Search Results

Search found 21947 results on 878 pages for 'static import'.

Page 294/878 | < Previous Page | 290 291 292 293 294 295 296 297 298 299 300 301  | Next Page >

  • In an ASP.NET MVC site, where would the JQuery code go?

    - by Maxim Z.
    I'm just getting started with ASP.NET MVC. I'm going to be using JQuery on the website I'm making, but I'm not really sure about one thing: where would JQuery code be placed? This concerns two things: Where do I import the JQuery JavaScript file? (I've been thinking that the Master page would be a good place to do this; am I right, or do I have to import it in each view?) Should all my JQuery code be referenced from the Master page (i.e., I store my code that uses JQuery in a separate .js file and reference it in a <script> tag)? Thanks in advance.

    Read the article

  • How to properly close a process with NppExec?

    - by Sam the Great
    I'm not sure what's going on here, but the following code continues running even after I end the process in the NppExec console with Ctrl-C (during the execution of the while loop). I restarted my computer to stop the Ctrl key sends. However, if I run the script in Window's cmd prompt, Ctrl-C ends the script just fine. import time import win32com.client shell = win32com.client.Dispatch("WScript.Shell") time.sleep(2) while True: shell.SendKeys('^') # Ctrl key time.sleep(0.5) The NppExec run command I used was: cmd /C python -u "$(FULL_CURRENT_PATH)" Let me know if there is any more information I can provide. Thanks.

    Read the article

  • Accessing running task scheduled with java.util.Timer

    - by jbatista
    I'm working on a Java project where I have created a class that looks like this (abridged version): public class Daemon { private static Timer[] timerarray=null; private static Daemon instance=null; protected Daemon() { ArrayList<Timer> timers = new ArrayList<Timer>(); Timer t = new Timer("My application"); t.schedule(new Worker(), 10000,30000); timers.add(t); //... timerarray = timers.toArray(new Timer[]{}); } public static Daemon getInstance() { if(instance==null) instance=new Daemon(); return instance; } public SomeClass getSomeValueFromWorker() { return theValue; } ///////////////////////////////////////////// private class Worker extends TimerTask { public Worker() {} public void run() { // do some work } public SomeReturnClass someMethod(SomeType someParameter) { // return something; } } ///////////////////////////////////////////// } I start this class, e.g. by invoking daemon.getInstance();. However, I'd like to have some way to access the running task objects' methods (for example, for monitoring the objects' state). The Java class java.util.Timer does not seem to provide the means to access the running object, it just schedules the object instance extending TimerTask. Are there ways to access the "running" object instanciated within a Timer? Do I have to subclass the Timer class with the appropriate methods to somehow access the instance (this "feels" strange, somehow)? I suppose someone might have done this before ... where can I find examples of this "procedure"? Thank you in advance for your feedback.

    Read the article

  • nhibernate : Repository Session Management

    - by frosty
    At the moment my repository has 2 constructors. When i call these from my mvc website i am alway calling first constructor and thus opening a new session. Should i been passing in the session. How should i be doing this. public CompanyRepository() { _session = NHibernateHelper.OpenSession(); } public CompanyRepository(ISession session) { _session = session; } public class NHibernateHelper { private static ISessionFactory _sessionFactory; private static ISessionFactory SessionFactory { get { if (_sessionFactory == null) { var configuration = new Configuration(); configuration.Configure(); configuration.AddAssembly(typeof(UserProfile).Assembly); configuration.SetProperty(NHibernate.Cfg.Environment.ConnectionStringName, System.Environment.MachineName); _sessionFactory = configuration.BuildSessionFactory(); } return _sessionFactory; } } public static ISession OpenSession() { return SessionFactory.OpenSession(); } } I'm using the Ninject IOC container ( very new to me ). I have the following container. How would i bind the ISession to the CompanyRepository. private class EStoreDependencies : NinjectModule { public override void Load() { Bind<ICompanyRepository>().To<CompanyRepository>(); Bind<IUserProfileRepository>().To<UserProfileRepository>(); Bind<IAddressRepository>().To<AddressRepository>(); Bind<IRolesService>().To<AspNetRoleProviderWrapper>(); Bind<IUserService>().To<AspNetMembershipProviderWrapper>(); Bind<ICurrentUserSerivce>().To<DefaultCurrentUserSerivce>(); Bind<IPasswordService>().To<AspNetMembershipProviderWrapper>(); Bind<IStatusResponseRepository>().To<StatusResponseRepository>(); Bind<ICategoryRepository>().To<CategoryRepository>(); Bind<IProductRepository>().To<ProductRepository>(); } }

