Search Results

Search found 6384 results on 256 pages for 'cgi parse qs'.

Page 34/256 | < Previous Page | 30 31 32 33 34 35 36 37 38 39 40 41  | Next Page >

  • Replace newline from MySQL TEXT field to parse w/ JSON

    - by dr3w
    Hi, "replace newline" seems to be a question asked here and there like hundred times already. But however, i haven't found any working solution for myself yet. I have a textarea that i use to save data into DB. Then using AJAX I want to get data from the DB in the backend that is in TEXT field and to pass it to frontend using JSON. But pasing JSON returns an error, as new lines from DB are not valid JSON syntax, I guess i should use \n instead... But how do i replace newlinew from DB with \n? I've tried this $t = str_replace('<br />', '\n', nl2br($t)); and this $t = preg_replace("/\r\n|\n\r|\r|\n/", "\n", $t); and using CHAR(13) and CHAR(10), and still I get an error the new line in textarea is equivalent to, i guess $t = 'text with a newline'; it gives the same error. And in notepad i clearly see that it is crlf

    Read the article

  • PyYAML parse into arbitary object

    - by Philip Fourie
    I have the following Python 2.6 program and YAML definition (using PyYAML): import yaml x = yaml.load( """ product: name : 'Product X' sku : 123 features : - size : '10x30cm' weight : '10kg' """ ) print type(x) print x Which results in the following output: <type 'dict'> {'product': {'sku': 123, 'name': 'Product X', 'features': [{'weight': '10kg', 'size': '10x30cm'}]}} It is possible to create a strongly typed object from x? I would like to the following: print x.features(0).size I am aware that it is possible to create and instance from an existent class, but that is not what I want for this particular scenario.

    Read the article

  • parse results in MySQL via REGEX

    - by Derek Adair
    Hi, I'm a bit confused on the functionality of the REGEX support for MySQL and I have yet to find a solid example on how to separate a result with REGEX within an sql statement. Example: How could I pull data from a table emails that looks something like... +-------------------------+ |Emails | |-------------------------| |[email protected]| +-------------------------+ and return something through an sql statement that looks like... +------------------------------+ |Username | Domain | TLD | |-----------|------------|-----| |some.email | yourdomain | com | +------------------------------+

    Read the article

  • Can't parse a 1904 date in ARPA format (email date)

    - by Ramon
    I'm processing an IMAP mailbox and running into trouble parsing the dates using the mxDateTime package. In particular, early dates like "Fri, 1 Jan 1904 00:43:25 -0400" is causing trouble: >>> import mx.DateTime >>> import mx.DateTime.ARPA >>> mx.DateTime.ARPA.ParseDateTimeUTC("Fri, 1 Jan 1904 00:43:25 -0400").gmtoffset() Traceback (most recent call last): File "<interactive input>", line 1, in <module> Error: cannot convert value to a time value >>> mx.DateTime.ARPA.ParseDateTimeUTC("Thu, 1 Jan 2009 00:43:25 -0400").gmtoffset() <mx.DateTime.DateTimeDelta object for '-08:00:00.00' at 1497b60> >>> Note that an almost identical date from 2009 works fine. I can't find any description of date limitations in mxDateTime itself. Any ideas why this might be? Thx, Ramon

    Read the article

  • Angularjs: addition of integers even after I parse the variable as integer

    - by Shiv Kumar
    I really have a weird problem in adding two numbers. Here is my code, in the first controller everything is working fine, but in the second controller instead of 0 if I add 10, the output is completely weird Here is html code <div ng-app=""> <div ng-controller="Controller1"> <br/>**** Controller-1 <br/>Add 0 : {{update1(0)}} <br/>Add 10 : {{update1(10)}} <br/>Add 50 : {{update1(50)}} <br/>Add -60 : {{update1(-60)}}</div> <div ng-controller="Controller2"> <br/>**** Controller-2 <br/>Add 10 : {{update2(10)}} <br/>Add 10 : {{update2(10)}} <br/>Add 50 : {{update2(50)}} <br/>Add -60 : {{update2(-60)}}</div> </div> Here is my javascript function Controller1($scope) { var x = 0; $scope.update1 = function (smValue) { x += parseInt(smValue); return x; } } function Controller2($scope) { var y = 0; $scope.update2 = function (smValue) { y += parseInt(smValue); return y; } } and here is the output **** Controller-1 Add 0 : 0 Add 10 : 10 Add 50 : 60 Add -60 : 0 **** Controller-2 Add 0 : 110 Add 10 : 120 Add 50 : 170 Add -60 : 110 here is the link to try: http://jsfiddle.net/6VqqN/ can anyone please explain me why it is behaving like that. Even if I add a 3or4 digit number, output is completely different then what I expected.

