Search Results

Search found 6384 results on 256 pages for 'cgi parse qs'.

Page 35/256 | < Previous Page | 31 32 33 34 35 36 37 38 39 40 41 42  | Next Page >

  • How to parse a url string using mvc2 routes

    - by Lavinski
    If I have a url http://www.site.com/controllerA/actionB/idC how can i extract the RouteValueDictionary where the item with the key controller would have the value of controllerA. Note this isn't for testing so I don't want to use mocking and the solution here does not seem to be working.

    Read the article

  • How to parse json data from https client in android

    - by Madhan Shanmugam
    I try to fetch data from https client. Same code i used to fetch from http client. but its working fine. when i try to use Https client its not working. i am getting the following error. java.net.UnknownHostException: Host is unresolved: https client address:443 Error Log: 10-27 10:01:08.280: W/System.err(21826): java.net.UnknownHostException: Host is unresolved: https client address.com 443 10-27 10:01:08.290: W/System.err(21826): at java.net.Socket.connect(Socket.java:1037) 10-27 10:01:08.290: W/System.err(21826): at org.apache.http.conn.ssl.SSLSocketFactory.connectSocket(SSLSocketFactory.java:317) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.DefaultClientConnectionOperator.openConnection(DefaultClientConnectionOperator.java:129) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPoolEntry.open(AbstractPoolEntry.java:164) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPooledConnAdapter.open(AbstractPooledConnAdapter.java:119) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.DefaultRequestDirector.execute(DefaultRequestDirector.java:348) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:555) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:487) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:465) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.JSONParser.getJSONFromUrl(JSONParser.java:38) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.myfile.processThread(myfile.java:159) 10-27 10:01:08.330: W/System.err(21826): at com.peripay.PERIPay$1$1.run(myfile.java:65) 10-27 10:01:08.330: E/Buffer Error(21826): Error converting result java.lang.NullPointerException 10-27 10:01:08.330: E/JSON Parser(21826): Error parsing data org.json.JSONException: A JSONObject text must begin with '{' at character 0 of

    Read the article

  • Parse JSON into a ListView friendly output

    - by Thomas McDonald
    So I have this JSON, which then my activity retrieves to a string: {"popular": {"authors_last_month": [ { "url":"http://activeden.net/user/OXYLUS", "item":"OXYLUS", "sales":"1148", "image":"http://s3.envato.com/files/15599.jpg" }, { "url":"http://activeden.net/user/digitalscience", "item":"digitalscience", "sales":"681", "image":"http://s3.envato.com/files/232005.jpg" } { ... } ], "items_last_week": [ { "cost":"4.00", "thumbnail":"http://s3.envato.com/files/227943.jpg", "url":"http://activeden.net/item/christmas-decoration-balls/75682", "sales":"43", "item":"Christmas Decoration Balls", "rating":"3", "id":"75682" }, { "cost":"30.00", "thumbnail":"http://s3.envato.com/files/226221.jpg", "url":"http://activeden.net/item/xml-flip-book-as3/63869", "sales":"27", "item":"XML Flip Book / AS3", "rating":"5", "id":"63869" }, { ... }], "items_last_three_months": [ { "cost":"5.00", "thumbnail":"http://s3.envato.com/files/195638.jpg", "url":"http://activeden.net/item/image-logo-shiner-effect/55085", "sales":"641", "item":"image logo shiner effect", "rating":"5", "id":"55085" }, { "cost":"15.00", "thumbnail":"http://s3.envato.com/files/180749.png", "url":"http://activeden.net/item/banner-rotator-with-auto-delay-time/22243", "sales":"533", "item":"BANNER ROTATOR with Auto Delay Time", "rating":"5", "id":"22243"}, { ... }] } } It can be accessed here as well, although it because it's quite a long string, I've trimmed the above down to display what is needed. Basically, I want to be able to access the items from "items_last_week" and create a list of them - originally my plan was to have the 'thumbnail' on the left with the 'item' next to it, but from playing around with the SDK today it appears too difficult or impossible to achieve this, so I would be more than happy with just having the 'item' data from 'items_last_week' in the list. Coming from php I'm struggling to use any of the JSON libraries which are available to Java, as it appears to be much more than a line of code which I will need to deserialize (I think that's the right word) the JSON, and they all appear to require some form of additional class, apart from the JSONArray/JSONObject script I have which doesn't like the fact that items_last_week is nested (again, I think that's the JSON terminology) and takes an awful long time to run on the Android emulator. So, in effect, I need a (preferably simple) way to pass the items_last_week data to a ListView. I understand I will need a custom adapter which I can probably get my head around but I cannot understand, no matter how much of the day I've just spent trying to figure it out, how to access certain parts of a JSON string..