    Read the article

  • How to use pom.xml/Maven to initialize a local thoughtsite (App Engine sample) project in Eclipse?

    - by ovr
    This sample app ("thoughtsite") for App Engine contains a pom.xml in its trunk: http://code.google.com/p/thoughtsite/source/browse/#svn/trunk But I don't know what command to run in Maven to set up the project locally. (The README doesn't mention anything about Maven.) I tried to just import the project code directly into Eclipse but it doesn't look like it's in an appropriate format for a direct import. So I assume I need to do something with Maven to get it set up correctly. I haven't really used Maven before so I'm not sure what command I would need to run to set everything up. The pom.xml seems like it downloads a bunch of dependencies for the project like the Spring jar files which I don't see anywhere else in the svn repository.

    Read the article

  • Scheme: what are the benefits of letrec?

    - by Ixmatus
    While reading "The Seasoned Schemer" I've begun to learn about letrec. I understand what it does (can be duplicated with a Y-Combinator) but the book is using it in lieu of recurring on the already defined function operating on arguments that remain static. An example of an old function using the defined function recurring on itself (nothing special): (define (substitute new old lat) (cond ((null? l) '()) ((eq? (car l) old) (cons new (substitute new old (cdr l)))) (else (cons (car l) (substitute new old (cdr l)))))) Now for an example of that same function but using letrec: (define (substitute new old lat) (letrec ((replace (lambda (l) (cond ((null? l) '()) ((eq? (car l) old) (cons new (replace (cdr l)))) (else (cons (car l) (replace (cdr l)))))))) (replace lat))) Aside from being slightly longer and more difficult to read I don't know why they are rewriting functions in the book to use letrec. Is there a speed enhancement when recurring over a static variable this way because you don't keep passing it?? Is this standard practice for functions with arguments that remain static but one argument that is reduced (such as recurring down the elements of a list)? Some input from more experienced Schemers/LISPers would help!

    Read the article

  • How do I use timezones with a datetime object in python?

    - by jidar
    How do I properly represent a different timezone in my timezone? The below example only works because I know that EDT is one hour ahead of me, so I can uncomment the subtraction of myTimeZone() import datetime, re from datetime import tzinfo class myTimeZone(tzinfo): """docstring for myTimeZone""" def utfoffset(self, dt): return timedelta(hours=1) def myDateHandler(aDateString): """u'Sat, 6 Sep 2008 21:16:33 EDT'""" _my_date_pattern = re.compile(r'\w+\,\s+(\d+)\s+(\w+)\s+(\d+)\s+(\d+)\:(\d+)\:(\d+)') day, month, year, hour, minute, second = _my_date_pattern.search(aDateString).groups() month = [ 'JAN', 'FEB', 'MAR', 'APR', 'MAY', 'JUN', 'JUL', 'AUG', 'SEP', 'OCT', 'NOV', 'DEC' ].index(month.upper()) + 1 dt = datetime.datetime( int(year), int(month), int(day), int(hour), int(minute), int(second) ) # dt = dt - datetime.timedelta(hours=1) # dt = dt - dt.tzinfo.utfoffset(myTimeZone()) return (dt.year, dt.month, dt.day, dt.hour, dt.minute, dt.second, 0, 0, 0) def main(): print myDateHandler("Sat, 6 Sep 2008 21:16:33 EDT") if __name__ == '__main__': main()