    Read the article

  • Parse XML function names and call within whole assembly

    - by Matt Clarkson
    Hello all, I have written an application that unit tests our hardware via a internet browser. I have command classes in the assembly that are a wrapper around individual web browser actions such as ticking a checkbox, selecting from a dropdown box as such: BasicConfigurationCommands EventConfigurationCommands StabilizationCommands and a set of test classes, that use the command classes to perform scripted tests: ConfigurationTests StabilizationTests These are then invoked via the GUI to run prescripted tests by our QA team. However, as the firmware is changed quite quickly between the releases it would be great if a developer could write an XML file that could invoke either the tests or the commands: <?xml version="1.0" encoding="UTF-8" ?> <testsuite> <StabilizationTests> <StressTest repetition="10" /> </StabilizationTests> <BasicConfigurationCommands> <SelectConfig number="2" /> <ChangeConfigProperties name="Weeeeee" timeOut="15000" delay="1000"/> <ApplyConfig /> </BasicConfigurationCommands> </testsuite> I have been looking at the System.Reflection class and have seen examples using GetMethod and then Invoke. This requires me to create the class object at compile time and I would like to do all of this at runtime. I would need to scan the whole assembly for the class name and then scan for the method within the class. This seems a large solution, so any information pointing me (and future readers of this post) towards an answer would be great! Thanks for reading, Matt

    Read the article

  • Parse Directory Structure (Strings) to JSON using PHP

    - by Ecropolis
    I have an array of file-path strings like this videos/funny/jelloman.wmv videos/funny/bellydance.flv videos/abc.mp4 videos/june.mp4 videos/cleaver.mp4 fun.wmv jimmy.wmv herman.wmv Is there a library or easy way I can get to a data structure json or xml? Something like this: (I see there are a lot of snippets available for traversing actual folders, but again, I just have strings.) { files:{ file:[ { filename:'fun.wmv' }, { filename:'jimmy.wmv' }, { filename:'herman.wmv' } ], folder:{ foldername:'videos', file:[ { filename:'abc.mp4' }, { filename:'june.mp4' }, { filename:'cleaver.mp4' } ], folder:{ foldername:'funny', file:[ { filename:'jelloman.wmv' }, { filename:'bellydance.flv' } ] } } } }

    Read the article

  • XamlReader.Parse throws exception on empty String

    - by sub-jp
    In our app, we need to save properties of objects to the same database table regardless of the type of object, in the form of propertyName, propertyValue, propertyType. We decided to use XamlWriter to save all of the given object's properties. We then use XamlReader to load up the XAML that was created, and turn it back into the value for the property. This works fine for the most part, except for empty strings. The XamlWriter will save an empty string as below. <String xmlns="clr-namespace:System;assembly=mscorlib" xml:space="preserve" /> The XamlReader sees this string and tries to create a string, but can't find an empty constructor in the String object to use, so it throws a ParserException. The only workaround that I can think of is to not actually save the property if it is an empty string. Then, as I load up the properties, I can check for which ones did not exist, which means they would have been empty strings. Is there some workaround for this, or is there even a better way of doing this?

    Read the article

  • Parse tree and grammars information

    - by fuzzylogikk
    Do anyone know where to find good online resources with examples how to make grammars and parsetrees? Preferebly introductary materials. Info that is n00b friendly, haven't found anything good with google myself. edit: I'm thinking about theory, not a specific parser software.

    Read the article

  • How to parse app.config using ConfigurationManager?

