Search Results

Search found 72218 results on 2889 pages for 'multiple definition error'.

Page 320/2889 | < Previous Page | 316 317 318 319 320 321 322 323 324 325 326 327  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • PHP, MySQL, jQuery, AJAX: json data returns correct response but frontend returns error

    - by Devner
    Hi all, I have a user registration form. I am doing server side validation on the fly via AJAX. The quick summary of my problem is that upon validating 2 fields, I get error for the second field validation. If I comment first field, then the 2nd field does not show any error. It has this weird behavior. More details below: The HTML, JS and Php code are below: HTML FORM: <form id="SignupForm" action=""> <fieldset> <legend>Free Signup</legend> <label for="username">Username</label> <input name="username" type="text" id="username" /><span id="status_username"></span><br /> <label for="email">Email</label> <input name="email" type="text" id="email" /><span id="status_email"></span><br /> <label for="confirm_email">Confirm Email</label> <input name="confirm_email" type="text" id="confirm_email" /><span id="status_confirm_email"></span><br /> </fieldset> <p> <input id="sbt" type="button" value="Submit form" /> </p> </form> JS: <script type="text/javascript"> $(document).ready(function() { $("#email").blur(function() { var email = $("#email").val(); var msgbox2 = $("#status_email"); if(email.length > 3) { $.ajax({ type: 'POST', url: 'check_ajax2.php', data: "email="+ email, dataType: 'json', cache: false, success: function(data) { if(data.success == 'y') { alert('Available'); } else { alert('Not Available'); } } }); } return false; }); $("#confirm_email").blur(function() { var confirm_email = $("#confirm_email").val(); var email = $("#email").val(); var msgbox3 = $("#status_confirm_email"); if(confirm_email.length > 3) { $.ajax({ type: 'POST', url: 'check_ajax2.php', data: 'confirm_email='+ confirm_email + '&email=' + email, dataType: 'json', cache: false, success: function(data) { if(data.success == 'y') { alert('Available'); } else { alert('Not Available'); } } , error: function (data) { alert('Some error'); } }); } return false; }); }); </script> PHP code: <?php //check_ajax2.php if(isset($_POST['email'])) { $email = $_POST['email']; $res = mysql_query("SELECT uid FROM members WHERE email = '$email' "); $i_exists = mysql_num_rows($res); if( 0 == $i_exists ) { $success = 'y'; $msg_email = 'Email available'; } else { $success = 'n'; $msg_email = 'Email is already in use.</font>'; } print json_encode(array('success' => $success, 'msg_email' => $msg_email)); } if(isset($_POST['confirm_email'])) { $confirm_email = $_POST['confirm_email']; $email = ( isset($_POST['email']) && trim($_POST['email']) != '' ? $_POST['email'] : '' ); $res = mysql_query("SELECT uid FROM members WHERE email = '$confirm_email' "); $i_exists = mysql_num_rows($res); if( 0 == $i_exists ) { if( isset($email) && isset($confirm_email) && $email == $confirm_email ) { $success = 'y'; $msg_confirm_email = 'Email available and match'; } else { $success = 'n'; $msg_confirm_email = 'Email and Confirm Email do NOT match.'; } } else { $success = 'n'; $msg_confirm_email = 'Email already exists.'; } print json_encode(array('success' => $success, 'msg_confirm_email' => $msg_confirm_email)); } ?> THE PROBLEM: As long as I am validating the $_POST['email'] as well as $_POST['confirm_email'] in the check_ajax2.php file, the validation for confirm_email field always returns an error. With my limited knowledge of Firebug, however, I did find out that the following were the responses when I entered email and confirm_email in the fields: RESPONSE 1: {"success":"y","msg_email":"Email available"} RESPONSE 2: {"success":"y","msg_email":"Email available"}{"success":"n","msg_confirm_email":"Email and Confirm Email do NOT match."} Although the RESPONSE 2 shows that we are receiving the correct message via msg_confirm_email, in the front end, the alert 'Some error' is popping up (I have enabled the alert for debugging). I have spent 48 hours trying to change every part of the code wherever possible, but with only little success. What is weird about this is that if I comment the validation for $_POST['email'] field completely, then the validation for $_POST['confirm_email'] field is displaying correctly without any errors. If I enable it back, it is validating email field correctly, but when it reaches the point of validating confirm_email field, it is again showing me the error. I have also tried renaming success variable in check_ajax2.php page to other different names for both $_POST['email'] and $_POST['confirm_email'] but no success. I will be adding more fields in the form and validating within the check_ajax2.php page. So I am not planning on using different ajax pages for validating each of those fields (and I don't think it's smart to do it that way). I am not a jquery or AJAX guru, so all help in resolving this issue is highly appreciated. Thank you in advance.

