change life in Custom Class was called"); NSLog(@"wtf is lifechange: %d", lifeChange); life += lifeChange; lifeString = [[NSString alloc] initWithFormat:@"%d",life]; [text setString:lifeString]; } Straight forward, but when the NSnumber is -5, it doesn't even get called, it crashes at the NSlog statement. So... what's up with that?

    Read the article

  • Maven eclipse does not add a dependency

    - by Calm Storm
    I have the following snippet in my pom.xml <dependency> <groupId>aspectj</groupId> <artifactId>aspectjrt</artifactId> <version>1.5.3</version> </dependency> and in one of my Java files I refer a class org.aspectj.lang.ProceedingJoinPoint. When I do a "mvn clean install" it compiles and builds fine but when I do an eclipse:eclipse, and import the project in eclipse it gives me an error The import org.aspectj cannot be resolved. I checked the .classpath file that was generated and it does not have an entry to this file. I tried a "mvn dependency:tree" and it lists this fine. Can someone tell me what is going wrong here?

    Read the article

  • Is this GetEnumAsStrings<T>() method reinventing the wheel?

    - by Edward Tanguay
    I have a number of enums and need to get them as List<string> objects in order to enumerate through them and hence made the GetEnumAsStrings<T>() method. But it seems to me there would be an easier way. Is there not a built-in method to get an enum like this into a List<string>? using System; using System.Collections.Generic; namespace TestEnumForeach2312 { class Program { static void Main(string[] args) { List<string> testModes = StringHelpers.GetEnumAsStrings<TestModes>(); testModes.ForEach(s => Console.WriteLine(s)); Console.ReadLine(); } } public static class StringHelpers { public static List<string> GetEnumAsStrings<T>() { List<string> enumNames = new List<string>(); foreach (T item in Enum.GetValues(typeof(TestModes))) { enumNames.Add(item.ToString()); } return enumNames; } } public enum TestModes { Test, Show, Wait, Stop } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Relative paths in spring classpath resource

    - by Mike Q
    Hi all, I have a bunch of spring config files, all of which live under the META-INF directory in various subpackages. I have been using import like the following... <import resource="../database/schema.xml"/> So a relative path from the source file. This works fine when I am working with a local build outside of a jar file. But when I package everything up in a jar then I get an error that it cannot resolve the URL resource. If I change the above to an absolute path (with classpath:) then it works fine. Is there any way to use relative paths with ".." in when the configs are packaged in a jar or am I restricted to descending relative paths and absolute paths only? Thanks.

    Read the article

  • Looking for Reachability (2.0) Use Case Validation

    - by user350243
    There is so much info out there on using Apple's Reachability example, and so much is conflicting. I'm trying to find out of I'm using it (Reachability 2.0) correctly below. My App use case is this: If an internet connection is available through any means (wifi, LAN, Edge, 3G, etc.) a UIButton ("See More") is visible on various views. If no connection, the button is not visible. The "See More" part is NOT critical in any way to the app, it's just an add-on feature. "See More" could be visible or not anytime during the application lifecycle as connection is established or lost. Here's how I did it - Is this correct and/or is there a better way? Any help is Greatly Appreciated! lq // AppDelegate.h #import "RootViewController.h" @class Reachability; @interface AppDelegate : NSObject <UIApplicationDelegate> { UIWindow *window; UINavigationController *navigationController; RootViewController *rootViewController; Reachability* hostReach; // NOT USED: Reachability* internetReach; // NOT USED: Reachability* wifiReach; } @property (nonatomic, retain) IBOutlet UIWindow *window; @property (nonatomic, retain) IBOutlet UINavigationController *navigationController; @property (nonatomic, retain) IBOutlet RootViewController *rootViewController; @end // AppDelegate.m #import "AppDelegate.h" #import "Reachability.h" #define kHostName @"www.somewebsite.com" @implementation AppDelegate @synthesize window; @synthesize navigationController; @synthesize rootViewController; - (void) updateInterfaceWithReachability: (Reachability*) curReach { if(curReach == hostReach) { NetworkStatus netStatus = [curReach currentReachabilityStatus]; BOOL connectionRequired = [curReach connectionRequired]; // Set a Reachability BOOL value flag in rootViewController // to be referenced when opening various views if ((netStatus != ReachableViaWiFi) && (netStatus != ReachableViaWWAN)) { rootViewController.bConnection = (BOOL *)0; } else { rootViewController.bConnection = (BOOL *)1; } } } - (void) reachabilityChanged: (NSNotification* )note { Reachability* curReach = [note object]; NSParameterAssert([curReach isKindOfClass: [Reachability class]]); [self updateInterfaceWithReachability: curReach]; } - (void)applicationDidFinishLaunching:(UIApplication *)application { // NOTE: #DEFINE in Reachability.h: // #define kReachabilityChangedNotification @"kNetworkReachabilityChangedNotification" [[NSNotificationCenter defaultCenter] addObserver: self selector: @selector(reachabilityChanged:) name: kReachabilityChangedNotification object: nil]; hostReach = [[Reachability reachabilityWithHostName: kHostName] retain]; [hostReach startNotifer]; [self updateInterfaceWithReachability: hostReach]; [window addSubview:[navigationController view]]; [window makeKeyAndVisible]; } - (void)dealloc { [navigationController release]; [rootViewController release]; [window release]; [super dealloc]; } @end

