Search Results

Search found 10883 results on 436 pages for 'ms expression'.

Page 319/436 | < Previous Page | 315 316 317 318 319 320 321 322 323 324 325 326  | Next Page >

  • Posting an action works... but no image

    - by Brian Rice
    I'm able to post an open graph action to facebook using the following url: https://graph.facebook.com/me/video.watches with the following post data: video=http://eqnetwork.com/home/video.html?f=8e7b4f27-8cbd-4430-84df-d9ccb46da45f.mp4 It seems to be getting the title from the open graph metatags at the "video" object. But, it's not getting the image (even though one is specified in the metatag "og:image"). Also, if I add this to the post data: picture=http://eqnetwork.com/icons/mgen/overplayThumbnail.ms?drid=14282&subType=ljpg&w=120&h=120&o=1&thumbnail= still no image. Any thoughts? Brian

    Read the article

  • XSL: Dead or not dead

    - by Seattle Leonard
    I'm currently taking on a new project at home. In this project I'm going to be generating HTML emails. For this purpose, I believe XSL to be a good candidate. However, I have heard people say that XSL is a dead language, and if it's not that it is on it's way out. In fact, MS has been very leary to support XSL 2.0. Personally I feel that any time you are going from text to text, it is a great tool. Such as: Generating HTML e-mails Creating Open Office Docs Generating another XML doc What are your thoughts? Is it dead, or is it still a viable, usefull tool?

    Read the article

  • ngModel and component with isolated scope

    - by Artem Andreev
    I am creating simple ui-datetime directive. It splits javascript Date object into _date, _hours and _minutes parts. _date uses jquery ui datepicker, _hours and _minutes - number inputs. See example: http://jsfiddle.net/andreev_artem/nWsZp/3/ On github: https://github.com/andreev-artem/angular_experiments/tree/master/ui-datetime As far as I understand - best practice when you create a new component is to use isolated scope. When I tried to use isolated scope - nothing works. ngModel.$viewValue === undefined. When I tried to use new scope (my example, not so good variant imho) - ngModel uses value on newly created scope. Of course I can create directive with isolated scope and work with ngModel value through "=expression" (example). But I think that working with ngModelController is a better practice. My questions: Can I use ngModelController with isolated scope? If it is not possible which solution is better for creating such component?

    Read the article

  • Why wont this entire word doc file generate from my php script?

