Search Results

Search found 21947 results on 878 pages for 'static import'.

Page 293/878 | < Previous Page | 289 290 291 292 293 294 295 296 297 298 299 300  | Next Page >

• read subprocess stdout line by line

  - by Caspin

  My python script uses subprocess to call a linux utility that is very noisy. I want to store all of the output to a log file, but only show some of it to the user. I thought the following would work, but the output does show up in my application until the utility has produced a significant amount of output. #fake_utility.py, just generates lots of output over time import time i = 0 while True: print hex(i)*512 i += 1 time.sleep(0.5) #filters output import subprocess proc = subprocess.Popen(['python','fake_utility.py'],stdout.subprocess.PIPE) for line in proc.stdout: #the real code does filtering here print "test:", line.rstrip() The behavior I really want is for the filter script to print each line as it is received from the subprocess. Sorta like what tee does but with python code. What am I missing? Is this even possible?

  Read the article

• Keep Hibernate Initializer from Crashing Program

  - by manyxcxi

  I have a Java program using a basic Hibernate session factory. I had an issue with a hibernate hbm.xml mapping file and it crashed my program even though I had the getSessionFactory() call in a try catch try { session = SessionFactoryUtil.getSessionFactory().openStatelessSession(); session.beginTransaction(); rh = getRunHistoryEntry(session); if(rh == null) { throw new Exception("No run history information found in the database for run id " + runId_ + "!"); } } catch(Exception ex) { logger.error("Error initializing hibernate"); } It still manages to break out of this try/catch and crash the main thread. How do I keep it from doing this? The main issue is I have a bunch of cleanup commands that NEED to be run before the main thread shuts down and need to be able to guarantee that even after a failure it still cleans up and goes down somewhat gracefully. The session factory looks like this: public class SessionFactoryUtil { private static final SessionFactory sessionFactory; static { try { // Create the SessionFactory from hibernate.cfg.xml sessionFactory = new Configuration().configure().buildSessionFactory(); } catch (Throwable ex) { // Make sure you log the exception, as it might be swallowed System.err.println("Initial SessionFactory creation failed." + ex); throw new ExceptionInInitializerError(ex); } } public static SessionFactory getSessionFactory() { try { return sessionFactory; } catch(Exception ex) { return null; } } }

  Read the article

• Is there any Java Decompiler that can correctly decompile calls to overloaded methods?

  - by mihi

  Consider this (IMHO simple) example: public class DecompilerTest { public static void main(String[] args) { Object s1 = "The", s2 = "answer"; doPrint((Object) "You should know:"); for (int i = 0; i < 2; i++) { doPrint(s1); doPrint(s2); s1 = "is"; s2 = new Integer(42); } System.out.println(); } private static void doPrint(String s1) { System.out.print("Wrong!"); } private static void doPrint(Object s1) { System.out.print(s1 + " "); } } Compile it with source/target level 1.1 without debug information (i.e. no local variable information should be present) and try to decompile it. I tried Jad, JD-GUI and Fernflower, and all of them got at least one of the call wrong (i. e. the program printed "Wrong!" at least once) Is there really no java decompiler that can infer the right casts so that it will not call the wrong overload?

  Read the article

• How to draw the "trail" in a maze solving application

  - by snow-spur

  Hello i have designed a maze and i want to draw a path between the cells as the 'person' moves from one cell to the next. So each time i move the cell a line is drawn Also i am using the graphics module The graphics module is an object oriented library Im importing from graphics import* from maze import* my circle which is my cell center = Point(15, 15) c = Circle(center, 12) c.setFill('blue') c.setOutline('yellow') c.draw(win) p1 = Point(c.getCenter().getX(), c.getCenter().getY()) this is my loop if mazez.blockedCount(cloc)> 2: mazez.addDecoration(cloc, "grey") mazez[cloc].deadend = True c.move(-25, 0) p2 = Point(getX(), getY()) line = graphics.Line(p1, p2) cloc.col = cloc.col - 1 Now it says getX not defined every time i press a key is this because of p2???