    Read the article

  • What is the problem with this code?

    - by Giffyguy
    The compile error I'm getting is "newline in constant" The error occurs where the four asterisks are (****). I can't debug, because the solution won't build successfully. <script type="text/javascript"> function TNClicked(fullImgURL, TNID) { document.getElementById("<%= this.imgFull.ClientID %>").src = fullImgURL; var pnlFullImage = document.getElementById("<%= this.pnlFullImage.ClientID %>"); if (pnlFullImage.style.visibility != "visible") pnlFullImage.style.visibility = "visible"; document.getElementById("<%= this.tcImage.ClientID %>").innerHTML = TNID; //document.forms[0].ctl00$ctl00$ctl00$cntBody$hfImage.value = TNID; //****document.getElementById("<%= this.hfImage").setAttribute("value", TNID); //document.getElementById("<%= this.hfImage.ClientID %>").value = TNID; } </script>

    Read the article

  • cannot connect to vpn server (error 721)

    - by callmeblessed
    Hi I got 2 internet connections in my computer. One is using 3.5G HSDPA modem (vodafone huawei e220) and the other using mobile phone (cdma zte c261). Both are using different ISP and i have both. at the moment, i can connect to my office vpn using the HSDPA modem one. But when i tried to use cdma modem (dial up - mobile phone modem), i am just able to get "verifying username and password" and then after a few minutes it display error : Error 721 The Remote Computer didn't respond. I tried to ping into my office ip address, it got good result but still cannot connect to the vpn. I tried to turn off all my firewall (i'm using commodo) and has no response as well. In my cdma mobile phone modem Network connections I tried to allow iNternet connection sharing as well ... and turn on all Internet Protocol TCP/IP, File & Printer Sharing & Client for microsoft networks. But all of my effort has no effect. How to fix this problem ? note: my office using windows vpn as well. thank you .

    Read the article

  • Abstract classes in shared library

    - by JTom
    Hi, I have an ordinary abstract class that has couple of pure virtual methods. The class itself is a part of the shared library. The compilation of the shared library itself is OK. But when the library is linked to another program that has another class deriving from the abstract one in the shared library and defining the pure virtual methods, I get the following linker error: I compile like this..: g++ -I../path/to/the/library main.cpp derived.cpp -L../path/to/the/library -lsomename -o shared ...and the linker error is: libsomename.so: undefined reference to `AbstractClass::method()' It's like the abstract class cannot access its pure virtual methods but I do not try to make any instance of the abstract class anywhere in the library. What could be the problem?

    Read the article

  • "could not find suitable fingerprints matched to available hardware" error

    - by Alex
    I have a thinkpad t61 with a UPEK fingerprint reader. I'm running ubuntu 9.10, with fprint installed. Everything works fine (I am able to swipe my fingerprint to authenticate any permission dialogues or "sudo" prompts successfully) except for actually logging onto my laptop when I boot up or end my session. I receive an error below the gnome login that says "Could not locate any suitable fingerprints matched to available hardware." What is causing this? here are the contents of /etc/pam.d/common-auth file # # /etc/pam.d/common-auth - authentication settings common to all services # # This file is included from other service-specific PAM config files, # and should contain a list of the authentication modules that define # the central authentication scheme for use on the system # (e.g., /etc/shadow, LDAP, Kerberos, etc.). The default is to use the # traditional Unix authentication mechanisms. # # As of pam 1.0.1-6, this file is managed by pam-auth-update by default. # To take advantage of this, it is recommended that you configure any # local modules either before or after the default block, and use # pam-auth-update to manage selection of other modules. See # pam-auth-update(8) for details. # here are the per-package modules (the "Primary" block) auth sufficient pam_fprint.so auth [success=1 default=ignore] pam_unix.so nullok_secure # here's the fallback if no module succeeds auth requisite pam_deny.so # prime the stack with a positive return value if there isn't one already; # this avoids us returning an error just because nothing sets a success code # since the modules above will each just jump around auth required pam_permit.so # and here are more per-package modules (the "Additional" block) auth optional pam_ecryptfs.so unwrap # end of pam-auth-update config #auth sufficient pam_fprint.so #auth required pam_unix.so nullok_secure