    Read the article

  • serving files using django - is this a security vulnerability

    - by Tom Tom
    I'm using the following code to serve uploaded files from a login secured view in a django app. Do you think that there is a security vulnerability in this code? I'm a bit concerned about that the user could place arbitrary strings in the url after the upload/ and this is directly mapped to the local filesystem. Actually I don't think that it is a vulnerability issue, since the access to the filesystem is restricted to the files in the folder defined with the UPLOAD_LOCATION setting. UPLOAD_LOCATION = is set to a not publicly available folder on the webserver url(r'^upload/(?P<file_url>[/,.,\s,_,\-,\w]+)', 'aeon_infrastructure.views.serve_upload_files', name='project_detail'), @login_required def serve_upload_files(request, file_url): import os.path import mimetypes mimetypes.init() try: file_path = settings.UPLOAD_LOCATION + '/' + file_url fsock = open(file_path,"r") file_name = os.path.basename(file_path) file_size = os.path.getsize(file_path) print "file size is: " + str(file_size) mime_type_guess = mimetypes.guess_type(file_name) if mime_type_guess is not None: response = HttpResponse(fsock, mimetype=mime_type_guess[0]) response['Content-Disposition'] = 'attachment; filename=' + file_name #response.write(file) except IOError: response = HttpResponseNotFound() return response

    Read the article

  • Scrapy Could not find spider Error

    - by Nacari
    I have been trying to get a simple spider to run with scrapy, but keep getting the error: Could not find spider for domain:stackexchange.com when I run the code with the expression scrapy-ctl.py crawl stackexchange.com. The spider is as follow: from scrapy.spider import BaseSpider from __future__ import absolute_import class StackExchangeSpider(BaseSpider): domain_name = "stackexchange.com" start_urls = [ "http://www.stackexchange.com/", ] def parse(self, response): filename = response.url.split("/")[-2] open(filename, 'wb').write(response.body) SPIDER = StackExchangeSpider()` Another person posted almost the exact same problem months ago but did not say how they fixed it, http://stackoverflow.com/questions/1806990/scrapy-spider-is-not-working I have been following the turtorial exactly at http://doc.scrapy.org/intro/tutorial.html, and cannot figure out why it is not working.

    Read the article

  • Read entire file in Scala?

    - by Brendan OConnor
    What's a simple and canonical way to read an entire file into memory in Scala? (Ideally, with control over character encoding.) The best I can come up with is: scala.io.Source.fromPath("file.txt").getLines.reduceLeft(_+_) or am I supposed to use one of Java's god-awful idioms, the best of which (without using an external library) seems to be: import java.util.Scanner import java.io.File new Scanner(new File("file.txt")).useDelimiter("\\Z").next() From reading mailing list discussions, it's not clear to me that scala.io.Source is even supposed to be the canonical I/O library. I don't understand what its intended purpose is, exactly. ... I'd like something dead-simple and easy to remember. For example, in these languages it's very hard to forget the idiom ... Ruby open("file.txt").read Ruby File.read("file.txt") Python open("file.txt").read()