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • [Android] Force close when trying to parse JSON with AsyncTask in the background

    - by robs
    Hello everyone, i'm new to android development and i'm playing around with json data. I managed to get the parsing to work. I want to show a ProgressDialog and i read that i need to use AsyncTask that. But for some reason i get a force close as soon as i put the same working code inside doInBackground() eventhough eclipse says everything is fine. Here is the source code: public class HomeActivity extends Activity { public class BackgroundAsyncTask extends AsyncTask<Void, Integer, Void> { ProgressDialog dialog = new ProgressDialog (HomeActivity.this); @Override protected void onPreExecute() { dialog.setMessage("Loading...please wait"); dialog.setIndeterminate(true); dialog.setCancelable(false); dialog.show(); } protected void onPostExecute() { dialog.dismiss(); } @Override protected Void doInBackground(Void... params) { try { URL json = new URL("http://www.corps-marchia.de/jsontest.php"); URLConnection tc = json.openConnection(); BufferedReader in = new BufferedReader(new InputStreamReader(tc.getInputStream())); String line; while ((line = in.readLine()) != null) { JSONArray ja = new JSONArray(line); JSONObject jo = (JSONObject) ja.get(0); TextView txtView = (TextView)findViewById(R.id.TextView01); txtView.setText(jo.getString("text")); } } catch (MalformedURLException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (JSONException e) { e.printStackTrace(); } return null; } } @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); new BackgroundAsyncTask().execute(); } } Here is the error log: 01-08 12:33:48.225: ERROR/AndroidRuntime(815): FATAL EXCEPTION: AsyncTask #1 01-08 12:33:48.225: ERROR/AndroidRuntime(815): java.lang.RuntimeException: An error occured while executing doInBackground() 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.os.AsyncTask$3.done(AsyncTask.java:200) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerSetException(FutureTask.java:274) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask.setException(FutureTask.java:125) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:308) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask.run(FutureTask.java:138) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1088) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:581) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.lang.Thread.run(Thread.java:1019) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): Caused by: android.view.ViewRoot$CalledFromWrongThreadException: Only the original thread that created a view hierarchy can touch its views. 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.ViewRoot.checkThread(ViewRoot.java:2932) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.ViewRoot.requestLayout(ViewRoot.java:629) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.checkForRelayout(TextView.java:5521) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2724) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2592) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2567) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.doInBackground(HomeActivity.java:52) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.doInBackground(HomeActivity.java:1) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.os.AsyncTask$2.call(AsyncTask.java:185) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:306) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): ... 4 more 01-08 12:33:51.605: ERROR/WindowManager(815): Activity net.ajzele.demo.andy1.HomeActivity has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@4051d0c0 that was originally added here 01-08 12:33:51.605: ERROR/WindowManager(815): android.view.WindowLeaked: Activity net.ajzele.demo.andy1.HomeActivity has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@4051d0c0 that was originally added here 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.ViewRoot.<init>(ViewRoot.java:258) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:148) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:91) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.Window$LocalWindowManager.addView(Window.java:424) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.Dialog.show(Dialog.java:241) 01-08 12:33:51.605: ERROR/WindowManager(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.onPreExecute(HomeActivity.java:33) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.AsyncTask.execute(AsyncTask.java:391) 01-08 12:33:51.605: ERROR/WindowManager(815): at net.ajzele.demo.andy1.HomeActivity.onCreate(HomeActivity.java:72) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1047) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1586) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1638) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.access$1500(ActivityThread.java:117) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:928) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.Handler.dispatchMessage(Handler.java:99) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.Looper.loop(Looper.java:123) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.main(ActivityThread.java:3647) 01-08 12:33:51.605: ERROR/WindowManager(815): at java.lang.reflect.Method.invokeNative(Native Method) 01-08 12:33:51.605: ERROR/WindowManager(815): at java.lang.reflect.Method.invoke(Method.java:507) 01-08 12:33:51.605: ERROR/WindowManager(815): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:839) 01-08 12:33:51.605: ERROR/WindowManager(815): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:597) 01-08 12:33:51.605: ERROR/WindowManager(815): at dalvik.system.NativeStart.main(Native Method) Any hints? I hope you can help me out ive searched the net and didnt find any working solution...Thanks in advance