    Read the article

  • Gui problem after rewriting to MVC

    - by trevor_nise
    I'm practicing MVC style programming. I have a Mastermind game in a single file, working with no problems (maybe apart of the fact that "Check" button is invisible at start). http://paste.pocoo.org/show/226726/ But when I've rewritten it to model, view, controller files - when I click on empty Pin (that should be updated, and repainted with new color) - noting happens. Can anybody see any problems here ? I've tried placing repaint() in different places, but it simply does not work at all :/ Main : public class Main { public static void main(String[] args){ Model model = new Model(); View view = new View("Mastermind", 400, 590, model); Controller controller = new Controller(model, view); view.setVisible(true); } } Model : import java.util.Random; public class Model{ static final int LINE = 5, SCORE = 10, OPTIONS = 20; Pin pins[][] = new Pin[21][LINE]; int combination[] = new int[LINE]; int curPin = 0; int turn = 1; Random generator = new Random(); int repaintPin; boolean pinsRepaint=false; int pinsToRepaint; boolean isUpdate = true, isPlaying = true, isRowFull = false; static final int HIT_X[] = {270,290,310,290,310}, HIT_Y[] = {506,496,496,516,516}; public Model(){ for ( int i=0; i < SCORE; i++ ){ for ( int j = 0; j < LINE; j++ ){ pins[i][j] = new Pin(20,0); pins[i][j].setPosition(j*50+30,510-i*50); pins[i+SCORE][j] = new Pin(8,0); pins[i+SCORE][j].setPosition(HIT_X[j],HIT_Y[j]-i*50); } } for ( int i=0; i < LINE; i++ ){ pins[OPTIONS][i] = new Pin( 20, i+2 ); pins[OPTIONS][i].setPosition( 370,i * 50 + 56); } } void fillHole(int color) { pins[turn-1][curPin].setColor(color+1); pinsRepaint = true; pinsToRepaint = turn; curPin = (curPin+1) % LINE; if (curPin == 0){ isRowFull = true; } pinsRepaint = false; pinsToRepaint = 0; } void check() { int junkPins[] = new int[LINE], junkCode[] = new int[LINE]; int pinCount = 0, pico = 0; for ( int i = 0; i < LINE; i++ ) { junkPins[i] = pins[turn-1][i].getColor(); junkCode[i] = combination[i]; } for ( int i = 0; i < LINE; i++ ){ if (junkPins[i]==junkCode[i]) { pins[turn+SCORE][pinCount].setColor(1); pinCount++; pico++; junkPins[i] = 98; junkCode[i] = 99; } } for ( int i = 0; i < LINE; i++ ){ for ( int j = 0; j < LINE; j++ ) if (junkPins[i]==junkCode[j]) { pins[turn+SCORE][pinCount].setColor(2); pinCount++; junkPins[i] = 98; junkCode[j] = 99; j = LINE; } } pinsRepaint = true; pinsToRepaint = turn + SCORE; pinsRepaint = false; pinsToRepaint=0; if ( pico == LINE ){ isPlaying = false; } else if ( turn >= 10 ){ isPlaying = false; } else{ curPin = 0; isRowFull = false; turn++; } } void combination() { for ( int i = 0; i < LINE; i++ ){ combination[i] = generator.nextInt(6) + 1; } } } class Pin{ private int color, X, Y, radius; public Pin(){ X = 0; Y = 0; radius = 0; color = 0; } public Pin( int r,int c ){ X = 0; Y = 0; radius = r; color = c; } public int getX(){ return X; } public int getY(){ return Y; } public int getRadius(){ return radius; } public void setRadius(int r){ radius = r; } public void setPosition( int x,int y ){ this.X = x ; this.Y = y ; } public void setColor( int c ){ color = c; } public int getColor() { return color; } } View: import java.awt.