    Read the article

  • How do I target a div without a class or id but with all these specific style-attributes

    - by Ben
    I'm restyling a certain page where I don't have access to all the source-HTML. So I'm left over with some hard to target elements within a page I need removed. For example the page is swamped with <div style="float: left; width: 10.25px; height: 284px;"></div>. To get rid of them I tried this in CSS: div[style="float: left; width: 10.25px; height: 284px;"] { display:none !important; } I'd like to fix this using CSS, because the the HTML that needs to be removed is updated using ajax. How do I target a div without a class or id but with all these specific style-attributes? Some more of the source-code (took a while to organize the parsed source): <div> <span class="Block BigPhotoList_Block"> <span class="Photo BigPhotoList_Photo" style="height: 200px"> <a href="/Webwinkel-Product-83760187/Le-Coq-Sportif-Angers-Low.html.html"> <span style="background-image:url(http://61955.static.securearea.eu/Files/2/61000/61955/ProductPhotos/MaxContent/144036303.jpg);" class="Canvas BigPhotoList_Canvas" title="Le-Coq-Sportif-Angers-Low"></span> </a> </span> <span class="Title BigPhotoList_Title"> <a href="/Webwinkel-Product-83760187/Le-Coq-Sportif-Angers-Low.html.html"> Le Coq Sportif Angers Low </a> </span> <span class="Price BigPhotoList_Price" style="font-size: 120%;"> € 89,95 </span> </span> <div style="float: left; width: 10.25px; height: 284px; border-right: 1px dashed #A0A0A0;" class="BigPhotoList_Stippel"></div> <div style="float: left; width: 10.25px; height: 284px;"></div> <span class="Block BigPhotoList_Block"> <span class="Photo BigPhotoList_Photo" style="height: 200px"> <a href="/Webwinkel-Product-83760185/Le-Coq-Sportif-Auveurne-Low.html"> <span style="background-image:url(http://61955.static.securearea.eu/Files/2/61000/61955/ProductPhotos/MaxContent/144036301.jpg);" class="Canvas BigPhotoList_Canvas" title="Le-Coq-Sportif-Auveurne-Low"></span> </a> </span> <span class="Title BigPhotoList_Title"> <a href="/Webwinkel-Product-83760185/Le-Coq-Sportif-Auveurne-Low.html"> Le Coq Sportif Auveurne Low </a> </span> <span class="Price BigPhotoList_Price" style="font-size: 120%;"> € 79,95 </span> </span> <div style="float: left; width: 10.25px; height: 284px; border-right: 1px dashed #A0A0A0;" class="BigPhotoList_Stippel"></div> <div style="float: left; width: 10.25px; height: 284px;"></div> <span class="Block BigPhotoList_Block"> <span class="Photo BigPhotoList_Photo" style="height: 200px"> <a href="/Webwinkel-Product-83760191/Le-Coq-Sportif-Bordeaux-Low.html"> <span style="background-image:url(http://61955.static.securearea.eu/Files/2/61000/61955/ProductPhotos/MaxContent/144036307.jpg);" class="Canvas BigPhotoList_Canvas" title="Le-Coq-Sportif-Bordeaux-Low"></span> </a> </span> <span class="Title BigPhotoList_Title"> <a href="/Webwinkel-Product-83760191/Le-Coq-Sportif-Bordeaux-Low.html"> Le Coq Sportif Bordeaux Low </a> </span> <span class="Price BigPhotoList_Price" style="font-size: 120%;"> € 99,95 </span> </span> <span class="Block BigPhotoList_Block"> <span class="Photo BigPhotoList_Photo" style="height: 200px"> <a href="/Webwinkel-Product-83760181/Le-Coq-Sportif-Cannet-Low.html"> <span style="background-image:url(http://61955.static.securearea.eu/Files/2/61000/61955/ProductPhotos/MaxContent/144036297.jpg);" class="Canvas BigPhotoList_Canvas" title="Le-Coq-Sportif-Cannet-Low"></span> </a> </span> <span class="Title BigPhotoList_Title"> <a href="/Webwinkel-Product-83760181/Le-Coq-Sportif-Cannet-Low.html"> Le Coq Sportif Cannet Low </a> </span> <span class="Discount BigPhotoList_Discount" style="font-size: 120%;"> € 99,95 </span> <span class="Price BigPhotoList_Price" style="font-size: 120%;"> € 94,95 </span> </span> <div style="float: left; width: 10.25px; height: 284px; border-right: 1px dashed #A0A0A0;" class="BigPhotoList_Stippel"></div> <div style="float: left; width: 10.25px; height: 284px;"></div> <span class="Block BigPhotoList_Block"> <span class="Photo BigPhotoList_Photo" style="height: 200px"> <a href="/Webwinkel-Product-83760183/Le-Coq-Sportif-Rodez-Low.html"> <span style="background-image:url(http://61955.static.securearea.eu/Files/2/61000/61955/ProductPhotos/MaxContent/144036299.jpg);" class="Canvas BigPhotoList_Canvas" title="Le-Coq-Sportif-Rodez-Low"></span> </a> </span> <span class="Title BigPhotoList_Title"> <a href="/Webwinkel-Product-83760183/Le-Coq-Sportif-Rodez-Low.html"> Le Coq Sportif Rodez Low </a> </span> <span class="Price BigPhotoList_Price" style="font-size: 120%;"> € 99,95 </span> </span> <div style="float: left; width: 10.25px; height: 284px; border-right: 1px dashed #A0A0A0;" class="BigPhotoList_Stippel"></div> <div style="float: left; width: 10.25px; height: 284px;"></div> <span class="Block BigPhotoList_Block"> <span class="Photo BigPhotoList_Photo" style="height: 200px"> <a href="/Webwinkel-Product-83760189/Le-Coq-Sportif-Sedan-Low.html"> <span style="background-image:url(http://61955.static.securearea.eu/Files/2/61000/61955/ProductPhotos/MaxContent/144036305.jpg);" class="Canvas BigPhotoList_Canvas" title="Le-Coq-Sportif-Sedan-Low"></span> </a> </span> <span class="Title BigPhotoList_Title"> <a href="/Webwinkel-Product-83760189/Le-Coq-Sportif-Sedan-Low.html"> Le Coq Sportif Sedan Low </a> </span> <span class="Discount BigPhotoList_Discount" style="font-size: 120%;"> € 109,95 </span> <span class="Price BigPhotoList_Price" style="font-size: 120%;"> € 99,95 </span> </span> </div>