    Read the article

  • When does a Tumbling Window Start in StreamInsight

    Whilst getting some courseware ready I was playing around writing some code and I decided to very simply show when a window starts and ends based on you asking for a TumblingWindow of n time units in StreamInsight.  I thought this was going to be a two second thing but what I found was something I haven’t yet found documented anywhere until now.   All this code is written in C# and will slot straight into my favourite quick-win dev tool LinqPad   Let’s first create a sample dataset   var EnumerableCollection = new [] { new {id = 1, StartTime = DateTime.Parse("2010-10-01 12:00:00 PM").ToLocalTime()}, new {id = 2, StartTime = DateTime.Parse("2010-10-01 12:20:00 PM").ToLocalTime()}, new {id = 3, StartTime = DateTime.Parse("2010-10-01 12:30:00 PM").ToLocalTime()}, new {id = 4, StartTime = DateTime.Parse("2010-10-01 12:40:00 PM").ToLocalTime()}, new {id = 5, StartTime = DateTime.Parse("2010-10-01 12:50:00 PM").ToLocalTime()}, new {id = 6, StartTime = DateTime.Parse("2010-10-01 01:00:00 PM").ToLocalTime()}, new {id = 7, StartTime = DateTime.Parse("2010-10-01 01:10:00 PM").ToLocalTime()}, new {id = 8, StartTime = DateTime.Parse("2010-10-01 02:00:00 PM").ToLocalTime()}, new {id = 9, StartTime = DateTime.Parse("2010-10-01 03:20:00 PM").ToLocalTime()}, new {id = 10, StartTime = DateTime.Parse("2010-10-01 03:30:00 PM").ToLocalTime()}, new {id = 11, StartTime = DateTime.Parse("2010-10-01 04:40:00 PM").ToLocalTime()}, new {id = 12, StartTime = DateTime.Parse("2010-10-01 04:50:00 PM").ToLocalTime()}, new {id = 13, StartTime = DateTime.Parse("2010-10-01 05:00:00 PM").ToLocalTime()}, new {id = 14, StartTime = DateTime.Parse("2010-10-01 05:10:00 PM").ToLocalTime()} };   Now let’s create a stream of point events   var inputStream = EnumerableCollection .ToPointStream(Application,evt=> PointEvent .CreateInsert(evt.StartTime,evt),AdvanceTimeSettings.StrictlyIncreasingStartTime);   Now we can create our windows over the stream.  The first window we will create is a one hour tumbling window.  We’'ll count the events in the window but what we do here is not the point, the point is our window edges.   var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromHours(1),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()};   Now we can have a look at what we get.  I am only going to show the first non Cti event as that is enough to demonstrate what is going on   windowedStream.ToIntervalEnumerable().First(e=> e.EventKind == EventKind.Insert).Dump("First Row from Windowed Stream");   The results are below   EventKind Insert   StartTime 01/10/2010 12:00   EndTime 01/10/2010 13:00     { CountOfEntries = 5 }   Payload CountOfEntries 5   Now this makes sense and is quite often the width of window specified in examples.  So what happens if I change the windowing code now to var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromHours(5),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()}; Now where does your window start?  What about   var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromMinutes(13),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()};   Well for the first example your window will start at 01/10/2010 10:00:00 , and for the second example it will start at  01/10/2010 11:55:00 Surprised?   Here is the reason why and thanks to the StreamInsight team for listening.   Windows start at TimeSpan.MinValue. Windows are then created from that point onwards of the size you specified in your code.  If a window contains no events they are not produced by the engine to the output.  This is why window start times can be before the first event is created.