*; import javax.swing.*; public class View extends Frame{ Model model; JButton checkAnswer; private JPanel button; private static final Color COLORS[] = {Color.black, Color.white, Color.red, Color.yellow, Color.green, Color.blue, new Color(7, 254, 250)}; public View(String name, int w, int h, Model m){ model = m; setTitle( name ); setSize( w,h ); setResizable( false ); this.setLayout(new BorderLayout()); button = new JPanel(); button.setSize( new Dimension(400, 100)); button.setVisible(true); checkAnswer = new JButton("Check"); checkAnswer.setSize( new Dimension(200, 30)); button.add( checkAnswer ); this.add( button, BorderLayout.SOUTH); button.setVisible(true); } @Override public void paint( Graphics g ) { g.setColor( new Color(238, 238, 238)); g.fillRect( 0,0,400,590); for ( int i=0; i < model.pins.length; i++ ) { paintPins(model.pins[i][0],g); paintPins(model.pins[i][1],g); paintPins(model.pins[i][2],g); paintPins(model.pins[i][3],g); paintPins(model.pins[i][4],g); } } @Override public void update( Graphics g ) { if ( model.isUpdate ) { paint(g); } else { model.isUpdate = true; paintPins(model.pins[model.repaintPin-1][0],g); paintPins(model.pins[model.repaintPin-1][1],g); paintPins(model.pins[model.repaintPin-1][2],g); paintPins(model.pins[model.repaintPin-1][3],g); paintPins(model.pins[model.repaintPin-1][4],g); } } void repaintPins( int pin ) { model.repaintPin = pin; model.isUpdate = false; repaint(); } public void paintPins(Pin p, Graphics g ){ int X = p.getX(); int Y = p.getY(); int color = p.getColor(); int radius = p.getRadius(); int x = X-radius; int y = Y-radius; if (color > 0){ g.setColor( COLORS[color]); g.fillOval( x,y,2*radius,2*radius ); } else{ g.setColor( new Color(238, 238, 238) ); g.drawOval( x,y,2*radius-1,2*radius-1 ); } g.setColor( Color.black ); g.drawOval( x,y,2*radius,2*radius ); } } Controller: import java.awt.*; import java.awt.event.*; public class Controller implements MouseListener, ActionListener { private Model model; private View view; public Controller(Model m, View v){ model = m; view = v; view.addWindowListener( new WindowAdapter(){ public void windowClosing(WindowEvent e){ System.exit(0); } }); view.addMouseListener(this); view.checkAnswer.addActionListener(this); model.combination(); } public void actionPerformed( ActionEvent e ) { if(e.getSource() == view.checkAnswer){ if(model.isRowFull){ model.check(); } } } public void mousePressed(MouseEvent e) { Point mouse = new Point(); mouse = e.getPoint(); if (model.isPlaying){ if (mouse.x > 350) { int button = 1 + (int)((mouse.y - 32) / 50); if ((button >= 1) && (button <= 5)){ model.fillHole(button); if(model.pinsRepaint){ view.repaintPins( model.pinsToRepaint ); } } } } } public void mouseClicked(MouseEvent e) {} public void mouseReleased(MouseEvent e){} public void mouseEntered(MouseEvent e) {} public void mouseExited(MouseEvent e) {} }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • setting url in yaml file for google app engin (page not found) problem