    - by Amokrane
    I was using a certain method for parsing my app.config file. Then I was told that using ConfigurationManager is better and simpler. But the thing is I don't know how to do it with ConfigurationManager. My original code looked like this: XmlNode xmlProvidersNode; XmlNodeList xmlProvidersList; XmlNodeList xmlTaskFactoriesList; XmlDocument xmlDoc = new XmlDocument(); xmlDoc.Load("app.config"); xmlProvidersNode = xmlDoc.DocumentElement.SelectSingleNode("TaskProviders"); xmlProvidersList = xmlProvidersNode.SelectNodes("TaskProvider"); foreach (XmlNode xmlProviderElement in xmlProvidersList) { if (xmlProviderElement.Attributes.GetNamedItem("Name").Value.Equals(_taskProvider)) { xmlTaskFactoriesList = xmlProviderElement.SelectNodes("TaskTypeFactory"); foreach (XmlNode xmlTaskFactoryElement in xmlTaskFactoriesList) { if (xmlTaskFactoryElement.Attributes.GetNamedItem("TaskType").Value.Equals(_taskType)) { taskTypeFactory = xmlTaskFactoryElement.Attributes.GetNamedItem("Class").Value; } } } } What would be the equivalent using ConfigurationManager? (Because all I can see is how to get keys not nodes..) Thanks

    Read the article

  • Parse filename from full path using regular expressions in C#

    - by WindyCityEagle
    How do I pull out the filename from a full path using regular expressions in C#? Say I have the full path C:\CoolDirectory\CoolSubdirectory\CoolFile.txt. How do I get out CoolFile.txt using the .NET flavor of regular expressions? I'm not really good with regular expressions, and my RegEx buddy and me couldn't figure this one out. Also, in the course of trying to solve this problem, I realized that I can just use System.IO.Path.GetFileName, but the fact that I couldn't figure out the regular expression is just making me unhappy and it's going to bother me until I know what the answer is.

    Read the article

  • How could I parse this HTML file?

    - by Sergio Tapia
    <div id="main"> <style type="text/css"> </style> <script language="JavaScript"> </script> <p style="margin: 0pt 0pt 0.5em;"><b>Media from&nbsp;<a onclick="(new Image()).src='/rg/find-media-title/media_strip/images/b.gif?link=/title/tt0087538/';" href="/title/tt0087538/">The Karate Kid</a> (1984)</b></p> <style type="text/css"> </style> <table style="border-collapse: collapse;"> </table> </div> I need to somehow extract the href value of the (new Image()). How exactly would I accomplish this with HtmlAgilityPack? I'm new to it, and so far I haven't found a useful tutorial on how to effectively use it for parsing. Thanks for the help!

    Read the article

  • How to parse an XML file using PHP?

    - by Jack
    Here I have a variable 'response' which is obtained by parsing an XML file. $url = 'http://xxxxx.xml'; $ch = curl_init($url); $response = curl_exec($ch); The url structure is as follows - <user> <id>734</id> <name>Peter Parker</name> - <status> <favorited>false</favorited> </status> </user> How to access each bit of info like id,name,favorited from response?

    Read the article

  • jQuery: How to parse a multidemensional array?

    - by Allen G
    I'm not sure if the array is too deep or what, but I can't seem to get anything other than the keys and undefines. Help please! I'm using Codeigniter for development. Here is the PHP then the jQuery: $term = $this->input->post('search_term'); $this->db->like('book_title', $term); $search_query = $this->db->get('books'); $return = array(); $i = 0; if ($search_query->num_rows() > 1) { foreach($search_query->result() as $s) { $return['books']['book_id'] = $s->book_id; $return['books']['book_title'] = $s->book_title; $return['books']['book_price'] = $s->book_price; $i++; } } elseif ($search_query->num_rows() == 1) { echo 1; $i = 0; $return['book_id'] = $search_query->row('book_id'); $return['book_title'] = $search_query->row('book_title'); $return['book_price'] = $search_query->row('book_price'); } elseif ($search_query->num_rows() == 0) { echo 0; } echo json_encode($return); $("#search").change(function() { var searchTerm = $(this).val(); $.post("/contentcreator/search_by_term", { search_term: searchTerm }, function(data) { $("#book_scroller").empty(); var lengthHolder = data.books; for (var i = 0; i data.books.length; i++) { var row = '<li id="book_item_' + l + '">' + data.books['book_title'] +'</li>'; $("#book_scroller").append(row); }; i++; }, "json"); }); Thanks!