    - by CheeseConQueso
    Here's the php script I'm using on a linux environment: <?php include("../_inc/odbcw.php"); //connect string $cat = $_GET["cat"]; if($_GET["st"]){$crs_query = "select crs_no, title, credits, abstr, prereq, coreq, lab_fee from xxx where active = 'Y' and cat = '".$cat."' and spec_top = 'Y' and prog='UNDG' order by crs_no";} else {$crs_query = "select crs_no, title, credits, abstr, prereq, coreq, lab_fee from xxx where active = 'Y' and cat = '".$cat."' and prog='UNDG' order by crs_no";} $crs_result = @mysql_query($crs_query); header("Content-type: application/vnd.ms-word"); header("Content-Disposition: attachment;Filename=cat.doc"); echo "<html>"; echo "<meta http-equiv=\"Content-Type\" content=\"text/html; charset=Windows-1252\">"; echo "<body>"; echo '<table border=0 width = 700>'; if($_GET["st"]){echo '<tr><td><font face=arial size=2><center>CATALOGUE<br>COURSE DESCRIPTIONS - '.$cat.'<br>SPECIAL TOPICS</center></font></td></tr>';} else {echo '<tr><td><font face=arial size=2><center>CATALOGUE<br>COURSE DESCRIPTIONS - '.$cat.'</center></font></td></tr>';} echo '</table>'; echo '<hr width=700>'; while($row = mysql_fetch_array($crs_result)) { $crs_no = $row['crs_no']; $title = $row['title']; $credits = $row['credits']; $abstr = $row['abstr']; $prereq = $row['prereq']; $coreq = $row['coreq']; $lab_fee = $row['lab_fee']; $rowspan = 2; if($prereq) {$rowspan++;} if($coreq) {$rowspan++;} if($lab_fee=="Y") {$rowspan++;} echo "<table border=0 width = 700>"; echo "<tr>"; echo "<td rowspan=".$rowspan." valign=top width=100><font face=arial size=2>".$crs_no."</font></td>"; echo "<td valign=top><font face=arial size=2><u>".$title."</u></font></td> <td valign=top align=right><font face=arial size=2>".$credits."</font></td>"; echo "</tr>"; echo "<tr>"; echo "<td colspan=2 valign=top align=justify><font face=arial size=2>".$abstr."</font></td>"; echo "</tr>"; if($prereq) { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Prerequisite: ".$prereq."</font></td>"; echo "</tr>"; } if($coreq) { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Coerequisite: ".$coreq."</font></td>"; echo "</tr>"; } if($lab_fee=="Y") { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Lab Fee Required</font></td>"; echo "</tr>"; } echo "</table>"; echo "<br>"; } echo "</body>"; echo "</html>"; ?> Everything works fine before the inclusion of: header("Content-type: application/vnd.ms-word"); header("Content-Disposition: attachment;Filename=cat.doc"); echo "<html>"; echo "<meta http-equiv=\"Content-Type\" content=\"text/html; charset=Windows-1252\">"; echo "<body>"; These lines successfully bring up the dialogue box to open or save cat.doc, but after I open it, the only lines printed are: CATALOGUE COURSE DESCRIPTIONS - and the <HR> beneath this echoed text. It seems to go on lunch break for the while loop echoing section. Any ideas?

    Read the article

  • SQLBulkCopy used in conjunction with Transaction and firing an event each time a batch is copied

    - by Hans Rudel
    Im currently uploading data to MS SQL server via SQLBulkCopy and Transactions. I would like to be able to raise an event after each batch has been uploaded (I have already tried SQLRowsCopied event and it doesnt work, see quote below) MSDN quote: No action, such as transaction activity, is supported in the connection during the execution of the bulk copy operation, and it is recommended that you not use the same connection used during the SqlRowsCopied event. However, you can open a different connection. http://msdn.microsoft.com/en-us/library/system.data.sqlclient.sqlbulkcopy.sqlrowscopied(v=vs.80).aspx So i basically cant have my cake and eat it :( Does anyone know a solution around this as i would like to fire an event after each batch has been uploaded. Thanks for your help.

    Read the article

  • a question on webpage data scraping using Java

    - by Gemma
    Hi there. I am now trying to implement a simple HTML webpage scraper using Java.Now I have a small problem. Suppose I have the following HTML fragment. <div id="sr-h-left" class="sr-comp"> <a class="link-gray-underline" id="compare_header" rel="nofollow" href="javascript:i18nCompareProd('/serv/main/buyer/ProductCompare.jsp?nxtg=41980a1c051f-0942A6ADCF43B802'); " Compare Showing 1 - 30 of 1,439 matches, The data I am interested is the integer 1.439 shown at the bottom.I am just wondering how can I get that integer out of the HTML. I am now considering using a regular expression,and then use the java.util.Pattern to help get the data out,but still not very clear about the process. I would be grateful if you guys could give me some hint or idea on this data scraping. Thanks a lot.

    Read the article

  • PHP File Serving Script: Unreliable Downloads?