    Read the article

  • calling invokeAndWait from the EDT

    - by Aly
    Hi, I have a problem following from my previous problem. I also have the code SwingUtillities.invokeAndWait somewhere else in the code base, but when I remove this the gui does not refresh. If I dont remove it the error I get is: Exception in thread "AWT-EventQueue-0" java.lang.Error: Cannot call invokeAndWait from the event dispatcher thread at java.awt.EventQueue.invokeAndWait(Unknown Source) at javax.swing.SwingUtilities.invokeAndWait(Unknown Source) at game.player.humanplayer.model.HumanPlayer.act(HumanPlayer.java:69) The code in HumanPlayer.act is: public Action act(final Action[] availiableActions) { try { SwingUtilities.invokeAndWait(new Runnable() { @Override public void run() { gui.update(availiableActions); } }); } catch (InterruptedException e) { e.printStackTrace(); } catch (InvocationTargetException e) { e.printStackTrace(); } synchronized(performedAction){ while(!hasPerformedAction()){ try { performedAction.wait(); } catch (InterruptedException e) { e.printStackTrace(); } } setPerformedAction(false); } return getActionPerfomed(); }

    Read the article

  • Syntax error on line 494 of httpd.conf: Cannot load .../php5apache2_2.dll into server

    - by pikachu
    I have been learning PHP. I had installed Apache-server (not in a combination-suite like USBWebserver). Now I'm trying to put my sites on a portable stick, using USBWebserver. I already used that program before to carry MySQL databases with me (and Apache worked as well, cause I used the included PHPMyAdmin for managing the databases.), but now it doesn't work anymore. When I start the program, I keep having the text saying Apache is offline. I've tried to open Apache using the command line (don't know what that would do, but, it's just a try). I got an error message saying Syntax error on line 494 of C:/.../httpd.conf: Cannot load C:/.../php5apache2_2.dll into server: (The following is translated from Dutch) An initialization routine of the dynamic link library (dll-file) has failed. Line 494 says this: LoadModule php5_module "C:/Users/School/Downloads/USBWebserver v8_en/php/php5apache2_2.dll" My first Apache installation (its service) is not running. The ports are different. And I also uninstalled the service (using the httpd.exe -k uninstall command); What can be the problem? Thanks for help.

    Read the article

  • Identifying Service Error in Fedora 16

    - by Cerin
    How do you find the cause of a failed service start in Fedora 16? The new systemctl command in Fedora 16 seems to horribly obscure any useful logging info. [root@host ~]# systemctl start httpd.service Job failed. See system logs and 'systemctl status' for details. [root@host ~]# systemctl status httpd.service httpd.service - The Apache HTTP Server (prefork MPM) Loaded: loaded (/lib/systemd/system/httpd.service; enabled) Active: failed since Thu, 21 Jun 2012 16:26:56 -0400; 1min 23s ago Process: 2119 ExecStop=/usr/sbin/httpd $OPTIONS -k stop (code=exited, status=0/SUCCESS) Process: 2215 ExecStart=/usr/sbin/httpd $OPTIONS -k start (code=exited, status=1/FAILURE) Main PID: 1062 (code=exited, status=0/SUCCESS) CGroup: name=systemd:/system/httpd.service So the first command fails...and it tells me to run another command...which simply tells me that the command returned an error code. Where's the actual error? Even more frustrating is nothing seems to have been written to the logs: [root@host ~]# ls -lah /var/log/httpd/ total 8.0K drwx------. 2 root root 4.0K Jun 21 16:19 . drwxr-xr-x. 21 root root 4.0K Jun 20 16:33 .. -rw-r----- 1 root root 0 Jun 21 16:19 modsec_audit.log -rw-r----- 1 root root 0 Jun 21 16:19 modsec_debug.log