  Read the article

• Looking for Reachability (2.0) Use Case Validation

  - by user350243

  There is so much info out there on using Apple's Reachability example, and so much is conflicting. I'm trying to find out of I'm using it (Reachability 2.0) correctly below. My App use case is this: If an internet connection is available through any means (wifi, LAN, Edge, 3G, etc.) a UIButton ("See More") is visible on various views. If no connection, the button is not visible. The "See More" part is NOT critical in any way to the app, it's just an add-on feature. "See More" could be visible or not anytime during the application lifecycle as connection is established or lost. Here's how I did it - Is this correct and/or is there a better way? Any help is Greatly Appreciated! lq // AppDelegate.h #import "RootViewController.h" @class Reachability; @interface AppDelegate : NSObject <UIApplicationDelegate> { UIWindow *window; UINavigationController *navigationController; RootViewController *rootViewController; Reachability* hostReach; // NOT USED: Reachability* internetReach; // NOT USED: Reachability* wifiReach; } @property (nonatomic, retain) IBOutlet UIWindow *window; @property (nonatomic, retain) IBOutlet UINavigationController *navigationController; @property (nonatomic, retain) IBOutlet RootViewController *rootViewController; @end // AppDelegate.m #import "AppDelegate.h" #import "Reachability.h" #define kHostName @"www.somewebsite.com" @implementation AppDelegate @synthesize window; @synthesize navigationController; @synthesize rootViewController; - (void) updateInterfaceWithReachability: (Reachability*) curReach { if(curReach == hostReach) { NetworkStatus netStatus = [curReach currentReachabilityStatus]; BOOL connectionRequired = [curReach connectionRequired]; // Set a Reachability BOOL value flag in rootViewController // to be referenced when opening various views if ((netStatus != ReachableViaWiFi) && (netStatus != ReachableViaWWAN)) { rootViewController.bConnection = (BOOL *)0; } else { rootViewController.bConnection = (BOOL *)1; } } } - (void) reachabilityChanged: (NSNotification* )note { Reachability* curReach = [note object]; NSParameterAssert([curReach isKindOfClass: [Reachability class]]); [self updateInterfaceWithReachability: curReach]; } - (void)applicationDidFinishLaunching:(UIApplication *)application { // NOTE: #DEFINE in Reachability.h: // #define kReachabilityChangedNotification @"kNetworkReachabilityChangedNotification" [[NSNotificationCenter defaultCenter] addObserver: self selector: @selector(reachabilityChanged:) name: kReachabilityChangedNotification object: nil]; hostReach = [[Reachability reachabilityWithHostName: kHostName] retain]; [hostReach startNotifer]; [self updateInterfaceWithReachability: hostReach]; [window addSubview:[navigationController view]]; [window makeKeyAndVisible]; } - (void)dealloc { [navigationController release]; [rootViewController release]; [window release]; [super dealloc]; } @end

  Read the article

• Python and Plone help

  - by Grenko

  Im using the plone cms and am having trouble with a python script. I get a name error "the global name 'open' is not defined". When i put the code in a seperate python script it works fine and the information is being passed to the python script becuase i can print the query. Code is below: #Import a standard function, and get the HTML request and response objects. from Products.PythonScripts.standard import html_quote request = container.REQUEST RESPONSE = request.RESPONSE # Insert data that was passed from the form query=request.query #print query f = open("blast_query.txt","w") for i in query: f.write(i) return printed I also have a second question, can i tell python to open a file in in a certain directory for example, If the script is in a certain loaction i.e. home folder, but i want the script to open a file at home/some_directory/some_directory can it be done?

  Read the article

• Python subprocess.Popen

  - by Albert

  I have that code: #!/usr/bin/python -u localport = 9876 import sys, re, os from subprocess import * tun = Popen(["./newtunnel", "22", str(localport)], stdout=PIPE, stderr=STDOUT) print "** Started tunnel, waiting to be ready ..." for l in tun.stdout: sys.stdout.write(l) if re.search("Waiting for connection", l): print "** Ready for SSH !" break The "./newtunnel" will not exit, it will constantly output more and more data to stdout. However, that code will not give any output and just keeps waiting in the tun.stdout. When I kill the newtunnel process externally, it flushes all the data to tun.stdout. So it seems that I can't get any data from the tun.stdout while it is still running. Why is that? How can I get the information? Note that the default bufsize for Popen is 0 (unbuffered). I can also specify bufsize=0 but that doesn't change anything.