    - by JGB146
    This post started as a question on ServerFault ( http://serverfault.com/questions/131156/user-receiving-partial-downloads ) but I determined that our php script was the culprit. So I'm issuing an updated question here about what I believe is the actual issue. I am using a php script to verify permissions and then serve up a file for users of my website to download. Most of the time, this works, but recently one user has been seeing problems with larger downloads. He is only getting ~80% of downloads for files that are 100MB in size. Also, all downloads from this script fail to report a filesize. Further, tests revealed that the same user COULD reliably download each of the failed files if given a direct link (at which point the filesize is reported). Here's the relevant snippet of code that we are using to serve the file: header("Content-type:$contenttype"); $len = filesize($filename); header("Content-Length: $len"); header("Content-Disposition: attachment; filename=".$title.".".$ext); readfile($filename); Note that $contenttype, $filename, $title, and $ext are all set correctly before we get here. These have been triple-checked. None of them are the problem. Also, $len does provide the correct filesize. While researching this issue, I came across this post: http://stackoverflow.com/questions/1334471/content-length-header-always-zero It seems that I am encountering the same issue. When I use the script, I get chunked encoding on the file and no size is set for content-length. I'm hypothesizing that something is going wrong on the large downloads, leading him to get a zero-length chunk before the end of the file. Here's what the headers look like for a direct request: http://www.grinderschool.com/videos/zfff5061b65ae00e8b21/KillsAids021.wmv GET /videos/zfff5061b65ae00e8b21/KillsAids021.wmv HTTP/1.1 Host: www.grinderschool.com User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.3) Gecko/20100401 Firefox/3.6.3 (.NET CLR 3.5.30729) Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8 Accept-Language: en-us,en;q=0.5 Accept-Encoding: gzip,deflate Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7 Keep-Alive: 115 Connection: keep-alive Referer: http://www.grinderschool.com/phpBB3/viewtopic.php?f=14&p=29468 Cookie: style_cookie=printonly; phpbb3_7c544_u=2; phpbb3_7c544_k=44b832912e5f887d; phpbb3_7c544_sid=e8852df42e08cc1b2250300c2897f78f; __utma=174624884.2719561324781918700.1251850714.1270986325.1270989003.575; __utmz=174624884.1264524375.411.12.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=low%20stakes%20poker%20videos; phpbb3_cmviy_k=; phpbb3_cmviy_u=2; phpbb3_cmviy_sid=d8df5c0943863004ca40ef9c392d371d; __utmb=174624884.4.10.1270989003; __utmc=174624884 Pragma: no-cache Cache-Control: no-cache HTTP/1.1 200 OK Date: Sun, 11 Apr 2010 12:57:41 GMT Server: Apache/2.2.14 (Unix) mod_ssl/2.2.14 OpenSSL/0.9.8l DAV/2 mod_auth_passthrough/2.1 FrontPage/5.0.2.2635 Last-Modified: Sun, 04 Apr 2010 12:51:06 GMT Etag: "eb42d6-7d9b843-48368aa6dc280" Accept-Ranges: bytes Content-Length: 131708995 Keep-Alive: timeout=10, max=30 Connection: Keep-Alive Content-Type: video/x-ms-wmv And here's what they look like for the request answered by my script: http://www.grinderschool.com/download_video_test.php?t=KillsAids021&format=wmv GET /download_video_test.php?t=KillsAids021&format=wmv HTTP/1.1 Host: www.grinderschool.com User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.3) Gecko/20100401 Firefox/3.6.3 (.NET CLR 3.5.30729) Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8 Accept-Language: en-us,en;q=0.5 Accept-Encoding: gzip,deflate Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7 Keep-Alive: 115 Connection: keep-alive Cookie: style_cookie=printonly; phpbb3_7c544_u=2; phpbb3_7c544_k=44b832912e5f887d; phpbb3_7c544_sid=e8852df42e08cc1b2250300c2897f78f; __utma=174624884.2719561324781918700.1251850714.1270986325.1270989003.575; __utmz=174624884.1264524375.411.12.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=low%20stakes%20poker%20videos; phpbb3_cmviy_k=; phpbb3_cmviy_u=2; phpbb3_cmviy_sid=d8df5c0943863004ca40ef9c392d371d; __utmb=174624884.4.10.1270989003; __utmc=174624884 HTTP/1.1 200 OK Date: Sun, 11 Apr 2010 12:58:02 GMT Server: Apache/2.2.14 (Unix) mod_ssl/2.2.14 OpenSSL/0.9.8l DAV/2 mod_auth_passthrough/2.1 FrontPage/5.0.2.2635 X-Powered-By: PHP/5.2.11 Content-Disposition: attachment; filename=KillsAids021.wmv Vary: Accept-Encoding Content-Encoding: gzip Keep-Alive: timeout=10, max=30 Connection: Keep-Alive Transfer-Encoding: chunked Content-Type: video/x-ms-wmv So the question is...what can I do to make downloads from the script work properly? Again, for 99% of users, it works as is (though I find it annoying now that no filesize is reported and thus that no time estimate can be computed about the download).