    Read the article

  • BSOD error 0x0000006B PROCESS1_INITIALIZATION_FAILED on boot

    - by DontCare4Free
    I reinstalled League of Legends because the patcher always gave me an error. However, out of complete stupidness I didn't uninstall the old installation first because I thought that it would simply replace the files. However, when the installer bar got to 100% it simply minimized. Then I closed the application from the task manager. I tried uninstalling it after a failed attempt to start it up. The same behavior as when I installed it. Then I tried reinstalling where it simply presented the InstallShield Modify/Repair/Remove menu and I selected repair. Nothing happened. Then I tried selecting Modify, then seeing that the only option (called DefaultFeature) was unchecked. Same behaviour as install/uninstall. After seeing that it still failed, I uninstalled again. And after that I deleted C:\Program Files (x86)\League of Legends manually. When I tried installing LoL again it still thought I had it, so I chose repair. This time something actually happened, but it installed the whole game to C:\Windows. Seeing what was going on I clicked cancel and then started it up to try uninstalling it. However, I got an error message about something not being registered and then the minimization to I decided to let it repair completely. Then I uninstalled it and it gave only the minimization. However, when I rebooted another application started up complaining about some library being absent. So I decided to do a system restore. After letting it complete I got a BSOD every time I tried starting up Windows normally or in safe mode. However, system recovery mode works, although the system recovery automatic repair does not fix it. After a bit of searching I found a Microsoft KB article about it (981833) and tried following the workaround instructions. Nothing happened. I am using Windows 7 Home Premium 64-bit and Ubuntu 10.04 LTS 64-bit installed with WUBI.

    Read the article

  • GCC problem with raw double type comparisons

    - by Monomer
    I have the following bit of code, however when compiling it with GCC 4.4 with various optimization flags I get some unexpected results when its run. #include <iostream> int main() { const unsigned int cnt = 10; double lst[cnt] = { 0.0 }; const double v[4] = { 131.313, 737.373, 979.797, 731.137 }; for(unsigned int i = 0; i < cnt; ++i) { lst[i] = v[i % 4] * i; } for(unsigned int i = 0; i < cnt; ++i) { double d = v[i % 4] * i; if(lst[i] != d) { std::cout << "error @ : " << i << std::endl; return 1; } } return 0; } when compiled with: "g++ -pedantic -Wall -Werror -O1 -o test test.cpp" I get the following output: "error @ : 3" when compiled with: "g++ -pedantic -Wall -Werror -O2 -o test test.cpp" I get the following output: "error @ : 3" when compiled with: "g++ -pedantic -Wall -Werror -O3 -o test test.cpp" I get no errors when compiled with: "g++ -pedantic -Wall -Werror -o test test.cpp" I get no errors I do not believe this to be an issue related to rounding, or epsilon difference in the comparison. I've tried this with Intel v10 and MSVC 9.0 and they all seem to work as expected. I believe this should be nothing more than a bitwise compare. If I replace the if-statement with the following: if (static_cast<long long int>(lst[i]) != static_cast<long long int>(d)), and add "-Wno-long-long" I get no errors in any of the optimization modes when run. If I add std::cout << d << std::endl; before the "return 1", I get no errors in any of the optimization modes when run. Is this a bug in my code, or is there something wrong with GCC and the way it handles the double type?

    Read the article

  • Couldn't copy package file to temp file in android

    - by Siva K
    hi i created a new app, whenever i try to run in my device it shows as [2011-02-17 18:57:09 - SpeedApp02] Installation error: INSTALL_FAILED_MEDIA_UNAVAILABLE [2011-02-17 18:57:09 - SpeedApp02] Please check logcat output for more details. [2011-02-17 18:57:10 - SpeedApp02] Launch canceled! in the console and 02-17 18:58:58.540: ERROR/PackageManager(59): Couldn't copy package file to temp file. in the logcat. What it means? what is the problem. This is the same with emulator too....