    - by mswallace
    I am new to python and I am super excited to learn. I am building my first app on app engin and I am not totally understanding why my yaml file is not resolving to the url that I set up. here is the code handlers: - url: .* script: main.py - url: /letmein/.* script: letmein.py so if I go to http://localhost:8080/letmein/ I get a link is brooken or page not found error. here is the python code that I have in letmein.py from google.appengine.ext import webapp from google.appengine.ext.webapp import util class LetMeInHandler(webapp.RequestHandler): def get(self): self.response.out.write('letmein!') def main(): application = webapp.WSGIApplication([('/letmein/', LetMeInHandler)], debug=True) util.run_wsgi_app(application) if __name__ == '__main__': main() thanks in advance for the help!

    Read the article

  • How to simplify this code or a better design?

    - by Tattat
    I am developing a game, the game have different mode. Easy, Normal, and Difficult. So, I'm thinking about how to store the game mode. My first idea is using number to represent the difficulty. Easy = 0 Normal = 1 Difficult = 2 So, my code will have something like this: switch(gameMode){ case 0: //easy break; case 1: //normal break; case 3: //difficult break; } But I think it have some problems, if I add a new mode, for example, "Extreme", I need to add case 4... ... it seems not a gd design. So, I am thinking making a gameMode object, and different gameMode is sub class of the super class gameMode. The gameMode object is something like this: class GameMode{ int maxEnemyNumber; int maxWeaponNumber; public static GameMode init(){ GameMode gm = GameMode(); gm.maxEnemyNumber = 0; gm.maxWeaponNumber = 0; return gm; } } class EasyMode extends GameMode{ public static GameMode init(){ GameMode gm = super.init(); gm.maxEnemyNumber = 10; gm.maxWeaponNumber = 100; return gm; } } class NormalMode extends GameMode{ public static GameMode init(){ GameMode gm = super.init(); gm.maxEnemyNumber = 20; gm.maxWeaponNumber = 80; return gm; } } But I think it seems too "bulky" to create an object to store gameMode, my "gameMode" only store different variables for game settings.... Is that any simple way to store data only instead of making an Object? thz u.

    Read the article

  • GWT combobox not displaying correctly

    - by James
    Hi, I am using GWT with GWT-EXT running in glassfish. I create 2 combo boxes as follows: import com.extjs.gxt.ui.client.widget.form.ComboBox; import com.extjs.gxt.ui.client.widget.form.SimpleComboBox; this.contentPanel = new ContentPanel(); this.contentPanel.setFrame(true); this.contentPanel.setSize((int)(Window.getClientWidth()*0.95), 600); this.contentPanel.setLayout(new FitLayout()); initWidget(this.contentPanel); SimpleComboBox<String> combo = new SimpleComboBox<String>(); combo.setEmptyText("Select a topic..."); combo.add("String1"); combo.add("String2"); this.contentPanel.add(combo); ComboBox combo1 = new ComboBox(); combo1.setEmptyText("Select a topic..."); ListStore topics = new ListStore(); topics.add("String3"); topics.add("String4"); combo.setStore(topics); this.contentPanel.add(combo1); When these are loaded in the browser (IE 8.0, Firefox 3.6.6 or Chrome 10.0) the combo boxes are shown but don't have the pull down arrow. They look like a text field with the "Select a topic..." text. When you select the text it disappears and if you type a character and then delete it the options are shown (i.e. pull down is invoked) however, there is still no pull down arrow. Does anyone know what the issue might be? Or how I can investigate further? Is it possible to see the actual HTML the browser is getting, when I View Page Source I only get the landing page HTML. As an additional I also have a import com.google.gwt.user.client.ui.Grid that does not render correctly. It is in table format but has no grid lines or header bar etc. Cheers, James

    Read the article

  • Converting IPv4 or IPv6 address to a long for comparisons

    - by Justin Akehurst
    In order to check if an IPv4 or IPv6 address is within a certain range, I've got code that takes an IPv4 address, turns that into a long, then does that same conversion on the upper/lower bound of the subnet, then checks to see if the long is between those values. I'd like to be able to do the same thing for IPv6, but saw nothing in the Python 2.6 standard libraries to allow me to do this, so I wrote this up: import socket, struct from array import array def ip_address_to_long(address): ip_as_long = None try: ip_as_long = socket.ntohl(struct.unpack('L', socket.inet_pton(socket.AF_INET, address))[0]) except socket.error: # try IPv6 try: addr = array('L', struct.unpack('!4L', socket.inet_pton(socket.AF_INET6, address))) addr.reverse() ip_as_long = sum(addr[i] << (i * 32) for i in range(len(addr))) except socket.error as se: raise ValueError('Invalid address') except Exception as e: print str(e) return ip_as_long My question is: Is there a simpler way to do this that I am missing? Is there a standard library call that can do this for me?

