Search Results

Search found 21947 results on 878 pages for 'static import'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 291/878 | < Previous Page | 287 288 289 290 291 292 293 294 295 296 297 298  | Next Page >

  • Video with QML Video plays choppy on Mac OS X

    - by avida
    I’m trying to create simple video player with QML. I have QtSdk installed and QtMobility compiled and installed from source. Then I put this simple video playing code to main qml file: import QtQuick 1.0 import QtMultimediaKit 1.1 Item{ width: 400; height: 300 Video { id: video source: "d:/Projects/Serenity - HD DVD Trailer.mp4" anchors.fill: parent MouseArea { anchors.fill: parent onClicked: { video.play() } } } } After compiling and running application, video plays choppy and on exiting application it puts this in log: 2011-06-07 11:13:44.055 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x10225ea60 of class NSCFNumber autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.007 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x10264f030 of class __NSCFDate autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.007 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a409000 of class NSCFTimer autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.008 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a43e550 of class NSCFArray autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.008 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a462560 of class __NSFastEnumerationEnumerator autoreleased with no pool in place - just leaking If any way to make it playing smoothly and to prevent memory?

    Read the article

  • Why does my program crash when given negative values?

    - by Wayfarer
    Alright, I am very confused, so I hope you friends can help me out. I'm working on a project using Cocos2D, the most recent version (.99 RC 1). I make some player objects and some buttons to change the object's life. But the weird thing is, the code crashes when I try to change their life by -5. Or any negative value for that matter, besides -1. NSMutableArray *lifeButtons = [[NSMutableArray alloc] init]; CCTexture2D *buttonTexture = [[CCTextureCache sharedTextureCache] addImage:@"Button.png"]; LifeChangeButtons *button = nil; //top left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , size.height - 30); [button buttonText:-5]; [lifeButtons addObject:button]; //top right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , size.height - 30); [button buttonText:1]; [lifeButtons addObject:button]; //bottom left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , 30); [button buttonText:5]; [lifeButtons addObject:button]; //bottom right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , 30); [button buttonText:-1]; [lifeButtons addObject:button]; for (LifeChangeButtons *theButton in lifeButtons) { [self addChild:theButton]; } This is the code that makes the buttons. It simply makes 4 buttons, puts them in each corner of the screen (size is the screen) and adds their life change ability, 1,-1,5, or -5. It adds them to the array and then goes through the array at the end and adds all of them to the screen. This works fine. Here is my code for the button class: (header file) // // LifeChangeButtons.h // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "cocos2d.h" @interface LifeChangeButtons : CCSprite <CCTargetedTouchDelegate> { NSNumber *lifeChange; } @property (nonatomic, readonly) CGRect rect; @property (nonatomic, retain) NSNumber *lifeChange; + (id)lifeButton:(CCTexture2D *)texture; - (void)buttonText:(int)number; @end Implementation file: // // LifeChangeButtons.m // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "LifeChangeButtons.h" #import "cocos2d.h" #import "CustomCCNode.h" @implementation LifeChangeButtons @synthesize lifeChange; //Create the button +(id)lifeButton:(CCTexture2D *)texture { return [[[self alloc] initWithTexture:texture] autorelease]; } - (id)initWithTexture:(CCTexture2D *)atexture { if ((self = [super initWithTexture:atexture])) { //NSLog(@"wtf"); } return self; } //Set the text on the button - (void)buttonText:(int)number { lifeChange = [NSNumber numberWithInt:number]; NSString *text = [[NSString alloc] initWithFormat:@"%d", number]; CCLabel *label = [CCLabel labelWithString:text fontName:@"Times New Roman" fontSize:20]; label.position = CGPointMake(35, 20); [self addChild:label]; } - (CGRect)rect { CGSize s = [self.texture contentSize]; return CGRectMake(-s.width / 2, -s.height / 2, s.width, s.height); } - (BOOL)containsTouchLocation:(UITouch *)touch { return CGRectContainsPoint(self.rect, [self convertTouchToNodeSpaceAR:touch]); } - (void)onEnter { [[CCTouchDispatcher sharedDispatcher] addTargetedDelegate:self priority:0 swallowsTouches:YES]; [super onEnter]; } - (void)onExit { [[CCTouchDispatcher sharedDispatcher] removeDelegate:self]; [super onExit]; } - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; if ( ![self containsTouchLocation:touch] ) return NO; NSLog(@"Button touch event was called returning yes. "); //this is where we change the life to each selected player NSLog(@"Test1"); NSMutableArray *tempArray = [[[UIApplication sharedApplication] delegate] selectedPlayerObjects]; NSLog(@"Test2"); for (CustomCCNode *aPlayer in tempArray) { NSLog(@"we change the life by %d.", [lifeChange intValue]); [aPlayer changeLife:[lifeChange intValue]]; } NSLog(@"Test3"); return YES; } - (void)ccTouchMoved:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; NSLog(@"You moved in a button!"); } - (void)ccTouchEnded:(UITouch *)touch withEvent:(UIEvent *)event { NSLog(@"You touched up in a button"); } @end Now, This function: - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event Is where all the shit goes down. It works for all of the buttons except the -5 one. And then, it gets to: NSLog(@"we change the life by %d.", [lifeChange integerValue]); And it crashes at that statement. It only crashes when given anything less than -1. -1 works, but nothing smaller does. Here is the code in the CustomCCNode Class, "changeLife" that is being called. - (void)changeLife:(int)lifeChange { NSLog(@"change life in Custom Class was called"); NSLog(@"wtf is lifechange: %d", lifeChange); life += lifeChange; lifeString = [[NSString alloc] initWithFormat:@"%d",life]; [text setString:lifeString]; } Straight forward, but when the NSnumber is -5, it doesn't even get called, it crashes at the NSlog statement. So... what's up with that?