    Read the article

  • Pros / Cons displaying list of users at login page

    - by Radu094
    We seem to have a lot of clients asking us to change the login screen in this manner: Display a list of all available users (thumbnail picture + name) User selects a username from the list A password prompt appears near the username User enters password then presses enter This sounds remarcably similar to the Windows XP login, which is probably where they got the ideea in the first place. There are only about 4 - 5 different users that can login at any given station, so implementing that list on one screen is feasable. So I was wondering if there are any usability experts with some word on this method of login. As far as I can tell, MS droped this behaviour in Vista/Win7, didn't they?

    Read the article

  • to_date in SQL Server 2005

    - by Chin
    Does any one know how I would have to change the following to work with ms sql? WHERE registrationDate between to_date ('2003/01/01', 'yyyy/mm/dd') AND to_date ('2003/12/31', 'yyyy/mm/dd'); What I have read implies I would have to construct it using DATEPART() which could become very long winded. Especially when the goal would be to compare on dates which I receive in the following format "2003-12-30 10:07:42". It would be nice to pass them off to the database as is. Any pointers appreciated.

    Read the article

  • Javascript substrings multiline replace by RegExp

    - by Radek Šimko
    Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

    Read the article

  • asp.net databinding string is passed to function but runtime occurs

    - by rod
    Hi All, I'm using a code-behind function (called TestFx) in my binding expression. I'm passing a string and the function accepts a string but I still get a runtime error saying invalid args. But if I change the method to accept an object and inspect the value, "it's a string!" Can someone please explain? -rod ProductDescription: <asp:Label ID="ProductDescriptionLabel" runat="server" Text='<%# TestFx(Eval("ProductDescription")) %>' /> <br />

    Read the article

  • Fastest way to calculate summary of database field

    - by Jo-wen
    I have a ms-sql table with the following structure: Name nvarchar; Sign nvarchar; Value int example contents: Test1, 'plus', 5 Test1, 'minus', 3 Test2, 'minus', 1 I would like to have totals per "Name". (add when sign = plus, subtract when sign = minus) result: Test1, 2 Test2, -1 I want to show these results (and update them when a new record is added)... and I'm looking for the fastest solution! [sproc? fast-forward cursor? calculate in .net?]

    Read the article

  • MSXML2.ServerXMLHTTP.4.0 Source?

    - by Frank V
    Where does the object "MSXML2.ServerXMLHTTP.4.0" come from? Which install package? I'm attempting to do the following: Set oXMLHTTP = CreateObject("MSXML2.ServerXMLHTTP.4.0") This attempt fails on my development machine (no object is returned) but it is successful on my collage's development machine. Obviously he has something installed that I don't or vice versa but where does this object, dll, etc come from? What would I need to install to get this call to work. For the record, changing the object to a different version isn't an option because code that this depends on was tested for several days against this specific version. We'd have to go back and test again... To expand on this question, how can I tell which version of MS XML is currently installed?