    Read the article

  • Haskell Ord instance with a Set

    - by mvid
    I have some code that I would like to use to append an edge to a Node data structure: import Data.Set (Set) import qualified Data.Set as Set data Node = Vertex String (Set Node) deriving Show addEdge :: Node -> Node -> Node addEdge (Vertex name neighbors) destination | Set.null neighbors = Vertex name (Set.singleton destination) | otherwise = Vertex name (Set.insert destination neighbors) However when I try to compile I get this error: No instance for (Ord Node) arising from a use of `Set.insert' As far as I can tell, Set.insert expects nothing but a value and a set to insert it into. What is this Ord?

    Read the article

  • Importing an Excel WorkSheet into a Datatable

    - by Nick LaMarca
    I have been asked to create import functionality in my application. I am getting an excel worksheet as input. The worksheet has column headers followed by data. The users want to simply select an xls file from their system, click upload and the tool deletes the table in the database and adds this new data. I thought the best way would be too bring the data into a datatable object and do a foeach for every row in the datatable insert row by row into the db. My question is what can anyone give me code to open an excel file, know what line the data starts on in the file, and import the data into a datable object?

    Read the article

  • What's the right way to use idlestartup on python 2.6.5?

    - by user210481
    Idlestartup is analogous to pythonstartup variable, but for IDLE, instead of command line. But it seems not to work properly. I'm using python 2.6.5 on Windows. I have the following script assigned to it: from pprint import pprint import sys newPath = 'C:\\Python26\test') sys.path.append(newPath) print "initial config loaded" Both variables Idlestartup and pythonstartup are assigned to the same file (script above). When running IDLE, pprint and sys are NOT available, the final message is NOT printed, but newPath was added to sys.path. Running the command line, pprint and sys are available, the final message is printed and newPath was added to sys.path. Is it a bug? Am I doing something wrong? Thanks

    Read the article

  • Threads in Java

    - by owca
    I've created simple program to test Threads in Java. I'd like it to print me numbers infinitely, like 123123123123123. Dunno why, but currently it stops after one cycle finishing 213 only. Anyone knows why ? public class Main { int number; public Main(int number){ } public static void main(String[] args) { new Infinite(2).start(); new Infinite(1).start(); new Infinite(3).start(); } } class Infinite extends Thread { static int which=1; static int order=1; int id; int number; Object console = new Object(); public Infinite(int number){ id = which; which++; this.number = number; } @Override public void run(){ while(1==1){ synchronized(console){ if(order == id){ System.out.print(number); order++; if(order >= which){ order = 1; } try{ console.notifyAll(); console.wait(); } catch(Exception e) {} } else { try{ console.notifyAll(); console.wait(); } catch(Exception e) {} } } try{Thread.sleep(0);} catch(Exception e) {} } } }

    Read the article

  • How to set the size of a wx.aui.AuiManager Pane that is centered?