    Read the article

  • dreamweaver sites

    - by ngreenwood6
    Hello, We have over 500 sites that we host. All of there ftp information is in a database. Whenever one of our programmers have to add a site they have to get all the info and set it up. However, I found that you can export them and it has all the info except for one problem. The password is encrypted. I am not trying to hack anything, I want to know how to encrypt our passwords so that we can import them using dreamweavers import feature. Can anyone tell me what encryption they use or a link on how to encrypt. I am not interested in decrypting at all because we already have all of them so it would not do me any good. Thanks for any help

    Read the article

  • serving files using django - is this a security vulnerability

    - by Tom Tom
    I'm using the following code to serve uploaded files from a login secured view in a django app. Do you think that there is a security vulnerability in this code? I'm a bit concerned about that the user could place arbitrary strings in the url after the upload/ and this is directly mapped to the local filesystem. Actually I don't think that it is a vulnerability issue, since the access to the filesystem is restricted to the files in the folder defined with the UPLOAD_LOCATION setting. UPLOAD_LOCATION = is set to a not publicly available folder on the webserver url(r'^upload/(?P<file_url>[/,.,\s,_,\-,\w]+)', 'aeon_infrastructure.views.serve_upload_files', name='project_detail'), @login_required def serve_upload_files(request, file_url): import os.path import mimetypes mimetypes.init() try: file_path = settings.UPLOAD_LOCATION + '/' + file_url fsock = open(file_path,"r") file_name = os.path.basename(file_path) file_size = os.path.getsize(file_path) print "file size is: " + str(file_size) mime_type_guess = mimetypes.guess_type(file_name) if mime_type_guess is not None: response = HttpResponse(fsock, mimetype=mime_type_guess[0]) response['Content-Disposition'] = 'attachment; filename=' + file_name #response.write(file) except IOError: response = HttpResponseNotFound() return response

    Read the article

  • How can I handle template dependencies in Template Toolkit?

    - by Smack my batch up
    My static web pages are built from a huge bunch of templates which are inter-included using Template Toolkit's "import" and "include", so page.html looks like this: [% INCLUDE top %] [% IMPORT middle %] Then top might have even more files included. I have very many of these files, and they have to be run through to create the web pages in various languages (English, French, etc., not computer languages). This is a very complicated process and when one file is updated I would like to be able to automatically remake only the necessary files, using a makefile or something similar. Are there any tools like makedepend for C files which can parse template toolkit templates and create a dependency list for use in a makefile? Or are there better ways to automate this process?