    Read the article

  • FluentValidation + s#arp

    - by csetzkorn
    Hi, Did someone implement something like this: http://www.jeremyskinner.co.uk/2010/02/22/using-fluentvalidation-with-an-ioc-container/ in s#arp? Thanks. Christian PS: Hi, I have made a start in using FluentValidation in S#arp. I have implemented a Validator factory: public class ResolveType { private static IWindsorContainer _windsorContainer; public static void Initialize(IWindsorContainer windsorContainer) { _windsorContainer = windsorContainer; } public static object Of(Type type) { return _windsorContainer.Resolve(type); } } public class CastleWindsorValidatorFactory : ValidatorFactoryBase { public override IValidator CreateInstance(Type validatorType) { return ResolveType.Of(validatorType) as IValidator; } } I think I will use services which can be used by the controllers etc.: public class UserValidator : AbstractValidator { private readonly IUserRepository UserRepository; public UserValidator(IUserRepository UserRepository) { Check.Require(UserRepository != null, "UserRepository may not be null"); this.UserRepository = UserRepository; RuleFor(user => user.Email).NotEmpty(); RuleFor(user => user.FirstName).NotEmpty(); RuleFor(user => user.LastName).NotEmpty(); } } public interface IUserService { User CreateUser(User User); } public class UserService : IUserService { private readonly IUserRepository UserRepository; private readonly UserValidator UserValidator; public UserService ( IUserRepository UserRepository ) { Check.Require(UserRepository != null, "UserRepository may not be null"); this.UserRepository = UserRepository; this.UserValidator = new UserValidator(UserRepository); } public User CreateUser(User User) { UserValidator.Validate(User); ... } } Instead of putting concrete validators in the service, I would like to use the above factory somehow. Where do I register it and how in s#arp (Global.asax)? I believe s#arp is geared towards the nhibernator validator. How do I deregister it? Thanks. Best wishes, Christian

    Read the article

  • How can I handle template dependencies in Template Toolkit?