    Read the article

  • grub2 error : out of disk

    - by Nostradamnit
    Hi everyone, I recently install ArchBang on a machine with Ubuntu and XP. I ran update-grub from Ubuntu and it found the new install and created an entry. However, when I try to boot it, I get: error: out of disk error: you need to load kernel first I've tried several things, including adding a new entry in 40_custom, but nothing changes. Here are the entries I have: default found by update-grub ### BEGIN /etc/grub.d/30_os-prober ### menuentry "ArchBang Linux (on /dev/sda4)" { insmod part_msdos insmod ext2 set root='(hd0,msdos4)' search --no-floppy --fs-uuid --set 75f96b44-3a8f-4727-9959-d669b9244f2a linux /boot/vmlinuz26 root=/dev/sda4 rootfstype=ext4 ro xorg=vesa quiet nomodeset swapon initrd /boot/kernel26.img } menuentry "ArchBang Linux Fallback (on /dev/sda4)" { insmod part_msdos insmod ext2 set root='(hd0,msdos4)' search --no-floppy --fs-uuid --set 75f96b44-3a8f-4727-9959-d669b9244f2a linux /boot/vmlinuz26 root=/dev/sda4 rootfstype=ext4 ro xorg=vesa quiet nomodeset swapon initrd /boot/kernel26-fallback.img } ### END /etc/grub.d/30_os-prober ### custom entry in 40_custom based on various ideas found on the internets menuentry "ArchBang Linux (on /dev/sda4)" { insmod part_msdos insmod ext2 set root='(hd0,msdos4)' search --no-floppy --fs-uuid --set 75f96b44-3a8f-4727-9959-d669b9244f2a linux /boot/vmlinuz26 root=/dev/disk/by-uuid/75f96b44-3a8f-4727-9959-d669b9244f2a rootfstype=ext4 ro xorg=vesa quiet nomodeset swapon initrd /boot/kernel26.img } I think the problem has something to do with the sda4 not being mounted at boot-time... Thanks in advance for you help, Sam

    Read the article

  • Dell Vostro Desktop error

    - by goldenmean
    Faced a strange situation at work today. We have people sitting at a table on opposite sides, with power cables underneath the table. This morning when the person sitting opposite to me banged his feet on ground, it disturbed the power cable to my PC and it turned-off. So when I turned it on, it says, "No boot device found" Press F1 to setup or F5 to perform test... There was no physical impact/crash/fall of the desktop cabinet, which could have crashed/damaged the hard disk physically. EDIT: The OS is Windows 7 So I tried to recognize it in the Bios setup, but even there it could not find the SATA disk that is connected to this machine. So then I opened the cabinet, removed the power supply and plugged it back again. Tried to reboot, same error, "Boot device not found" It is not recognizing the hard disk. Any ideas about what might be wrong? Hard-disk crash, OS Crash(But it doesn't even go to the point of loading the disk after the initial Bios execution, so doubt this...) Any pointers about how I should proceed to troubleshoot/solve this error are welcome.

    Read the article

  • Full-text search locks up database - error 0x8001010e

    - by Stewart May
    Hi We have a full-text catalog that is populated via a job every 15 minutes like so: ALTER FULLTEXT INDEX ON [dbo].[WorkItemLongTexts] START INCREMENTAL POPULATION We have encountered a problem where the database containing this catalog locks up. There are a couple of scenarios, we either see the job execute and the process hang with with a wait type of UNKNOWN TOKEN, or we see another process hang with a wait type of MSSEARCH. Once this happens the job continues to run but informs us that the request to start a full-text index population is ignored because a population is currently active. Looking in the full text log files we see the following error each time these problems occur: 2010-04-21 08:15:00.76 spid21s The full-text catalog health monitor reported a failure for full-text catalog "XXXFullTextCatalog" (5) in database "YYY" (14). Reason code: 0. Error: 0x8001010e(The application called an interface that was marshalled for a different thread.). The system will restart any in-progress population from the previous checkpoint. If this message occurs frequently, consult SQL Server Books Online for troubleshooting assistance. This is an informational message only. No user action is required."'' The only solution is to restart the SQL Server service and then the full text service. This is now occuring on a daily basis now so any help would be appreciated.

    Read the article

  • my .jar file won't do anything.