    Read the article

  • Can't enumerate LinQ results with left join

    - by nvtthang
    var itemSet = from item in da.GetList<Models.account>() join file in objFileStorageList on item.account_id equals file.parent_id into objFile from fileItem in objFile.DefaultIfEmpty() where item.company != null && item.company.company_id == 123 orderby item.updatedDate descending select new { Id = item.account_id, RefNo = item.refNo, StartDate = item.StartDate , EndDate = item.EndDate , Comment = item.comment, FileStorageID = fileItem != null ? fileItem.fileStorage_id : -1, Identification = fileItem != null ? fileItem.identifier : null, fileName = fileItem != null ? fileItem.file_nm : null }; It raises error message when I try to enumerate through collection result from Linq query above. LINQ to Entities does not recognize the method 'System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage] DefaultIfEmpty[fileStorage](System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage])' method, and this method cannot be translated into a store expression foreach (var item in itemSet) { string itemRef= item.RefNo; } Please suggest me any solutions. Thanks in advance.

    Read the article

  • gdb: SIGTRAP on std::string::c_str() call

    - by sheepsimulator
    So I've been trying to use gdb to return the value of a string I have by calling > print <member variable name>.c_str() But everytime I do so, I get this: Program received signal SIGTRAP, Trace/breakpoint trap. <some address> in std::string::c_str() from /usr/lib/libstdc++.so.6 GDB remains in the frame where the signal was received. To change this behavior use "set unwindonsignal on" Evaluation of the expression containing the function (std::string::c_str() const) will be abandoned. Two questions: Why/how is the standard library throwing SIGTRAP? I checked basic_string.h and c_str() is defined as: const _CharT* c_str() const { return _M_data(); } I don't see any SIGTRAP-throwing here... is there a way to get around this SIGTRAP? How can I read the text value of the std::string out (without getting some crazy extension library) in gdb?

    Read the article

  • Redirect www.example.com/apple to food.example.com/fruits/apple

    - by Senthil
    I want to redirect users from www.example.com/apple to http://food.example.com/fruits/apple Note: This is a hardcoded redirection. Even a mapping if you will. "apple" will not be substituted with anything else. Nothing in the two URLs will change except for the domain of course. So there is no need for a regular expression to match the "apple" or anything else. There is already dozens of RewriteCond and RewriteRule things in the .htaccess file. I do not want them to be affected. This redirection is independent of those. I have access to the .htaccess file at the root of www.example.com and the httpd.conf What code should I put in .htaccess in order to achieve this? Or should I change the httpd.conf?

    Read the article

  • SQL: ATER COLUMN to shorter CHAR(n) type

    - by Rising Star
    I'm working with MS SQL SERVER 2003. I want to change a column in one of my tables to have fewer characters in the entries. This is identical to this question: http://stackoverflow.com/questions/2281336/altering-a-table-column-to-accept-more-characters except for the fact that I want fewer characters instead of more. I have a column in one of my tables that holds nine-digit entries. A developer previously working on the table mistakenly set the column to hold ten-digit entries. I need to change the type from CHAR(10) to CHAR(9). Following the instructions from the discussion linked above, I wrote the statement ALTER TABLE [MY_TABLE] ALTER COLUMN [MY_COLUMN] CHAR(9); This returns the error message "String or binary data would be truncated". I see that my nine-digit strings have a space appended to make them ten digits. How do I tell SQL Server to discard the extra space and convert my column to a CHAR(9) type?