    Read the article

  • Sending mail from Python using SMTP

    - by Eli Bendersky
    I'm using the following method to send mail from Python using SMTP. Is it the right method to use or are there gotchas I'm missing ? from smtplib import SMTP import datetime debuglevel = 0 smtp = SMTP() smtp.set_debuglevel(debuglevel) smtp.connect('YOUR.MAIL.SERVER', 26) smtp.login('USERNAME@DOMAIN', 'PASSWORD') from_addr = "John Doe <[email protected]>" to_addr = "[email protected]" subj = "hello" date = datetime.datetime.now().strftime( "%d/%m/%Y %H:%M" ) message_text = "Hello\nThis is a mail from your server\n\nBye\n" msg = "From: %s\nTo: %s\nSubject: %s\nDate: %s\n\n%s" % ( from_addr, to_addr, subj, date, message_text ) smtp.sendmail(from_addr, to_addr, msg) smtp.quit()

    Read the article

  • load a pickle file from a zipfile

    - by eric.frederich
    For some reason I cannot get cPickle.load to work on the file-type object returned by ZipFile.open(). If I call read() on the file-type object returned by ZipFile.open() I can use cPickle.loads though. Example .... import zipfile import cPickle # the data we want to store some_data = {1: 'one', 2: 'two', 3: 'three'} # # create a zipped pickle file # zf = zipfile.ZipFile('zipped_pickle.zip', 'w', zipfile.ZIP_DEFLATED) zf.writestr('data.pkl', cPickle.dumps(some_data)) zf.close() # # cPickle.loads works # zf = zipfile.ZipFile('zipped_pickle.zip', 'r') sd1 = cPickle.loads(zf.open('data.pkl').read()) zf.close() # # cPickle.load doesn't work # zf = zipfile.ZipFile('zipped_pickle.zip', 'r') sd2 = cPickle.load(zf.open('data.pkl')) zf.close() Note: I don't want to zip just the pickle file but many files of other types. This is just an example.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Existing LINQ extension method similar to Parallel.For?

    - by Joel Martinez
    The linq extension methods for ienumerable are very handy ... but not that useful if all you want to do is apply some computation to each item in the enumeration without returning anything. So I was wondering if perhaps I was just missing the right method, or if it truly doesn't exist as I'd rather use a built-in version if it's available ... but I haven't found one :-) I could have sworn there was a .ForEach method somewhere, but I have yet to find it. In the meantime, I did write my own version in case it's useful for anyone else: using System.Collections; using System.Collections.Generic; public delegate void Function<T>(T item); public delegate void Function(object item); public static class EnumerableExtensions { public static void For(this IEnumerable enumerable, Function func) { foreach (object item in enumerable) { func(item); } } public static void For<T>(this IEnumerable<T> enumerable, Function<T> func) { foreach (T item in enumerable) { func(item); } } } usage is: myEnumerable.For<MyClass>(delegate(MyClass item) { item.Count++; });