    Read the article

  • Jquery-ajax parse xml and set radiobutton

    - by haltman
    hi everybody, I've a form with some radio button like this: <input type="radio" name="leva" value="a"><input type="radio" name="leva" value="b"> with ajax post method I receive value of the radio. The question is how can I set correct radio value to checked? thanks in advance ciao h.

    Read the article

  • Why can XSLT not parse this XML?

    - by Matt W
    Taking the XSLT and XML from this page as an example: http://www.w3schools.com/xsl/xsl_transformation.asp I have an xml file which contains (above example modified): <?xml version="1.0" encoding="ISO-8859-1"?> <?xml-stylesheet type="text/xsl" href="cdcatalog.xsl"?> <catalog xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns="http://tempuri.org/"> <cd> In my case, the output contains nothing when the XSLT/XML is processed by the browser. The moment I remove the attributes from the element, it works. Problem is, I don't really have the option of pre-processing those attributes out of the file. Can anyone explain how to force the XSLT to work with the XML as is, please? After all, those attributes seem fairly standard. Many thanks, Matt.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to parse json data from https client in android

    - by Madhan Shanmugam
    I try to fetch data from https client. Same code i used to fetch from http client. but its working fine. when i try to use Https client its not working. i am getting the following error. java.net.UnknownHostException: Host is unresolved: https client address:443 Error Log: 10-27 10:01:08.280: W/System.err(21826): java.net.UnknownHostException: Host is unresolved: https client address.com 443 10-27 10:01:08.290: W/System.err(21826): at java.net.Socket.connect(Socket.java:1037) 10-27 10:01:08.290: W/System.err(21826): at org.apache.http.conn.ssl.SSLSocketFactory.connectSocket(SSLSocketFactory.java:317) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.DefaultClientConnectionOperator.openConnection(DefaultClientConnectionOperator.java:129) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPoolEntry.open(AbstractPoolEntry.java:164) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPooledConnAdapter.open(AbstractPooledConnAdapter.java:119) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.DefaultRequestDirector.execute(DefaultRequestDirector.java:348) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:555) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:487) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:465) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.JSONParser.getJSONFromUrl(JSONParser.java:38) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.myfile.processThread(myfile.java:159) 10-27 10:01:08.330: W/System.err(21826): at com.peripay.PERIPay$1$1.run(myfile.java:65) 10-27 10:01:08.330: E/Buffer Error(21826): Error converting result java.lang.NullPointerException 10-27 10:01:08.330: E/JSON Parser(21826): Error parsing data org.json.JSONException: A JSONObject text must begin with '{' at character 0 of

    Read the article

  • Still confuse parse JSON in GWT

    - by graybow
    Please help meee. I create a project named 'tesdb3' in eclipse. I create the PHP side to access the database, and made the output as JSON.. I create the userdata.php in folder war. then I compile tesdb3 project. Folder tesdb3 and the userdata.php in war moved in local server(I use WAMP). I put the PHP in folder tesdb3. This is the result from my localhost/phpmyadmin/tesdb3/userdata.php [{"kode":"002","nama":"bambang gentolet"},{"kode":"012","nama":"Algiz"}] From that result I think the PHP side was working good.Then I create UserData.java as JSNI overlay like this: package com.tesdb3.client; import com.google.gwt.core.client.JavaScriptObject; class UserData extends JavaScriptObject{ protected UserData() {} public final native String getKode() /*-{ return this.kode; }-*/; public final native String getNama() /*-{ return this.nama; }-*/; public final String getFullData() { return getKode() + ":" + getNama(); } } Then Finally in the tesdb3.java: public class Tesdb3 implements EntryPoint { String url= "http://localhost/phpmyadmin/tesdb3/datauser.php"; private native JsArray<UserData> getuserdata(String json) /*-{ return eval(json); }-*/; public void LoadData() throws RequestException{ RequestBuilder builder = new RequestBuilder(RequestBuilder.GET, URL.encode(url)); builder.sendRequest(null, new RequestCallback(){ @Override public void onError(Request request, Throwable exception) { Window.alert("error " + exception); } public void onResponseReceived(Request request, Response response) { Window.alert("betul" + response.getText()); //data(getuserdata(response.getText())); } }); } public void data(JsArray<UserData> data){ for (int i = 0; i < data.length(); i++) { String lkode =data.get(i).getKode(); String lname =data.get(i).getNama(); Label l = new Label(lkode+" "+lname); tb.setWidget(i, 0, l); } RootPanel.get().add(new HTML("my data")); RootPanel.get().add(tb); } public void onModuleLoad() { try { LoadData(); } catch (RequestException e) { } } } The result just showing string "my data". And the Window.alert(response.getText()) showing nothing. Whyy?