    Read the article

  • jQuery Autocomplete fetch and parse data source with custom function, except not

    - by Ben Dauphinee
    So, I am working with the jQuery Autocomplete function, and am trying to write a custom data parser. Not sure what I am doing incorrectly, but it throws an error on trying to call the autocompleteSourceParse function, saying that req is not set. setURL("ajax/clients/ac"); function autocompleteSourceParse(req, add){ var suggestions = []; $.getJSON(getURL()+"/"+req, function(data){ $.each(data, function(i, val){ suggestions.push(val.name); }); add(suggestions); }); return(suggestions); } $("#company").autocomplete({ source: autocompleteSourceParse(req, add), minLength: 2 });

    Read the article

  • How to parse text as JavaScript?

    - by Danjah
    This question of mine (currently unanswered), drove me toward finding a better solution to what I'm attempting. My requirements: chunks of code which can be arbitrarily added into a document, without an identifier: [div class="thing"] [elements... /] [/div] the objects are scanned for and found by an external script: var things = yd.getElementsBy(function(el){ return yd.hasClass('thing'); },null,document ); the objects must be individually configurable, what I have currently is identifier-based: [div class="thing" id="thing0"] [elements... /] [script type="text/javascript"] new Thing().init({ id:'thing0'; }); [/script] [/div] So I need to ditch the identifier (id="thing0") so there are no duplicates when more than one chunk of the same code is added to a page I still need to be able to config these objects individually, without an identifier SO! All of that said, I wondered about creating a dynamic global variable within the script block of each added chunk of code, within its script tag. As each 'thing' is found, I figure it would be legit to grab the innerHTML of the script tag and somehow convert that text into a useable JS object. Discuss. Ok, don't discuss if you like, but if you get the drift then feel free to correct my wayward thinking or provide a better solution - please! d

    Read the article

  • parse [object XrayWrapper [object HTMLLIElement]] into HTML object

    - by kitokid
    when I access and GM_log the currentLi of li object, it is complaining undefined. So when I GM_log li value as a string , instead of HTML object, I am getting [object XrayWrapper [object HTMLLIElement]]. How can I convert it or how I can access its related elements and value ? $("#result-set li").each(function(index) { var $currentLi = $(this); var $class1link = $currentLi.find("class1"); var $class1href = $class1link.attr("href"); }

    Read the article

  • PHP won't parse MySQL statements

    - by Hussain
    I just installed Apache 2.2.15/PHP 5.3.2/MySQL 5.1.44 on Windows Vista. Apache is working fine, PHP is functional, and MySQL works on the CLI. However, when I try to access MySQL via PHP, I get an error (Fatal error: Call to undefined function mysql_connect()). extension=php_mysql.dll and extension=php_mbstring.dll are uncommented in the php.ini file, and PHP is in the system path. There is no libmysql.dll in either the top level PHP directory or the ext directory. There's a libmySQL.dll file in the MySQL bin directory (which is also in the system path); I tried renaming it, but that doesn't do anything Also, in case anyone wants to know, I originally installed PHP using the MSI installer, but it was missing some DLLs, so I installed from the zip file. I think I've exhausted all my options. Any help on this problem would be very appreciated. Thanks in advance.