    - by aF
    Hello, I have three panes with the InfoPane center option. I want to know how to set their size. Using this code: import wx import wx.aui class MyFrame(wx.Frame): def __init__(self, parent, id=-1, title='wx.aui Test', pos=wx.DefaultPosition, size=(800, 600), style=wx.DEFAULT_FRAME_STYLE): wx.Frame.__init__(self, parent, id, title, pos, size, style) self._mgr = wx.aui.AuiManager(self) # create several text controls text1 = wx.TextCtrl(self, -1, 'Pane 1 - sample text', wx.DefaultPosition, wx.Size(200,150), wx.NO_BORDER | wx.TE_MULTILINE) text2 = wx.TextCtrl(self, -1, 'Pane 2 - sample text', wx.DefaultPosition, wx.Size(200,150), wx.NO_BORDER | wx.TE_MULTILINE) text3 = wx.TextCtrl(self, -1, 'Main content window', wx.DefaultPosition, wx.Size(200,150), wx.NO_BORDER | wx.TE_MULTILINE) # add the panes to the manager self._mgr.AddPane(text1, wx.CENTER) self._mgr.AddPane(text2, wx.CENTER) self._mgr.AddPane(text3, wx.CENTER) # tell the manager to 'commit' all the changes just made self._mgr.Update() self.Bind(wx.EVT_CLOSE, self.OnClose) def OnClose(self, event): # deinitialize the frame manager self._mgr.UnInit() # delete the frame self.Destroy() app = wx.App() frame = MyFrame(None) frame.Show() app.MainLoop() I want to know what is called when we change the size of the panes. If you tell me that, I can do the rest by myself :)

    Read the article

  • Dynamically creating page definitions in Cherrypy

    - by Hugh
    Hi, I've been looking around the CherryPy documentation, but can't quite get my head around what I want to do. I suspect it might be more of a Python thing than a CherryPy thing... My current class looks something like this: import managerUtils class WebManager: def A(self, **kwds): return managerUtils.runAction("A", kwds) A.enabled = True def B(self, **kwds): return managerUtils.runAction("B", kwds) B.enabled = True def C(self, **kwds): return managerUtils.runAction("C", kwds) C.enabled = True Obviously there's a lot of repetition in here. in managerUtils.py, I have a dict that's something like: actions = {'A': functionToRunForA, 'B': functionToRunForB, 'C': functionToRunForC} Okay, so that's a slightly simplistic view of it, but I'm sure you get the idea. I want to be able to do something like: import managerUtils class WebManager: def __init__(self): for action in managerUtils.actions: f = registerFunction(action) f.enabled = True Any ideas of how to do this?

    Read the article

  • How to setup Xcode 3.1.4 with Perforce ?

    - by Azeworai
    Hi everyone, I've been trying to setup Xcode with Perforce for about 7 hours now and managed to get the Perforce Repository Authenticated within Xcode. The problem I have is, within the repositories window, I don't see any directories for me to check out. I can see the p4root login and client are ok with the tick on the repository log. When I try to Import an xcode project directory within the Perforce root directory- the import fails with '/Users/jackson/p4root/alpha/MessageTapper' is not under the Perforce root. I have p4d running on the local machine, and have created a user and workspace. The workspace has the directories in view. I'm hoping for someone to give me some direction or maybe point me to a good reference to how to set perforce up with xcode. Thanks!

    Read the article

  • Python: Converting a tuple to a string with 'err'

    - by skylarking
    Given this : import os import subprocess def check_server(): cl = subprocess.Popen(["nmap","10.7.1.71"], stdout=subprocess.PIPE) result = cl.communicate() print result check_server() check_server() returns this tuple: ('\nStarting Nmap 4.53 ( http://insecure.org ) at 2010-04-07 07:26 EDT\nInteresting ports on 10.7.1.71:\nNot shown: 1711 closed ports\nPORT STATE SERVICE\n21/tcp open ftp\n22/tcp open ssh\n80/tcp open http\n\nNmap done: 1 IP address (1 host up) scanned in 0.293 seconds\n', None) Changing the second line in the method to result, err = cl.communicate() results in check_server() returning : Starting Nmap 4.53 ( http://insecure.org ) at 2010-04-07 07:27 EDT Interesting ports on 10.7.1.71: Not shown: 1711 closed ports PORT STATE SERVICE 21/tcp open ftp 22/tcp open ssh 80/tcp open http Nmap done: 1 IP address (1 host up) scanned in 0.319 seconds Looks to be the case that the tuple is converted to a string, and the \n's are being stripped.... but how? What is 'err' and what exactly is it doing?