  Read the article

• Importing an Excel WorkSheet into a Datatable

  - by Nick LaMarca

  I have been asked to create import functionality in my application. I am getting an excel worksheet as input. The worksheet has column headers followed by data. The users want to simply select an xls file from their system, click upload and the tool deletes the table in the database and adds this new data. I thought the best way would be too bring the data into a datatable object and do a foeach for every row in the datatable insert row by row into the db. My question is what can anyone give me code to open an excel file, know what line the data starts on in the file, and import the data into a datable object?

  Read the article

• python lxml problem

  - by David ???

  I'm trying to print/save a certain element's HTML from a web-page. I've retrieved the requested element's XPath from firebug. All I wish is to save this element to a file. I don't seem to succeed in doing so. (tried the XPath with and without a /text() at the end) I would appreciate any help, or past experience. 10x, David import urllib2,StringIO from lxml import etree url='http://www.tutiempo.net/en/Climate/Londres_Heathrow_Airport/12-2009/37720.htm' seite = urllib2.urlopen(url) html = seite.read() seite.close() parser = etree.HTMLParser() tree = etree.parse(StringIO.StringIO(html), parser) xpath = "/html/body/table/tbody/tr/td[2]/div/table/tbody/tr[6]/td/table/tbody/tr/td[3]/table/tbody/tr[3]/td/table/tbody/tr/td/table/tbody/tr/td/table/tbody/text()" elem = tree.xpath(xpath) print elem[0].strip().encode("utf-8")

  Read the article

• Java map with values limited by key's type parameter

  - by Ashley Mercer

  Is there a way in Java to have a map where the type parameter of a value is tied to the type parameter of a key? What I want to write is something like the following: public class Foo { // This declaration won't compile - what should it be? private static Map<Class<T>, T> defaultValues; // These two methods are just fine public static <T> void setDefaultValue(Class<T> clazz, T value) { defaultValues.put(clazz, value); } public static <T> T getDefaultValue(Class<T> clazz) { return defaultValues.get(clazz); } } That is, I can store any default value against a Class object, provided the value's type matches that of the Class object. I don't see why this shouldn't be allowed since I can ensure when setting/getting values that the types are correct. EDIT: Thanks to cletus for his answer. I don't actually need the type parameters on the map itself since I can ensure consistency in the methods which get/set values, even if it means using some slightly ugly casts.

  Read the article

• one variable and multiple controllers..

  - by Simon

  I'm working on a web application, using the CAKEPHP framework. Herefor i need to request one variable on multiple pages (all pages have different controllers). it is oubvious that i get a error on several pages, since the variable isn't declared in all the different controllers. Is there a workaround for this? i've already tried the app:: import to import a controller in another controller, but this doens't seem to work (still get a undefined variable error). Thnx for your cooperation! Regards, Simon

  Read the article

• Color picker does not give gradient appearance

  - by ykaratoprak

  i added below codes. But it generates to me 16 color. but i need 16 color between "red" and "khaki". i don't need gradient flow. My colors look like gradient flow. My colors must not closer to each other. Because i will use this codes return values in chart columns. they are too near each other. static class Program { [STAThread] static void Main() { Form form = new Form(); Color start = Color.Red, end = Color.Khaki; for (int i = 0; i < 16; i++) { int r = Interpolate(start.R, end.R, 15, i), g = Interpolate(start.G, end.G, 15, i), b = Interpolate(start.B, end.B, 15, i); Button button = new Button(); button.Dock = DockStyle.Top; button.BackColor = Color.FromArgb(r, g, b); form.Controls.Add(button); button.BringToFront(); } Application.Run(form); } static int Interpolate(int start, int end, int steps, int count) { float s = start, e = end, final = s + (((e - s) / steps) * count); return (int)final; } }