    - by David
    I created a program that more or less holds an array of strings as an object and randomly prints one. so basicaly class Happy { string[] namestrings = new string[#] constructor() { fill with some strings} public static void main (String[]arg) { create instance of class do some junk with it method that prints it } method that prints it {} another method } when i compile and run it on the command line it works fine but when on the comand line i type in jar -cf Happy.jar Fun.class i get a .jar file called Happy and when i click on it i get an error message that reads "the java Jar file happy could not be launched read the consol for possible error messages" I have a mac i'm running lepord if that makes a diference. Whats going on?

    Read the article

  • Dell Vostro Desktop error.

    - by goldenmean
    Faced a strange situation at work today. We have people sitting at a table on opposite sides, with power cables underneath the table. This morning when the person sitting opposite to me banged his feet on ground, it disturbed the power cable to my PC and it turned-off. So when I turned it on, it says, "No boot device found" Press F1 to setup or F5 to perform test... There was no physical impact/crash/fall of the desktop cabinet, which could have crashed/damaged the hard disk physically. EDIT: The OS is Windows 7 So I tried to recognize it in the Bios setup, but even there it could not find the SATA disk that is connected to this machine. So then I opened the cabinet, removed the power supply and plugged it back again. Tried to reboot, same error, "Boot device not found" It is not recognizing the hard disk. Any ideas about what might be wrong? Hard-disk crash, OS Crash(But it doesn't even go to the point of loading the disk after the initial Bios execution, so doubt this...) Any pointers about how I should proceed to troubleshoot/solve this error are welcome.

    Read the article

  • How to show / debug PEAR::DB errors in webpage?

    - by Markus Ossi
    I am connecting to MySQL database on my webpage and have this copy-pasted code for errors: if(DB::isError($db)) die($db->getMessage()); I have the connection code in an outside file called connection.inc that I include at the beginning of my page before the DOCTYPE and html tags. For debugging purposes, how can I print the database errors on my webpage? I thought I could do something like this: echo 'Could not connect to database. The error was:' . $db->getMessage(); but this returns: Fatal error: Call to undefined method DB_mysql::getMessage()

    Read the article

  • script to list user's mapped drive not giving results or error

    - by user223631
    We are in the process of migrating two file servers to a new server. We have mapped drives via user group in group policy. Many users have manually mapped drives and we need to find these mappings. I have created a PowerShell script to run that remotely get the drive mappings. It works on most computers but there are many that are not returning results and I am not getting any error messages. Each workstation on the list creates a text file and the ones that are not returning results have no text in the files. I can ping these machines. If the machine is not turned on, it does come up error message that the RPC server is not available. My domain user account is in a group that is in the local admin account. I have no idea why some are not working. Here is the script. # Load list into variable, which will become an array of strings If( !(Test-Path C:\Scripts)) { New-Item C:\Scripts -ItemType directory } If( !(Test-Path C:\Scripts\Computers)) { New-Item C:\Scripts\Computers -ItemType directory } If( !(Test-Path C:\Scripts\Workstations.txt)) { "No Workstations found. Please enter a list of Workstations under Workstation.txt"; Return} If( !(Test-Path C:\Scripts\KnownMaps.txt)) { "No Mapping to check against. Please enter a list of Known Mappings under KnownMaps.txt"; Return} $computerlist = Get-Content C:\Scripts\Workstations.txt # Loop through each item in the array (each computer in the list of computers we loaded into the variable) ForEach ($computer in $computerlist) { $diskObject = Get-WmiObject Win32_MappedLogicalDisk -computerName $computer | Select Name,ProviderName | Out-File C:\Tester\Computers\$computer.txt -width 200 } Select-String -Path C:\Tester\Computers\*.txt -Pattern cmsfiles | Out-File C:\Tester\Drivemaps-all.txt $strings = Get-Content C:\Tester\KnownMaps.txt Select-String -Path C:\Tester\Drivemaps-all.txt -Pattern $strings -notmatch -simplematch | Out-File C:\Tester\Drivemaps-nonmatch.txt -Width 200 Select-String -Path C:\Tester\Drivemaps-all.txt -Pattern $strings -simplematch | Out-File C:\Tester\Drivemaps-match.txt -Width 200

    Read the article

  • What information do you capture your software crashes in the field?