    Read the article

  • Programmatically sync the db in Django

    - by Attila Oláh
    I'm trying to sync my db from a view, something like this: from django import http from django.core import management def syncdb(request): management.call_command('syncdb') return http.HttpResponse('Database synced.') The issue is, it will block the dev server by asking for user input from the terminal. How can I pass it the '--noinput' option to prevent asking me anything? I have other ways of marking users as super-user, so there's no need for the user input, but I really need to call syncdb (and flush) programmatically, without logging on to the server via ssh. Any help is appreciated.

    Read the article

  • How to make scipy.interpolate give a an extrapolated result beyond the input range?

    - by Salim Fadhley
    I'm trying to port a program which uses a hand-rolled interpolator (developed by a mathematitian colleage) over to use the interpolators provided by scipy. I'd like to use or wrap the scipy interpolator so that it has as close as possible behavior to the old interpolator. A key difference between the two functions is that in our original interpolator - if the input value is above or below the input range, our original interpolator will extrapolate the result. If you try this with the scipy interpolator it raises a ValueError. Consider this program as an example: import numpy as np from scipy import interpolate x = np.arange(0,10) y = np.exp(-x/3.0) f = interpolate.interp1d(x, y) print f(9) print f(11) # Causes ValueError, because it's greater than max(x) Is there a sensible way to make it so that instead of crashing, the final line will simply do a linear extrapolate, continuing the gradients defined by the first and last two pouints to infinity. Note, that in the real software I'm not actually using the exp function - that's here for illustration only!

    Read the article

  • In Java it seems Public constructors are always a bad coding practice

    - by Adam Gent
    This maybe a controversial question and may not be suited for this forum (so I will not be insulted if you choose to close this question). It seems given the current capabilities of Java there is no reason to make constructors public ... ever. Friendly, private, protected are OK but public no. It seems that its almost always a better idea to provide a public static method for creating objects. Every Java Bean serialization technology (JAXB, Jackson, Spring etc...) can call a protected or private no-arg constructor. My questions are: I have never seen this practice decreed or written down anywhere? Maybe Bloch mentions it but I don't own is book. Is there a use case other than perhaps not being super DRY that I missed? EDIT: I explain why static methods are better. .1. For one you get better type inference. For example See Guava's http://code.google.com/p/guava-libraries/wiki/CollectionUtilitiesExplained .2. As a designer of the class you can later change what is returned with a static method. .3. Dealing with constructor inheritance is painful especially if you have to pre-calculate something.

    Read the article

  • How can I draw a log-normalized imshow plot with a colorbar representing the raw data in matplotlib

    - by Adam Fraser
    I'm using matplotlib to plot log-normalized images but I would like the original raw image data to be represented in the colorbar rather than the [0-1] interval. I get the feeling there's a more matplotlib'y way of doing this by using some sort of normalization object and not transforming the data beforehand... in any case, there could be negative values in the raw image. import matplotlib.pyplot as plt import numpy as np def log_transform(im): '''returns log(image) scaled to the interval [0,1]''' try: (min, max) = (im[im > 0].min(), im.max()) if (max > min) and (max > 0): return (np.log(im.clip(min, max)) - np.log(min)) / (np.log(max) - np.log(min)) except: pass return im a = np.ones((100,100)) for i in range(100): a[i] = i f = plt.figure() ax = f.add_subplot(111) res = ax.imshow(log_transform(a)) # the colorbar drawn shows [0-1], but I want to see [0-99] cb = f.colorbar(res) I've tried using cb.set_array, but that didn't appear to do anything, and cb.set_clim, but that rescales the colors completely. Thanks in advance for any help :)

    Read the article

< Previous Page | 290 291 292 293 294 295 296 297 298 299 300 301  | Next Page >