    Read the article

  • Whats wrong with this code.Runtime error

    - by javacode
    Hi I am writing this application in eclipse I added all the jar files.I am pasting the code and error.Please let me know what changes I should make to run the application properly. import javax.mail.*; import javax.mail.internet.*; import java.util.*; public class SendMail { public static void main(String [] args) { SendMail sm=new SendMail(); try{ sm.postMail(new String[]{"[email protected]"},"hi","hello","[email protected]"); } catch(MessagingException e) { e.printStackTrace(); } } public void postMail( String recipients[ ], String subject, String message , String from) throws MessagingException { boolean debug = false; //Set the host smtp address Properties props = new Properties(); props.put("mail.smtp.starttls.enable","true"); props.put("mail.smtp.host", "smtp.gmail.com"); props.setProperty("mail.smtp.port", "25"); // create some properties and get the default Session Session session = Session.getDefaultInstance(props, null); session.setDebug(debug); // create a message Message msg = new MimeMessage(session); // set the from and to address InternetAddress addressFrom = new InternetAddress(from); msg.setFrom(addressFrom); InternetAddress[] addressTo = new InternetAddress[recipients.length]; for (int i = 0; i < recipients.length; i++) { addressTo[i] = new InternetAddress(recipients[i]); } msg.setRecipients(Message.RecipientType.TO, addressTo); // Optional : You can also set your custom headers in the Email if you Want msg.addHeader("MyHeaderName", "myHeaderValue"); // Setting the Subject and Content Type msg.setSubject(subject); msg.setContent(message, "text/plain"); Transport.send(msg); } } Error: com.sun.mail.smtp.SMTPSendFailedException: 530 5.7.0 Must issue a STARTTLS command first. 13sm646598ewy.13 at com.sun.mail.smtp.SMTPTransport.issueSendCommand(SMTPTransport.java:1829) at com.sun.mail.smtp.SMTPTransport.mailFrom(SMTPTransport.java:1368) at com.sun.mail.smtp.SMTPTransport.sendMessage(SMTPTransport.java:886) at javax.mail.Transport.send0(Transport.java:191) at javax.mail.Transport.send(Transport.java:120) at SendMail.postMail(SendMail.java:54) at SendMail.main(SendMail.java:10)

    Read the article

  • error: expected constructor, destructor, or type conversion before '(' token

    - by jonathanasdf
    include/TestBullet.h:12: error: expected constructor, destructor, or type conver sion before '(' token I hate C++ error messages... lol ^^ Basically, I'm following what was written in this post to try to create a factory class for bullets so they can be instantiated from a string, which will be parsed from an xml file, because I don't want to have a function with a switch for all of the classes because that looks ugly. Here is my TestBullet.h: #pragma once #include "Bullet.h" #include "BulletFactory.h" class TestBullet : public Bullet { public: void init(BulletData& bulletData); void update(); }; REGISTER_BULLET(TestBullet); <-- line 12 And my BulletFactory.h: #pragma once #include <string> #include <map> #include "Bullet.h" #define REGISTER_BULLET(NAME) BulletFactory::reg<NAME>(#NAME) #define REGISTER_BULLET_ALT(NAME, CLASS) BulletFactory::reg<CLASS>(NAME) template<typename T> Bullet * create() { return new T; } struct BulletFactory { typedef std::map<std::string, Bullet*(*)()> bulletMapType; static bulletMapType map; static Bullet * createInstance(char* s) { std::string str(s); bulletMapType::iterator it = map.find(str); if(it == map.end()) return 0; return it->second(); } template<typename T> static void reg(std::string& s) { map.insert(std::make_pair(s, &create<T>)); } }; Thanks in advance.

    Read the article

  • Is there any Java Decompiler that can correctly decompile calls to overloaded methods?

    - by mihi
    Consider this (IMHO simple) example: public class DecompilerTest { public static void main(String[] args) { Object s1 = "The", s2 = "answer"; doPrint((Object) "You should know:"); for (int i = 0; i < 2; i++) { doPrint(s1); doPrint(s2); s1 = "is"; s2 = new Integer(42); } System.out.println(); } private static void doPrint(String s1) { System.out.print("Wrong!"); } private static void doPrint(Object s1) { System.out.print(s1 + " "); } } Compile it with source/target level 1.1 without debug information (i.e. no local variable information should be present) and try to decompile it. I tried Jad, JD-GUI and Fernflower, and all of them got at least one of the call wrong (i. e. the program printed "Wrong!" at least once) Is there really no java decompiler that can infer the right casts so that it will not call the wrong overload?

    Read the article

  • pyplot: really slow creating heatmaps

    - by cvondrick
    I have a loop that executes the body about 200 times. In each loop iteration, it does a sophisticated calculation, and then as debugging, I wish to produce a heatmap of a NxM matrix. But, generating this heatmap is unbearably slow and significantly slow downs an already slow algorithm. My code is along the lines: import numpy import matplotlib.pyplot as plt for i in range(200): matrix = complex_calculation() plt.set_cmap("gray") plt.imshow(matrix) plt.savefig("frame{0}.png".format(i)) The matrix, from numpy, is not huge --- 300 x 600 of doubles. Even if I do not save the figure and instead update an on-screen plot, it's even slower. Surely I must be abusing pyplot. (Matlab can do this, no problem.) How do I speed this up?