    Read the article

  • Seeking References To MSVC 9.0's C++ Standards Compliance

    - by John Dibling
    I "know" (hopefully) that MSVC 9.0 Implements C++ 2003 (ISO/IEC 14882:2003). I am looking for a reference to this fact, and I am also looking for any research that has been done in to how compliant MSVC 9.0 is with that version of the Standard. I have searched for and not been able to find a specific reference from MicroSoft that actually says something to the effect that MSVC implements C++ 2003. Some of the out-of-date documentation says things like "this release achieves roughly 98% compliance" (when referring to MSVC .NET 2003's conformance to C++ 1997). But I want a link to a document from MS that says "MSVC 9.0 implements blah," and another link to an independent group that has tested the conformance of MSVC 9.0. Do you know of any such links?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Numbering Regex Submatches

    - by gentlylisped
    Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

    Read the article

  • How to serve a View as CSV in ASP.NET Web Forms

    - by ChessWhiz
    Hi, I have a MS SQL view that I want to make available as a CSV download in my ASPNET Web Forms app. I am using Entity Framework for other views and tables in the project. What's the best way to enable this download? I could add a HyperLink whose click handler iterates over the view, writes its CSV form to the disk, and then serves that file. However, I'd prefer not to write to the disk if it can be avoided, and that involves iteration code that may be avoided with some other solution. Any ideas?

    Read the article

  • F# - This code isn't compiling for me

    - by stacker
    This code isn't compiling for me: let countDown = [5L .. -1L .. 0L];; I have a book that says it should return this: val countDown : int list = [5L; 4L; 3L; 2L; 1L; 0L] Compiler Error: Program.fs(42,24): error FS0010: Unexpected character '-' in expression > > let countDown = [5L .. -1L .. 0L];; let countDown = [5L .. -1L .. 0L];; -----------------------^

    Read the article

  • A table that has relation to itself issue

    - by Mostafa
    Hi , I've defined table with this schema : CREATE TABLE [dbo].[Codings]( [Id] [int] IDENTITY(1,1) NOT NULL, [ParentId] [int] NULL, [CodeId] [int] NOT NULL, [Title] [nvarchar](50) COLLATE Arabic_CI_AI NOT NULL, CONSTRAINT [PK_Codings] PRIMARY KEY CLUSTERED ( [Id] ASC )WITH (IGNORE_DUP_KEY = OFF) ON [PRIMARY] ) ON [PRIMARY] And fill it up with data like this : Id ParentId CodeId Title ----------- ----------- ----------- ---------- 1 NULL 0 Gender 2 1 1 Male 3 1 2 Female 4 NULL 0 Educational Level 5 4 1 BS 6 4 2 MS 7 4 3 PHD Now , I'm looking for a solution , in order , When i delete a record that is parent ( like Id= 1 or 4 ), It delete all child automatically ( all records that their ParentId is 1 or 4 ) . I supposed i can do it via relation between Id and Parent Id ( and set cascade for delete rule ) , But when i do that in MMS , the Delete Rule or Update Rule in Properties is disabled . My question is , What can i do to accomplish this ? Thank you

    Read the article

  • Delphi component or library to display mathematical expressions

    - by Svein Bringsli
    I'm looking for a simple component that displays mathematical expressions in Delphi. When I started out I thought it would be easy to find something on the net, but it turns out it was harder than anticipated. There are lots and lots of components that will parse mathematical expressions, but few (none?) that will display them. Ideally I would like a component as simple as a TLabel, where I could set the caption to some expression and it would be displayed correctly, but some sort of library that let's me draw expressions to a canvas would also be sufficient for my needs. Update: I'm not talking about plotting graphs of functions or something like that. I want to display (for instance) (X^2+3)/X like this:

    Read the article

  • Html combo box to database record Id

    - by LanguaFlash
    I'm fairly sure there has to be a simple solution to my problem, but I am a new web developer and can't quite figure it out. On my page I have a combo box whose values are filled from my database. When the user submits the form, how to I go about converting those values back to the record numbers in the database? Up to now I have been just doing a sort of reversed lookup in my database to try to get the record's ID. This has quite a few obvious flaws and I am sure that there has to be a better way. I am used to MS Forms combo boxes where the record data and ID are never separated. But in the case of a web form, I have no way to do multiple columns in the combo box like I am used to. Thanks! Jeff

    Read the article

< Previous Page | 315 316 317 318 319 320 321 322 323 324 325 326  | Next Page >