    - by Smack my batch up
    My static web pages are built from a huge bunch of templates which are inter-included using Template Toolkit's "import" and "include", so page.html looks like this: [% INCLUDE top %] [% IMPORT middle %] Then top might have even more files included. I have very many of these files, and they have to be run through to create the web pages in various languages (English, French, etc., not computer languages). This is a very complicated process and when one file is updated I would like to be able to automatically remake only the necessary files, using a makefile or something similar. Are there any tools like makedepend for C files which can parse template toolkit templates and create a dependency list for use in a makefile? Or are there better ways to automate this process?

    Read the article

  • pyplot: really slow creating heatmaps

    - by cvondrick
    I have a loop that executes the body about 200 times. In each loop iteration, it does a sophisticated calculation, and then as debugging, I wish to produce a heatmap of a NxM matrix. But, generating this heatmap is unbearably slow and significantly slow downs an already slow algorithm. My code is along the lines: import numpy import matplotlib.pyplot as plt for i in range(200): matrix = complex_calculation() plt.set_cmap("gray") plt.imshow(matrix) plt.savefig("frame{0}.png".format(i)) The matrix, from numpy, is not huge --- 300 x 600 of doubles. Even if I do not save the figure and instead update an on-screen plot, it's even slower. Surely I must be abusing pyplot. (Matlab can do this, no problem.) How do I speed this up?

    Read the article

  • Existing LINQ extension method similar to Parallel.For?

    - by Joel Martinez
    The linq extension methods for ienumerable are very handy ... but not that useful if all you want to do is apply some computation to each item in the enumeration without returning anything. So I was wondering if perhaps I was just missing the right method, or if it truly doesn't exist as I'd rather use a built-in version if it's available ... but I haven't found one :-) I could have sworn there was a .ForEach method somewhere, but I have yet to find it. In the meantime, I did write my own version in case it's useful for anyone else: using System.Collections; using System.Collections.Generic; public delegate void Function<T>(T item); public delegate void Function(object item); public static class EnumerableExtensions { public static void For(this IEnumerable enumerable, Function func) { foreach (object item in enumerable) { func(item); } } public static void For<T>(this IEnumerable<T> enumerable, Function<T> func) { foreach (T item in enumerable) { func(item); } } } usage is: myEnumerable.For<MyClass>(delegate(MyClass item) { item.Count++; });

    Read the article

  • Is there any Java Decompiler that can correctly decompile calls to overloaded methods?

    - by mihi
    Consider this (IMHO simple) example: public class DecompilerTest { public static void main(String[] args) { Object s1 = "The", s2 = "answer"; doPrint((Object) "You should know:"); for (int i = 0; i < 2; i++) { doPrint(s1); doPrint(s2); s1 = "is"; s2 = new Integer(42); } System.out.println(); } private static void doPrint(String s1) { System.out.print("Wrong!"); } private static void doPrint(Object s1) { System.out.print(s1 + " "); } } Compile it with source/target level 1.1 without debug information (i.e. no local variable information should be present) and try to decompile it. I tried Jad, JD-GUI and Fernflower, and all of them got at least one of the call wrong (i. e. the program printed "Wrong!" at least once) Is there really no java decompiler that can infer the right casts so that it will not call the wrong overload?

    Read the article

  • MySQLdb not INSERTING, _mysql does fine.

    - by Mad_Casual
    Okay, I log onto the MySQL command-line client as root. I then open or otherwise run a python app using the MySQLdb module as root. When I check the results using python (IDLE), everything looks fine. When I use the MySQL command-line client, no INSERT has occurred. If I change things around to _mysql instead of MySQLdb, everything works fine. I'd appreciate any clarification(s). "Works" until IDLE/Virtual machine is reset: <pre><code>import MySQLdb db = MySQLdb.connect(user='root', passwd='*******',db='test') cursor = db.cursor() cursor.execute("""INSERT INTO test VALUES ('somevalue');""",)</code></end> Works: <pre><code>import _mysql db = _mysql.connect(user='root', passwd='*******',db='test') db.query("INSERT INTO test VALUES ('somevalue');")</code></end> System info: Intel x86 WinXP Python 2.5 MySQL 5.1.41 MySQL-Python 1.2.2