    Read the article

  • MSTest unit test passes by itself, fails when other tests are run

    - by Sarah Vessels
    I'm having trouble with some MSTest unit tests that pass when I run them individually but fail when I run the entire unit test class. The tests test some code that SLaks helped me with earlier, and he warned me what I was doing wasn't thread-safe. However, now my code is more complicated and I don't know how to go about making it thread-safe. Here's what I have: public static class DLLConfig { private static string _domain; public static string Domain { get { return _domain = AlwaysReadFromFile ? readCredentialFromFile(DOMAIN_TAG) : _domain ?? readCredentialFromFile(DOMAIN_TAG); } } } And my test is simple: string expected = "the value I know exists in the file"; string actual = DLLConfig.Domain; Assert.AreEqual(expected, actual); When I run this test by itself, it passes. When I run it alongside all the other tests in the test class (which perform similar checks on different properties), actual is null and the test fails. I note this is not a problem with a property whose type is a custom Enum type; maybe I'm having this problem with the Domain property because it is a string? Or maybe it's a multi-threaded issue with how MSTest works?

    Read the article

  • How to draw the "trail" in a maze solving application

    - by snow-spur
    Hello i have designed a maze and i want to draw a path between the cells as the 'person' moves from one cell to the next. So each time i move the cell a line is drawn Also i am using the graphics module The graphics module is an object oriented library Im importing from graphics import* from maze import* my circle which is my cell center = Point(15, 15) c = Circle(center, 12) c.setFill('blue') c.setOutline('yellow') c.draw(win) p1 = Point(c.getCenter().getX(), c.getCenter().getY()) this is my loop if mazez.blockedCount(cloc)> 2: mazez.addDecoration(cloc, "grey") mazez[cloc].deadend = True c.move(-25, 0) p2 = Point(getX(), getY()) line = graphics.Line(p1, p2) cloc.col = cloc.col - 1 Now it says getX not defined every time i press a key is this because of p2???

    Read the article

  • Maven eclipse does not add a dependency

    - by Calm Storm
    I have the following snippet in my pom.xml <dependency> <groupId>aspectj</groupId> <artifactId>aspectjrt</artifactId> <version>1.5.3</version> </dependency> and in one of my Java files I refer a class org.aspectj.lang.ProceedingJoinPoint. When I do a "mvn clean install" it compiles and builds fine but when I do an eclipse:eclipse, and import the project in eclipse it gives me an error The import org.aspectj cannot be resolved. I checked the .classpath file that was generated and it does not have an entry to this file. I tried a "mvn dependency:tree" and it lists this fine. Can someone tell me what is going wrong here?

    Read the article

  • Relative paths in spring classpath resource

    - by Mike Q
    Hi all, I have a bunch of spring config files, all of which live under the META-INF directory in various subpackages. I have been using import like the following... <import resource="../database/schema.xml"/> So a relative path from the source file. This works fine when I am working with a local build outside of a jar file. But when I package everything up in a jar then I get an error that it cannot resolve the URL resource. If I change the above to an absolute path (with classpath:) then it works fine. Is there any way to use relative paths with ".." in when the configs are packaged in a jar or am I restricted to descending relative paths and absolute paths only? Thanks.

    Read the article

  • Scrapy Could not find spider Error

    - by Nacari
    I have been trying to get a simple spider to run with scrapy, but keep getting the error: Could not find spider for domain:stackexchange.com when I run the code with the expression scrapy-ctl.py crawl stackexchange.com. The spider is as follow: from scrapy.spider import BaseSpider from __future__ import absolute_import class StackExchangeSpider(BaseSpider): domain_name = "stackexchange.com" start_urls = [ "http://www.stackexchange.com/", ] def parse(self, response): filename = response.url.split("/")[-2] open(filename, 'wb').write(response.body) SPIDER = StackExchangeSpider()` Another person posted almost the exact same problem months ago but did not say how they fixed it, http://stackoverflow.com/questions/1806990/scrapy-spider-is-not-working I have been following the turtorial exactly at http://doc.scrapy.org/intro/tutorial.html, and cannot figure out why it is not working.