  Read the article

• error LNK2001: unresolved external symbol

  - by numerical25

  I am receiving this error >GXRenderManager.obj : error LNK2001: unresolved external symbol "private: static class GXRenderer * GXRenderManager::renderDevice" (?renderDevice@GXRenderManager@@0PAVGXRenderer@@A) The following is my code... GXDX.h class GXDX: public GXRenderer { public: void Render(); void StartUp(); }; GXGL.h class GXGL: public GXRenderer { public: void Render(); void StartUp(); }; GXRenderer class GXRenderer { public: virtual void Render() = 0; virtual void StartUp() = 0; }; GXRenderManager.h #ifndef GXRM #define GXRM #include <windows.h> #include "GXRenderer.h" #include "GXDX.h" #include "GXGL.h" enum GXDEVICE { DIRECTX, OPENGL }; class GXRenderManager { public: static int Ignite(GXDEVICE); private: static GXRenderer *renderDevice; }; #endif GXRenderManager.cpp #include "GXRenderManager.h" int GXRenderManager::Ignite(GXDEVICE DeviceType) { switch(DeviceType) { case DIRECTX: GXRenderManager::renderDevice = new GXDX; return 1; break; case OPENGL: GXRenderManager::renderDevice = new GXGL; return 1; break; default: return 0; } } main.cpp #include "GXRenderManager.h" int WINAPI WinMain(HINSTANCE hInstance, HINSTANCE hPrevInstance, LPSTR lpCmdLine, int nCmdShow) { return 0; } I am not trying to get it to do anything. I am just trying to compile with no errors. I am new with all this so if anyone can give me a hand. that will be great. thanks

  Read the article

• return an ArrayList method

  - by Bopeng Liu

  This is a drive method for two other classes. which i posted here http://codereview.stackexchange.com/questions/33148/book-program-with-arraylist I need some help for the private static ArrayList getAuthors(String authors) method. I am kind a beginner. so please help me finish this drive method. or give me some directions. Instruction some of the elements of the allAuthors array contain asterisks “*” between two authors names. The getAuthors method uses this asterisk as a delimiter between names to store them separately in the returned ArrayList of Strings. import java.util.ArrayList; public class LibraryDrive { public static void main(String[] args) { String[] titles = { "The Hobbit", "Acer Dumpling", "A Christmas Carol", "Marley and Me", "Building Java Programs", "Java, How to Program" }; String[] allAuthors = { "Tolkien, J.R.", "Doofus, Robert", "Dickens, Charles", "Remember, SomeoneIdont", "Reges, Stuart*Stepp, Marty", "Deitel, Paul*Deitel, Harvery" }; ArrayList<String> authors = new ArrayList<String>(); ArrayList<Book> books = new ArrayList<Book>(); for (int i = 0; i < titles.length; i++) { authors = getAuthors(allAuthors[i]); Book b = new Book(titles[i], authors); books.add(b); authors.remove(0); } Library lib = new Library(books); System.out.println(lib); lib.sort(); System.out.println(lib); } private static ArrayList<String> getAuthors(String authors) { ArrayList books = new ArrayList<String>(); // need help here. return books; } }

  Read the article

• Why is the destructor called when the CPython garbage collector is disabled?

  - by Frederik

  I'm trying to understand the internals of the CPython garbage collector, specifically when the destructor is called. So far, the behavior is intuitive, but the following case trips me up: Disable the GC. Create an object, then remove a reference to it. The object is destroyed and the __del__ method is called. I thought this would only happen if the garbage collector was enabled. Can someone explain why this happens? Is there a way to defer calling the destructor? import gc import unittest _destroyed = False class MyClass(object): def __del__(self): global _destroyed _destroyed = True class GarbageCollectionTest(unittest.TestCase): def testExplicitGarbageCollection(self): gc.disable() ref = MyClass() ref = None # The next test fails. # The object is automatically destroyed even with the collector turned off. self.assertFalse(_destroyed) gc.collect() self.assertTrue(_destroyed) if __name__=='__main__': unittest.main() Disclaimer: this code is not meant for production -- I've already noted that this is very implementation-specific and does not work on Jython.