    Read the article

  • SQL Server INSERT ... SELECT Statement won't parse

    - by Jim Barnett
    I am getting the following error message with SQL Server 2005 Msg 120, Level 15, State 1, Procedure usp_AttributeActivitiesForDateRange, Line 18 The select list for the INSERT statement contains fewer items than the insert list. The number of SELECT values must match the number of INSERT columns. I have copy and pasted the select list and insert list into excel and verified there are the same number of items in each list. Both tables an additional primary key field with is not listed in either the insert statement or select list. I am not sure if that is relevant, but suspicious it may be. Here is the source for my stored procedure: CREATE PROCEDURE [dbo].[usp_AttributeActivitiesForDateRange] ( @dtmFrom DATETIME, @dtmTo DATETIME ) AS BEGIN SET NOCOUNT ON; DECLARE @dtmToWithTime DATETIME SET @dtmToWithTime = DATEADD(hh, 23, DATEADD(mi, 59, DATEADD(s, 59, @dtmTo))); -- Get uncontested DC activities INSERT INTO AttributedDoubleClickActivities ([Time], [User-ID], [IP], [Advertiser-ID], [Buy-ID], [Ad-ID], [Ad-Jumpto], [Creative-ID], [Creative-Version], [Creative-Size-ID], [Site-ID], [Page-ID], [Country-ID], [State Province], [Areacode], [OS-ID], [Domain-ID], [Keyword], [Local-User-ID], [Activity-Type], [Activity-Sub-Type], [Quantity], [Revenue], [Transaction-ID], [Other-Data], Ordinal, [Click-Time], [Event-ID]) SELECT [Time], [User-ID], [IP], [Advertiser-ID], [Buy-ID], [Ad-ID], [Ad-Jumpto], [Creative-ID], [Creative-Version], [Creative-Size-ID], [Site-ID], [Page-ID], [Country-ID], [State Province], [Areacode], [OS-ID], [Domain-ID], [Keyword], [Local-User-ID] [Activity-Type], [Activity-Sub-Type], [Quantity], [Revenue], [Transaction-ID], [Other-Data], REPLACE(Ordinal, '?', '') AS Ordinal, [Click-Time], [Event-ID] FROM Activity_Reports WHERE [Time] BETWEEN @dtmFrom AND @dtmTo AND REPLACE(Ordinal, '?', '') IN (SELECT REPLACE(Ordinal, '?', '') FROM Activity_Reports WHERE [Time] BETWEEN @dtmFrom AND @dtmTo EXCEPT SELECT CONVERT(VARCHAR, TripID) FROM VisualSciencesActivities WHERE [Time] BETWEEN @dtmFrom AND @dtmTo); END GO

    Read the article

  • Upload file and parse in classic asp

    - by Allen
    Any ideas how this can be done thru pure asp? I have various upload scripts, but they all either save a file to a folder or in a database. I can't seem to modify these examples correctly to put the file in an array. Here's the 2 I'm currently using: http://www.asp101.com/articles/jacob/scriptupload.asp|http://www.pscode.com/vb/scripts/ShowCode.asp?txtCodeId=7361&lngWId=4

    Read the article

  • Why does my CGI script keep redirecting links to localhost?