    Read the article

  • iphone - UIViewController header view errors

    - by Fiona
    Hi there, So to give a little background: I've an app that has a UITableViewController- (ContactDetailViewController) In this view at the top, I require a few labels and buttons, followed by a group style tableview. So I've created a nib file containing these elements. (ContactHeaderView.xib) Then in the viewDidLoad of ContactDetailViewController I've loaded this nib as the headerView. See implementation file below: #import "ContactDetailViewController.h" #import "DisplayInfoViewController.h" #import "ActionViewController.h" @implementation ContactDetailViewController @synthesize name; @synthesize date; @synthesize nextAction; @synthesize nameLabel; @synthesize usernameLabel; @synthesize nextActionTextField; @synthesize dateLabel; @synthesize contactInfoButton; @synthesize backgroundInfoButton; @synthesize actionDoneButton; - (void)viewDidLoad { [super viewDidLoad]; } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } #pragma mark Table view methods - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { return 1; } // Customize the number of rows in the table view. - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { return 3; } - (UIView *) tableView:(UITableView *)tableView viewForHeaderInSection:(NSInteger)section { if (section == 0){ UIViewController *chv = [[[UIViewController alloc] initWithNibName:@"ContactHeaderView" bundle:nil] autorelease]; // self.nameLabel.text = self.name; return chv.view; }else{ return nil; } } - (CGFloat)tableView:(UITableView *)tableView heightForHeaderInSection:(NSInteger)section{ return 300.0; } // Customize the appearance of table view cells. - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier] autorelease]; } // Set up the cell... return cell; } - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { // Navigation logic may go here. Create and push another view controller. // AnotherViewController *anotherViewController = [[AnotherViewController alloc] initWithNibName:@"AnotherView" bundle:nil]; // [self.navigationController pushViewController:anotherViewController]; // [anotherViewController release]; } /* // Override to support conditional editing of the table view. - (BOOL)tableView:(UITableView *)tableView canEditRowAtIndexPath:(NSIndexPath *)indexPath { // Return NO if you do not want the specified item to be editable. return YES; } */ - (void)dealloc { [name release]; [date release]; [nextAction release]; [nameLabel release]; [usernameLabel release]; [nextActionTextField release]; [dateLabel release]; [contactInfoButton release]; [backgroundInfoButton release]; [actionDoneButton release]; [super dealloc]; } -(IBAction)displayContactInfo:(id)sender{ DisplayInfoViewController *divc = [[DisplayInfoViewController alloc] init]; divc.textView = self.nextAction; divc.title = @"Contact Info"; [self.navigationController pushViewController:divc animated:YES]; [divc release]; } -(IBAction)displayBackgroundInfo:(id)sender{ DisplayInfoViewController *divc = [[DisplayInfoViewController alloc] init]; divc.textView = self.nextAction; divc.title = @"Background Info"; [self.navigationController pushViewController:divc animated:YES]; [divc release]; } -(IBAction)actionDone:(id)sender{ ActionViewController *avc = [[ActionViewController alloc] init]; avc.title = @"Action"; avc.nextAction = self.nextAction; [self.navigationController pushViewController:avc animated:YES]; [avc release]; } @end Here's the Header File: #import <UIKit/UIKit.h> @interface ContactDetailViewController : UITableViewController { NSString *name; NSString *date; NSString *nextAction; IBOutlet UILabel *nameLabel; IBOutlet UILabel *usernameLabel; IBOutlet UITextField *nextActionTextField; IBOutlet UILabel *dateLabel; IBOutlet UIButton *contactInfoButton; IBOutlet UIButton *backgroundInfoButton; IBOutlet UIButton *actionDoneButton; } @property (nonatomic, retain) NSString *name; @property (nonatomic, retain) NSString *date; @property (nonatomic, retain) NSString *nextAction; @property (nonatomic, retain) IBOutlet UILabel *nameLabel; @property (nonatomic, retain) IBOutlet UILabel *usernameLabel; @property (nonatomic, retain) IBOutlet UITextField *nextActionTextField; @property (nonatomic, retain) IBOutlet UILabel *dateLabel; @property (nonatomic, retain) IBOutlet UIButton *contactInfoButton; @property (nonatomic, retain) IBOutlet UIButton *backgroundInfoButton; @property (nonatomic, retain) IBOutlet UIButton *actionDoneButton; -(IBAction)displayContactInfo: (id)sender; -(IBAction)displayBackgroundInfo: (id)sender; -(IBAction)actionDone: (id)sender; @end However when I run it, I get the following error message: * Terminating app due to uncaught exception 'NSUnknownKeyException', reason: '[ setValue:forUndefinedKey:]: this class is not key value coding-compliant for the key nameLabel.' In IB I've hooked up the labels/buttons/textbox to the File's Owner (set the File's Owner Class to: ContactDetailViewController) Anyone any idea what I'm doing wrong? Regards, Fiona