  Read the article

• Threads in Java

  - by owca

  I've created simple program to test Threads in Java. I'd like it to print me numbers infinitely, like 123123123123123. Dunno why, but currently it stops after one cycle finishing 213 only. Anyone knows why ? public class Main { int number; public Main(int number){ } public static void main(String[] args) { new Infinite(2).start(); new Infinite(1).start(); new Infinite(3).start(); } } class Infinite extends Thread { static int which=1; static int order=1; int id; int number; Object console = new Object(); public Infinite(int number){ id = which; which++; this.number = number; } @Override public void run(){ while(1==1){ synchronized(console){ if(order == id){ System.out.print(number); order++; if(order >= which){ order = 1; } try{ console.notifyAll(); console.wait(); } catch(Exception e) {} } else { try{ console.notifyAll(); console.wait(); } catch(Exception e) {} } } try{Thread.sleep(0);} catch(Exception e) {} } } }

  Read the article

• to connect matlab with java

  - by user304005

  Through the below given code I was able to connect to matlab. But I was not able to execute the script file containing matlab code...Please help me to modify the code so as to execute the matlab code.... Here luck2 is a .m file.... import java.io.InputStreamReader; import java.io.*; public class matlab { private static File myMATLABScript; public static String runScript(File luck2) { String output = "" ; String error = ""; try { String commandToRun ="C:\\Program Files\\MATLAB\\R2009a\\bin\\matlab -nodisplay <" + "Z:\\sem\\java\\luck2"; //String commandToRun = "matlab -nosplash -r myMATLABScript -nodisplay -nodesktop < " + opentxt; System.out.println(commandToRun); Process p = Runtime.getRuntime().exec(commandToRun); String s; BufferedReader stdInput = new BufferedReader(new InputStreamReader(p.getInputStream())); BufferedReader stdError = new BufferedReader(new InputStreamReader(p.getErrorStream())); System.out.println("\nHere is the standard output of the command:\n"); while ((s = stdInput.readLine()) != null) { System.out.println("haiiiiiiiiiiii"); output = s + "\n"; System.out.println(s); } while ((s = stdError.readLine()) != null) { error = s + "\n"; System.out.println(s); } } catch (Exception e) { System.out.println("exception happened here what I know:"); e.printStackTrace(); System.exit(-1); } return output + error; } public static void main(String[] args) throws IOException { matlab m = new matlab(); matlab.runScript(myMATLABScript); //matlab.runScript(); } }

  Read the article

• java timer on current instance

  - by hspim

  import java.util.Scanner; import java.util.Timer; import java.util.TimerTask; public class Boggle { Board board; Player player; Timer timer; boolean active; static Scanner in = new Scanner(System.in); public Boggle() { board = new Board(4); timer = new Timer(); } public void newGame() { System.out.println("Please enter your name: "); String line = in.nextLine(); player = new Player(line); active = true; board.shuffle(); System.out.println(board); timer.schedule(new timesUP(), 20000); while(active) { String temp = in.nextLine(); player.addGuess(temp); } } public void endGame() { active = false; int score = Scoring.calculate(player, board); System.out.println(score); } class timesUP extends TimerTask { public void run() { endGame(); } } public static void main(String[] args) { Boggle boggle = new Boggle(); boggle.newGame(); } } I have the above class which should perform a loop for a given length of time and afterwards invoke an instance method. Essentially I need the loop in newGame() to run for a minute or so before endGame() is invoked on the current instance. However, using the Timer class I'm not sure how I would invoke the method I need on the current instance since I can't pass any parameters to the timertasks run method? Is there an easy way to do this or am I going about this the wrong way? (note: this is a console project only, no GUI) ========== code edited I've changed the code to the above following the recommendations, and it works almost as I expect however the thread still doesnt seem to end properly. I was the while loop would die and control would eventually come back to the main method. Any ideas?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Using Doctrine to abstract CRUD operations

  - by TomWilsonFL

  This has bothered me for quite a while, but now it is necessity that I find the answer. We are working on quite a large project using CodeIgniter plus Doctrine. Our application has a front end and also an admin area for the company to check/change/delete data. When we designed the front end, we simply consumed most of the Doctrine code right in the controller: //In semi-pseudocode function register() { $data = get_post_data(); if (count($data) && isValid($data)) { $U = new User(); $U->fromArray($data); $U->save(); $C = new Customer(); $C->fromArray($data); $C->user_id = $U->id; $C->save(); redirect_to_next_step(); } } Obviously when we went to do the admin views code duplication began and considering we were in a "get it DONE" mode so it now stinks with code bloat. I have moved a lot of functionality (business logic) into the model using model methods, but the basic CRUD does not fit there. I was going to attempt to place the CRUD into static methods, i.e. Customer::save($array) [would perform both insert and update depending on if prikey is present in array], Customer::delete($id), Customer::getObj($id = false) [if false, get all data]. This is going to become painful though for 32 model objects (and growing). Also, at times models need to interact (as the interaction above between user data and customer data), which can't be done in a static method without breaking encapsulation. I envision adding another layer to this (exposing web services), so knowing there are going to be 3 "controllers" at some point I need to encapsulate this CRUD somewhere (obviously), but are static methods the way to go, or is there another road? Your input is much appreciated.