    Read the article

  • Eclipse keyword highlighting in in my own text editor

    - by Torok Balint
    I made a simple text editor in eclipse to which I added some simple WordRule based syntax highlighting to highlight the language keywords. The problem is that when a keyword is part of an identifier (eg. "import" is part of "extra_import"), then "import" is highlighted in "extra_import". How can I stop eclipse to highlight a a keyword if it is only a sub string of another string? Anlther question; is there a regular expression based IRule? What is the purpose of WhitespaceRule? White spaces are usually not highlighted. Thaks

    Read the article

  • Hadoop in a RESTful Java Web Application - Conflicting URI templates

    - by user1231583
    I have a small Java Web Application in which I am using Jersey 1.12 and the Hadoop 1.0.0 JAR file (hadoop-core-1.0.0.jar). When I deploy my application to my JBoss 5.0 server, the log file records the following error: SEVERE: Conflicting URI templates. The URI template / for root resource class org.apache.hadoop.hdfs.server.namenode.web.resources.NamenodeWebHdfsMethods and the URI template / transform to the same regular expression (/.*)? To make sure my code is not the problem, I have created a fresh web application that contains nothing but the Jersey and Hadoop JAR files along with a small stub. My web.xml is as follows: <?xml version="1.0" encoding="UTF-8"?> <web-app version="2.5" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_2_5.xsd"> <servlet> <servlet-name>ServletAdaptor</servlet-name> <servlet-class>com.sun.jersey.spi.container.servlet.ServletContainer</servlet- class> <load-on-startup>1</load-on-startup> </servlet> <servlet-mapping> <servlet-name>ServletAdaptor</servlet-name> <url-pattern>/mytest/*</url-pattern> </servlet-mapping> <session-config> <session-timeout> 30 </session-timeout> </session-config> <welcome-file-list> <welcome-file>index.jsp</welcome-file> </welcome-file-list> </web-app> My simple RESTful stub is as follows: import javax.ws.rs.core.Context; import javax.ws.rs.core.UriInfo; import javax.ws.rs.Path; @Path("/mytest") public class MyRest { @Context private UriInfo context; public MyRest() { } } In my regular application, when I remove the Hadoop JAR files (and the code that is using Hadoop), everything works as I would expect. The deployment is successful and the remaining RESTful services work. I have also tried the Hadoop 1.0.1 JAR files and have had the same problems with the conflicting URL template in the NamenodeWebHdfsMethods class. Any suggestions or tips in solving this problem would be greatly appreciated.

    Read the article

  • Why is the destructor called when the CPython garbage collector is disabled?

    - by Frederik
    I'm trying to understand the internals of the CPython garbage collector, specifically when the destructor is called. So far, the behavior is intuitive, but the following case trips me up: Disable the GC. Create an object, then remove a reference to it. The object is destroyed and the __del__ method is called. I thought this would only happen if the garbage collector was enabled. Can someone explain why this happens? Is there a way to defer calling the destructor? import gc import unittest _destroyed = False class MyClass(object): def __del__(self): global _destroyed _destroyed = True class GarbageCollectionTest(unittest.TestCase): def testExplicitGarbageCollection(self): gc.disable() ref = MyClass() ref = None # The next test fails. # The object is automatically destroyed even with the collector turned off. self.assertFalse(_destroyed) gc.collect() self.assertTrue(_destroyed) if __name__=='__main__': unittest.main() Disclaimer: this code is not meant for production -- I've already noted that this is very implementation-specific and does not work on Jython.