    - by Russ
    I am working on rewriting my unexpected error handling process, and I would like to ask the community: What information do you capture both automatic, and manually, when software you have written crashes? Right now, I capture a few items, some of which are: Automatic: Name of app that crashed Version of app that crashed Stack trace Operating System version RAM used by the application Number of processors Screen shot: (Only on non-public applications) User name and contact information (from Active Directory) Manual: What context is the user in (i.e.: what company, tech support call number, RA number, etc...) When did the user expect to happen? (Typical response: "Not to crash”) Steps to reproduce. What other bits of information do you capture that helps you discover the true cause of an applications problem, especially given that most users simply mash the keyboard when asked to tell you what happened. For the record I’m using C#, WPF and .NET version 4, but I don’t necessarily want to limit myself to those. Related: http://stackoverflow.com/questions/1226671/what-to-collect-information-when-software-crashes Related: http://stackoverflow.com/questions/701596/what-should-be-included-in-the-state-of-the-art-error-and-exception-handling-stra

    Read the article

  • NginX & Munin - Location and error 404

    - by user1684189
    I've a server that running nginx+php-fpm with this simple configuration: server { listen 80; server_name ipoftheserver; access_log /var/www/default/logs/access.log; error_log /var/www/default/logs/error.log; location / { root /var/www/default/public_html; index index.html index.htm index.php; } location ^~ /munin/ { root /var/cache/munin/www/; index index.html index.htm index.php; } location ~\.php$ { include /etc/nginx/fastcgi_params; fastcgi_pass 127.0.0.1:9000; fastcgi_index index.php; fastcgi_param SCRIPT_FILENAME /var/www/default/public_html$fastcgi_script_name; } } but when I open ipoftheserver/munin/ I recieve a 404 error (when I request ipoftheserver/ the files on /var/www/default/public_html are listened correctly) Munin is installed and works perfectly. If I remove this configuration and I use this another one all works good (but not in the /munin/ directory): server { server_name ipoftheserver; root /var/cache/munin/www/; location / { index index.html; access_log off; } } How to fix? Many thanks for your help

    Read the article

  • Catching errors in ANTLR and finding parent

    - by Andreas
    I have found out that I can catch errors during parsing by overwriting displayRecognitionError, but how do I find the parent "node" of this error? ex. if I have the grammar: prog: stat expr; stat: STRING; expr: INTEGER; And give it the input "abc def". Then I will get an error at "def" which should be an integer. At this point I then want to get the parent which is "expr" (since it fails inside the INTEGER part) and it's parent "prog". Kind of like printing stack trace in java. I tried to look at the node from RecognitionException parsed to displayRecognitionError, but it is null, and using CommonErrorNode the parent is null. Should I maybe take a completely different approach?

    Read the article

  • Model Django Poll

    - by MacPython
    I followed the django tutorial here: http://docs.djangoproject.com/en/dev/intro/tutorial01/ and now I am at creating a poll. The code below works fine until I want to create choices, where for some reason I always get this error message: line 22, in unicode return self.question AttributeError: 'Choice' object has no attribute 'question' Unfortunatley, I dont understand where I made an error. Any help would be greatly appreciated. Thanks for the time! CODE: import datetime from django.db import models class Poll(models.Model): question = models.CharField(max_length=200) pub_date = models.DateTimeField('date published') def __unicode__(self): return self.question def was_published_today(self): return self.pub_date.date() == datetime.date.today() class Choice(models.Model): poll = models.ForeignKey(Poll) choice = models.CharField(max_length=200) votes = models.IntegerField() def __unicode__(self): return self.question

    Read the article

  • mysql_connect()

    - by Jacksta
    I am trying to connect to mysql and am getting an error. I put my servers ip address in and used port 3306 whihch post should be used? <?php $connection = mysql_connect("serer.ip:port", "user", "pass") or die(mysql_error()); if ($connection) {$msg = "success";} ?> <html> <head> </head> <body> <? echo "$msg"; ?> </body> </html> Here is the error its producing Warning: mysql_connect() [function.mysql-connect]: Access denied for user 'admin'@'server1.myserver.com' (using password: YES) in /home/admin/domains/mydomain.com.au/public_html/db_connect.php on line 3 Access denied for user 'admin'@'server1.myserver.com' (using password: YES)

    Read the article

< Previous Page | 316 317 318 319 320 321 322 323 324 325 326 327  | Next Page >