  Read the article

• How do I target a div without a class or id but with all these specific style-attributes

  - by Ben

  I'm restyling a certain page where I don't have access to all the source-HTML. So I'm left over with some hard to target elements within a page I need removed. For example the page is swamped with <div style="float: left; width: 10.25px; height: 284px;"></div>. To get rid of them I tried this in CSS: div[style="float: left; width: 10.25px; height: 284px;"] { display:none !important; } I'd like to fix this using CSS, because the the HTML that needs to be removed is updated using ajax. How do I target a div without a class or id but with all these specific style-attributes? Some more of the source-code (took a while to organize the parsed source): <div> <span class="Block BigPhotoList_Block"> <span class="Photo BigPhotoList_Photo" style="height: 200px"> <a href="/Webwinkel-Product-83760187/Le-Coq-Sportif-Angers-Low.html.html"> <span style="background-image:url(http://61955.static.securearea.eu/Files/2/61000/61955/ProductPhotos/MaxContent/144036303.jpg);" class="Canvas BigPhotoList_Canvas" title="Le-Coq-Sportif-Angers-Low"></span> </a> </span> <span class="Title BigPhotoList_Title"> <a href="/Webwinkel-Product-83760187/Le-Coq-Sportif-Angers-Low.html.html"> Le Coq Sportif Angers Low </a> </span> <span class="Price BigPhotoList_Price" style="font-size: 120%;"> € 89,95 </span> </span> <div style="float: left; width: 10.25px; height: 284px; border-right: 1px dashed #A0A0A0;" class="BigPhotoList_Stippel"></div> <div style="float: left; width: 10.25px; height: 284px;"></div> <span class="Block BigPhotoList_Block"> <span class="Photo BigPhotoList_Photo" style="height: 200px"> <a href="/Webwinkel-Product-83760185/Le-Coq-Sportif-Auveurne-Low.html"> <span style="background-image:url(http://61955.static.securearea.eu/Files/2/61000/61955/ProductPhotos/MaxContent/144036301.jpg);" class="Canvas BigPhotoList_Canvas" title="Le-Coq-Sportif-Auveurne-Low"></span> </a> </span> <span class="Title BigPhotoList_Title"> <a href="/Webwinkel-Product-83760185/Le-Coq-Sportif-Auveurne-Low.html"> Le Coq Sportif Auveurne Low </a> </span> <span class="Price BigPhotoList_Price" style="font-size: 120%;"> € 79,95 </span> </span> <div style="float: left; width: 10.25px; height: 284px; border-right: 1px dashed #A0A0A0;" class="BigPhotoList_Stippel"></div> <div style="float: left; width: 10.25px; height: 284px;"></div> <span class="Block BigPhotoList_Block"> <span class="Photo BigPhotoList_Photo" style="height: 200px"> <a href="/Webwinkel-Product-83760191/Le-Coq-Sportif-Bordeaux-Low.html"> <span style="background-image:url(http://61955.static.securearea.eu/Files/2/61000/61955/ProductPhotos/MaxContent/144036307.jpg);" class="Canvas BigPhotoList_Canvas" title="Le-Coq-Sportif-Bordeaux-Low"></span> </a> </span> <span class="Title BigPhotoList_Title"> <a href="/Webwinkel-Product-83760191/Le-Coq-Sportif-Bordeaux-Low.html"> Le Coq Sportif Bordeaux Low </a> </span> <span class="Price BigPhotoList_Price" style="font-size: 120%;"> € 99,95 </span> </span> <span class="Block BigPhotoList_Block"> <span class="Photo BigPhotoList_Photo" style="height: 200px"> <a href="/Webwinkel-Product-83760181/Le-Coq-Sportif-Cannet-Low.html"> <span style="background-image:url(http://61955.static.securearea.eu/Files/2/61000/61955/ProductPhotos/MaxContent/144036297.jpg);" class="Canvas BigPhotoList_Canvas" title="Le-Coq-Sportif-Cannet-Low"></span> </a> </span> <span class="Title BigPhotoList_Title"> <a href="/Webwinkel-Product-83760181/Le-Coq-Sportif-Cannet-Low.html"> Le Coq Sportif Cannet Low </a> </span> <span class="Discount BigPhotoList_Discount" style="font-size: 120%;"> € 99,95 </span> <span class="Price BigPhotoList_Price" style="font-size: 120%;"> € 94,95 </span> </span> <div style="float: left; width: 10.25px; height: 284px; border-right: 1px dashed #A0A0A0;" class="BigPhotoList_Stippel"></div> <div style="float: left; width: 10.25px; height: 284px;"></div> <span class="Block BigPhotoList_Block"> <span class="Photo BigPhotoList_Photo" style="height: 200px"> <a href="/Webwinkel-Product-83760183/Le-Coq-Sportif-Rodez-Low.html"> <span style="background-image:url(http://61955.static.securearea.eu/Files/2/61000/61955/ProductPhotos/MaxContent/144036299.jpg);" class="Canvas BigPhotoList_Canvas" title="Le-Coq-Sportif-Rodez-Low"></span> </a> </span> <span class="Title BigPhotoList_Title"> <a href="/Webwinkel-Product-83760183/Le-Coq-Sportif-Rodez-Low.html"> Le Coq Sportif Rodez Low </a> </span> <span class="Price BigPhotoList_Price" style="font-size: 120%;"> € 99,95 </span> </span> <div style="float: left; width: 10.25px; height: 284px; border-right: 1px dashed #A0A0A0;" class="BigPhotoList_Stippel"></div> <div style="float: left; width: 10.25px; height: 284px;"></div> <span class="Block BigPhotoList_Block"> <span class="Photo BigPhotoList_Photo" style="height: 200px"> <a href="/Webwinkel-Product-83760189/Le-Coq-Sportif-Sedan-Low.html"> <span style="background-image:url(http://61955.static.securearea.eu/Files/2/61000/61955/ProductPhotos/MaxContent/144036305.jpg);" class="Canvas BigPhotoList_Canvas" title="Le-Coq-Sportif-Sedan-Low"></span> </a> </span> <span class="Title BigPhotoList_Title"> <a href="/Webwinkel-Product-83760189/Le-Coq-Sportif-Sedan-Low.html"> Le Coq Sportif Sedan Low </a> </span> <span class="Discount BigPhotoList_Discount" style="font-size: 120%;"> € 109,95 </span> <span class="Price BigPhotoList_Price" style="font-size: 120%;"> € 99,95 </span> </span> </div>