    Read the article

  • How to intercept, parse and compile?

    - by epitka
    This is a problem I've been struggling to solve for a while. I need a way to either replace code in the method with a parsed code from the template at compile time (PostSharp comes to mind) or to create a dynamic proxy (Linfu or Castle). So given a source code like this [Template] private string GetSomething() { var template = [%=Customer.Name%] } I need it to be compiled into this private string GetSomething() { MemoryStream mStream = new MemoryStream(); StreamWriter writer = new StreamWriter(mStream,System.Text.Encoding.UTF8); writer.Write(@"" ); writer.Write(Customer.Name); StreamReader sr = new StreamReader(mStream); writer.Flush(); mStream.Position = 0; return sr.ReadToEnd(); } It is not important what technology is used. I tried with PostSharp's ImplementMethodAspect but got nowhere (due to lack of experience with it). I also looked into Linfu framework. Can somebody suggest some other approach or way to do this, I would really appreciate. My whole project depends on this.

    Read the article

  • Using JavaScript to parse an XML file

    - by Chris Clouten
    I am new to Stack OverFlow and coding in general. I am trying to take an XML file and render it in the browser using JavaScript. I have looked around at some sample code of how to do this and came up with the following code: <!DOCTYPE html> <html> <body> <script> if (window.XMLHttpRequest) {// code for IE7+, Firefox, Chrome, Opera, Safari xmlhttp=new XMLHttpRequest(); } else {// code for IE6, IE5 xmlhttp=new ActiveXObject("Microsoft.XMLHTTP"); } xmlhttp.open("GET","social.xml",false); xmlhttp.send(); xmlDoc=xmlhttp.responseXML; document.write("<table border='1'>"); var x=xmlDoc.getElementsByTagName("CD"); for (i=0;i<x.length;i++) { document.write("<tr><td>"); document.write(x[i].getElementsByTagName("c_id")[0].childNodes[0].nodeValue); document.write("</td><td>"); document.write(x[i].getElementsByTagName("facebook_id")[0].childNodes[0].nodeValue); document.write("</td></tr>"); } document.write("</table>"); </script> </body> </html> Anyway, when I run this on my local server none of the data that I am trying to display in the table appears. My .html file and .xml file are in the same folder, so I believe I have the correct file pathway. I could just be making a rookie mistake here, but I can't for the life of me figure out why a table listing the c_id and facebook_id values is not being created. I looked around for answers and haven't been able to find any. Any help would be greatly appreciated. Thanks!

    Read the article

  • Scala parser combinators: how to parse "if(x)" if x can contain a ")"

    - by Germán
    I'm trying to get this to work: def emptyCond: Parser[Cond] = ("if" ~ "(") ~> regularStr <~ ")" ^^ { case s => Cond("",Nil,Nil) } where regularStr is defined to accept a number of things, including ")". Of course, I want this to be an acceptable input: if(foo()). But for any if(x) it is taking the ")" as part of the regularStr and so this parser never succeeds. What am I missing?

    Read the article

< Previous Page | 30 31 32 33 34 35 36 37 38 39 40 41  | Next Page >