    Read the article

  • MSTest unit test passes by itself, fails when other tests are run

    - by Sarah Vessels
    I'm having trouble with some MSTest unit tests that pass when I run them individually but fail when I run the entire unit test class. The tests test some code that SLaks helped me with earlier, and he warned me what I was doing wasn't thread-safe. However, now my code is more complicated and I don't know how to go about making it thread-safe. Here's what I have: public static class DLLConfig { private static string _domain; public static string Domain { get { return _domain = AlwaysReadFromFile ? readCredentialFromFile(DOMAIN_TAG) : _domain ?? readCredentialFromFile(DOMAIN_TAG); } } } And my test is simple: string expected = "the value I know exists in the file"; string actual = DLLConfig.Domain; Assert.AreEqual(expected, actual); When I run this test by itself, it passes. When I run it alongside all the other tests in the test class (which perform similar checks on different properties), actual is null and the test fails. I note this is not a problem with a property whose type is a custom Enum type; maybe I'm having this problem with the Domain property because it is a string? Or maybe it's a multi-threaded issue with how MSTest works?

    Read the article

  • How to draw the "trail" in a maze solving application

    - by snow-spur
    Hello i have designed a maze and i want to draw a path between the cells as the 'person' moves from one cell to the next. So each time i move the cell a line is drawn Also i am using the graphics module The graphics module is an object oriented library Im importing from graphics import* from maze import* my circle which is my cell center = Point(15, 15) c = Circle(center, 12) c.setFill('blue') c.setOutline('yellow') c.draw(win) p1 = Point(c.getCenter().getX(), c.getCenter().getY()) this is my loop if mazez.blockedCount(cloc)> 2: mazez.addDecoration(cloc, "grey") mazez[cloc].deadend = True c.move(-25, 0) p2 = Point(getX(), getY()) line = graphics.Line(p1, p2) cloc.col = cloc.col - 1 Now it says getX not defined every time i press a key is this because of p2???

    Read the article

  • fastest in-memory cache for XslCompiledTransform

    - by rudnev
    I have a set of xslt stylesheet files. I need to produce the fastest performance of XslConpiledTransform, so i want to make in-memory representation of these stylesheets. I can load them to in-memory collection as IXpathNavigable on application start, and then load each IXPAthNavigable into singleton XslCompiledTransform on each request. But this works only for styleshhets without xsl:import or xsl:include. (Xsl:import is only for files). also i can load into cache many instances of XSLCompiledTransform for each template. Is it reasonable? Are there other ways? What is the best? what are another tips for improving performance MS Xslt processor?

    Read the article

  • Java: conditional initialization?

    - by HH
    Ruby has conditional initialization. Apparently, Java does not or does it? I try to write more succintly, to limit the range as small as possible. import java.io.*; import java.util.*; public class InitFor{ public static void main(String[] args){ for(int i=7,k=999;i+((String h="hello").size())<10;i++){} System.out.println("It should be: hello = "+h); } } Errors Press ENTER or type command to continue InitFor.java:8: ')' expected for(int i=7,k=999;i+((String h="hello").size())<10;i++){} ^

    Read the article

< Previous Page | 287 288 289 290 291 292 293 294 295 296 297 298  | Next Page >