  Read the article

• Whats wrong with this function? .each related

  - by Ritz

  When I uncomment the alert the data is there... like: { 'Huishoudelijke hulp': 'Huishoudelijke hulp', 'Verpleging thuis': 'Verpleging thuis', 'Verzorging thuis': 'Verzorging thuis', '24 uurs zorg': '24 uurs zorg', 'Ondersteunende begeleiding': 'Ondersteunende begeleiding', } But instead of populating the key and the value it takes the whole var and start to create a key and value pair for each character. You can see this in action here: http://www.zorgzuster-zeeland.nl/site/static/calendar_test.php create a task in the calendar and then try to edit the task by clicking on it. It should populate the dropdown field properly. When i create a static var with the same values the dropdown works. static variable var zvmlist = { 'Huishoudelijke hulp': 'Huishoudelijke hulp', 'Verpleging thuis': 'Verpleging thuis', 'Verzorging thuis': 'Verzorging thuis', '24 uurs zorg': '24 uurs zorg', 'Ondersteunende begeleiding': 'Ondersteunende begeleiding', }; This is my function, anybody has a clue? $.get('get_zorgvormen.php', function(zvmlist) { //alert("Data Loaded: " + zvmlist); $.each(zvmlist, function(key, value) { var selected=''; if(key==eventdata.title){var selected='selected' } $('<option value="'+key+'" '+selected+'>'+value+'</option>').appendTo($('#calendar_edit_entry_form_title')); }); });