    Read the article

  • Cannot instantiate abstract class or interface : problem while persisting

    - by sammy
    i have a class campaign that maintains a list of AdGroupInterfaces. im going to persist its implementation @Entity @Table(name = "campaigns") public class Campaign implements Serializable,Comparable<Object>,CampaignInterface { private static final long serialVersionUID = 1L; @Id @GeneratedValue(strategy = GenerationType.IDENTITY) private Long id; @OneToMany ( cascade = {CascadeType.ALL}, fetch = FetchType.EAGER, targetEntity=AdGroupInterface.class ) @org.hibernate.annotations.Cascade( value = org.hibernate.annotations.CascadeType.DELETE_ORPHAN ) @org.hibernate.annotations.IndexColumn(name = "CHOICE_POSITION") private List<AdGroupInterface> AdGroup; public Campaign() { super(); } public List<AdGroupInterface> getAdGroup() { return AdGroup; } public void setAdGroup(List<AdGroupInterface> adGroup) { AdGroup = adGroup; } public void set1AdGroup(AdGroupInterface adGroup) { if(AdGroup==null) AdGroup=new LinkedList<AdGroupInterface>(); AdGroup.add(adGroup); } } AdGroupInterface's implementation is AdGroups. when i add an adgroup to the list in campaign, campaign c; c.getAdGroupList().add(new AdGroups()), etc and save campaign it says"Cannot instantiate abstract class or interface :" AdGroupInterface its not recognizing the implementation just before persisting... Whereas Persisting adGroups separately works. when it is a member of another entity, it doesnt get persisted. import java.io.Serializable; import java.util.List; import javax.persistence.*; @Entity @DiscriminatorValue("1") @Table(name = "AdGroups") public class AdGroups implements Serializable,Comparable,AdGroupInterface{ /** * */ private static final long serialVersionUID = 1L; private Long Id; private String Name; private CampaignInterface Campaign; private MonetaryValue DefaultBid; public AdGroups(){ super(); } public AdGroups( String name, CampaignInterface campaign) { super(); this.Campaign=new Campaign(); Name = name; this.Campaign = campaign; DefaultBid = defaultBid; AdList=adList; } @Id @GeneratedValue(strategy = GenerationType.IDENTITY) @Column(name="AdGroup_Id") public Long getId() { return Id; } public void setId(Long id) { Id = id; } @Column(name="AdGroup_Name") public String getName() { return Name; } public void setName(String name) { Name = name; } @ManyToOne @JoinColumn (name="Cam_ID", nullable = true,insertable = false) public CampaignInterface getCampaign() { return Campaign; } public void setCampaign(CampaignInterface campaign) { this.Campaign = campaign; } } what am i missing?? please look into it ...

    Read the article

  • read subprocess stdout line by line

    - by Caspin
    My python script uses subprocess to call a linux utility that is very noisy. I want to store all of the output to a log file, but only show some of it to the user. I thought the following would work, but the output does show up in my application until the utility has produced a significant amount of output. #fake_utility.py, just generates lots of output over time import time i = 0 while True: print hex(i)*512 i += 1 time.sleep(0.5) #filters output import subprocess proc = subprocess.Popen(['python','fake_utility.py'],stdout.subprocess.PIPE) for line in proc.stdout: #the real code does filtering here print "test:", line.rstrip() The behavior I really want is for the filter script to print each line as it is received from the subprocess. Sorta like what tee does but with python code. What am I missing? Is this even possible?

    Read the article

  • MySQLdb not INSERTING, _mysql does fine.

    - by Mad_Casual
    Okay, I log onto the MySQL command-line client as root. I then open or otherwise run a python app using the MySQLdb module as root. When I check the results using python (IDLE), everything looks fine. When I use the MySQL command-line client, no INSERT has occurred. If I change things around to _mysql instead of MySQLdb, everything works fine. I'd appreciate any clarification(s). "Works" until IDLE/Virtual machine is reset: <pre><code>import MySQLdb db = MySQLdb.connect(user='root', passwd='*******',db='test') cursor = db.cursor() cursor.execute("""INSERT INTO test VALUES ('somevalue');""",)</code></end> Works: <pre><code>import _mysql db = _mysql.connect(user='root', passwd='*******',db='test') db.query("INSERT INTO test VALUES ('somevalue');")</code></end> System info: Intel x86 WinXP Python 2.5 MySQL 5.1.41 MySQL-Python 1.2.2

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 287 288 289 290 291 292 293 294 295 296 297 298  | Next Page >