    - by Noah Brainey
    Visit this page http://online-file-sharing.net/tos.html and click one of the bottom footer links. It redirects you to your localhost in the address bar. I have no idea why it does this. This is in the main script that my entire website revolves around: upload.cgi $ENV{PATH} = '/bin:/usr/bin'; delete @ENV{'IFS', 'CDPATH', 'ENV', 'BASH_ENV'}; ($ENV{DOCUMENT_ROOT}) = ($ENV{DOCUMENT_ROOT} =~ /(.*)/); # untaint. #$ENV{SCRIPT_NAME} = '/cgi-bin/upload.cgi'; use lib './perlmodules'; #use Time::HiRes 'gettimeofday'; #my $hires_start = gettimeofday(); my (%PREF,%TEXT) = (); No file is displayed when someone visits the root directory, although I have a .htaccess file saying to open my upload.cgi file which is located in my root directory. When I point my browser directly to the CGI file it works but it brings me to my localhost again. I'm hosting this website on my own server, which is this computer, and using XAMPP if this information helps. I'm also using DynDNS as my nameservers. I hope you can give me some insight.

    Read the article

  • parse/collator for php

    - by dramatic
    I'm pretty much a newbie at php (at the "install an app and try to tweak it a bit" stage). Is there a tool anywhere which can take a script which is spread over many files and show you all the code which is processed (for a given set of arguments passed to the script) in a single output? For example, I want to make a call to zen cart from a script in a different language, which returns a category listing without any surrounding page. So I want to be able to trace what the actual process is to generate that then strip off all the unwanted bits to create a custom script.

    Read the article

  • PHP or C# script to parse CSV table values to fill in one-to-many table

    - by Yaaqov
    I'm looking for an example of how to split-out comma-delimited data in a field of one table, and fill in a second table with those individual elements, in order to make a one-to-many relational database schema. This is probably really simple, but let me give an example: I'll start with everything in one table, Widgets, which has a "state" field to contain states that have that widget: Table: WIDGET =============================== | id | unit | states | =============================== |1 | abc | AL,AK,CA | ------------------------------- |2 | lmn | VA,NC,SC,GA,FL | ------------------------------- |3 | xyz | KY | =============================== Now, what I'd like to create via code is a second table to be joined to WIDGET called *Widget_ST* that has widget id, widget state id, and widget state name fields, for example Table: WIDGET_ST ============================== | w_id | w_st_id | w_st_name | ------------------------------ |1 | 1 | AL | |1 | 2 | AK | |1 | 3 | CA | |2 | 1 | VA | |2 | 2 | NC | |2 | 1 | SC | |2 | 2 | GA | |2 | 1 | FL | |3 | 1 | KY | ============================== I am learning C# and PHP, so responses in either language would be great. Thanks.

    Read the article

  • Parse multiple named command line parameters

    - by scholzr
    I need to add the ability to a program to accept multiple named parameters when opening the program via the command line. i.e. program.exe /param1=value /param2=value and then be able to utilize these parameters as variables in the program. I have found a couple of ways to accomplish pieces of this, but can't seem to figure out how to put it all together. I have been able to pass one named parameter and recover it using the code below, and while I could duplicate it for every possible named parameter, I know that can't be the preffered way to do this. Dim inputArgument As String = "/input=" Dim inputName As String = "" For Each s As String In My.Application.CommandLineArgs If s.ToLower.StartsWith(inputArgument) Then inputName = s.Remove(0, inputArgument.Length) End If Next Alternatively, I can get multiple unnamed parameters from the command line using My.Application.CommandLineArgs But this requires that the parameters all be passed in the same order/format each time. I need to be able to pass a random subset of parameters each time. Ultimately, what I would like to be able to do, is separate each argument and value, and load it into a multidimentional array for later use. I know that I could find a way to do this by separating the string at the "=" and stripping the "/", but as I am somewhat new to this, I wanted to see if there was a "preffered" way for dealing with multiple named parameters?