  Read the article

• Python Imaging: YCbCr problems

  - by daver

  Hi, I'm doing some image processing in Python using PIL, I need to extract the luminance layer from a series of images, and do some processing on that using numpy, then put the edited luminance layer back into the image and save it. The problem is, I can't seem to get any meaningful representation of my Image in a YCbCr format, or at least I don't understand what PIL is giving me in YCbCr. PIL documentation claims YCbCr format gives three channels, but when I grab the data out of the image using np.asarray, I get 4 channels. Ok, so I figure one must be alpha. Here is some code I'm using to test this process: import Image as im import numpy as np pengIm = im.open("Data\\Test\\Penguins.bmp") yIm = pengIm.convert("YCbCr") testIm = np.asarray(yIm) grey = testIm[:,:,0] grey = grey.astype('uint8') greyIm = im.fromarray(grey, "L") greyIm.save("Data\\Test\\grey.bmp") I'm expecting a greyscale version of my image, but what I get is this jumbled up mess: http://i.imgur.com/zlhIh.png Can anybody explain to me where I'm going wrong? The same code in matlab works exactly as I expect.

  Read the article

• How much does Website Development cost nowadays?

  - by Andreas Grech

  I am thinking of setting up my own freelance business but coming from a workplace that offers a particular service to huge clients, I do not know what are the current charges for websites are nowadays. I know that as technology just keeps changing and changing (most of the time, for the better...), the amount you charge for a single website is constantly differing. Like for example, I don't think static websites (with just static html pages) are that expensive today, no? (as i said, I might be mistaken since I haven't really touched on this freelance industry yet) So, freelance web-developers out there, can you give me estimates on how much you charge for your clients? Some examples of websites that I want to know an approx charge: ~10 static html pages ~10 dhtml pages (with maybe a flasy menu on the top/side) Database driven websites with a standard CMS (be it the one you developed, or an existing one) Database driven but with a custom-built cms for the particular client Using an existing template for a design Starting the design from scratch etc... I know that the normally clients don't really care about the technologies used to construct their websites, but do you charge differently according to which technology you use to build the website with?; as in, is the technology a factor when setting the price? ...being ASP.Net, PHP, Ruby On Rails etc... Also, how do you go on about charging your clients for your services? What are the major factors that you consider when setting a price tag for a website to a client ? And better yet, how do you even find prospective clients? <= [or should I leave this question for a different post?] Btw, in your post, also mention some numbers (in cash values, be it in USD, GBP, EUR or anything) because I want to be able to take calculate some averages from this post when some answers stack up

  Read the article

• How do I use timezones with a datetime object in python?

  - by jidar

  How do I properly represent a different timezone in my timezone? The below example only works because I know that EDT is one hour ahead of me, so I can uncomment the subtraction of myTimeZone() import datetime, re from datetime import tzinfo class myTimeZone(tzinfo): """docstring for myTimeZone""" def utfoffset(self, dt): return timedelta(hours=1) def myDateHandler(aDateString): """u'Sat, 6 Sep 2008 21:16:33 EDT'""" _my_date_pattern = re.compile(r'\w+\,\s+(\d+)\s+(\w+)\s+(\d+)\s+(\d+)\:(\d+)\:(\d+)') day, month, year, hour, minute, second = _my_date_pattern.search(aDateString).groups() month = [ 'JAN', 'FEB', 'MAR', 'APR', 'MAY', 'JUN', 'JUL', 'AUG', 'SEP', 'OCT', 'NOV', 'DEC' ].index(month.upper()) + 1 dt = datetime.datetime( int(year), int(month), int(day), int(hour), int(minute), int(second) ) # dt = dt - datetime.timedelta(hours=1) # dt = dt - dt.tzinfo.utfoffset(myTimeZone()) return (dt.year, dt.month, dt.day, dt.hour, dt.minute, dt.second, 0, 0, 0) def main(): print myDateHandler("Sat, 6 Sep 2008 21:16:33 EDT") if __name__ == '__main__': main()

  Read the article

< Previous Page | 289 290 291 292 293 294 295 296 297 298 299 300  | Next Page >