    Read the article

  • Ruby: Parse, replace, and evaluate a string formula

    - by Swartz
    I'm creating a simple Ruby on Rails survey application for a friend's psychological survey project. So we have surveys, each survey has a bunch of questions, and each question has one of the options participants can choose from. Nothing exciting. One of the interesting aspects is that each answer option has a score value associated with it. And so for each survey a total score needs to be calculated based on these values. Now my idea is instead of hard-coding calculations is to allow user add a formula by which the total survey score will be calculated. Example formulas: "Q1 + Q2 + Q3" "(Q1 + Q2 + Q3) / 3" "(10 - Q1) + Q2 + (Q3 * 2)" So just basic math (with some extra parenthesis for clarity). The idea is to keep the formulas very simple such that anyone with basic math can enter them without resolving to some fancy syntax. My idea is to take any given formula and replace placeholders such as Q1, Q2, etc with the score values based on what the participant chooses. And then eval() the newly formed string. Something like this: f = "(Q1 + Q2 + Q3) / 2" # some crazy formula for this survey values = {:Q1 => 1, :Q2 => 2, :Q3 => 2} # values for substitution result = f.gsub(/(Q\d+)/) {|m| values[$1.to_sym] } # string to be eval()-ed eval(result) So my questions are: Is there a better way to do this? I'm open to any suggestions. How to handle formulas where not all placeholders were successfully replaced (e.g. one question wasn't answered)? Ex: {:Q3 = 2} wasn't in values hash? My idea is to rescue eval()... any thoughts? How to get proper result? Should be 2.5, but due to integer arithmetic, it will truncate to 2. I can't expect people who provide the correct formula (e.g. / 2.0 ) to understand this nuance. I do not expect this, but how to best protect eval() from abuse (e.g. bad formula, manipulated values coming in)? Thank you!

    Read the article

  • android html download and parse error

    - by Brahadeesh
    I am trying to download the html file using the ul of the page. I am using Jsoup. This is my code: TextView ptext = (TextView) findViewById(R.id.pagetext); Document doc = null; try { doc = (Document) Jsoup.connect(mNewLinkUrl).get(); } catch (IOException e) { Log.d(TAG, e.toString()); e.printStackTrace(); } NodeList nl = doc.getElementsByTagName("meta"); Element meta = (Element) nl.item(0); String title = meta.attr("title"); ptext.append("\n" + mNewLinkUrl); When running it, I am getting an error saying attr is not defined for the type element. What have I done wrong? Pardon me if this seems trivial.

    Read the article

  • IE7 not digesting JSON: "parse error"

    - by Kenny Leu
    While trying to GET a JSON, my callback function is NOT firing. $.ajax({ type:"GET", dataType:'json', url: myLocalURL, data: myData, success: function(returned_data){alert('success');} }); The strangest part of this is that my JSON(s) validates on JSONlint this ONLY fails on IE7...it works in Safari, Chrome, and all versions of Firefox. If I use 'error', then it reports "parseError"...even though it validates! Is there anything that I'm missing? Does IE7 not process certain characters, data structures (my data doesn't have anything non-alphanumeric, but it DOES have nested JSONs)? I have used tons of other AJAX calls that all work (even in IE7), but with the exception of THIS call. An example data return here is: {"question":{ "question_id":"19", "question_text":"testing", "other_crap":"none" }, "timestamp":{ "response":"answer", "response_text":"the text here" } } I am completely at a loss. Hopefully someone has some insight into what's going on...thank you!

    Read the article

  • List of drugs to parse in application

    - by Skoder
    Hey, Not sure if that has been asked before, but semantics causes difficulty in searching. Are there any sites which have a list of items for developers to use in applications? For example, you can download Dictionaries in specific formats (e.g. XML) for use in word games. In particular, I was hoping that there might be a list of common medical drugs so that I can use display a list in an application I'm working on as researching and typing 150+ drug names would be quite inefficient. Thanks

    Read the article

  • parse JSON . I have server response

    - by GauravBOSS
    i am new in JSON Parsing . i have a server response how i can fetch the "Device Name and Id" of 0 index. thanks in Advance { Successfully = ( { 0 = { DeviceName = Tommy; DeviceTypeId = 1; EMEI = xxxxxx; GId = xxxxx; Id = 105; Pet = "<null>"; PetImage = "352022008228784.jpg"; ProtocolId = xxxx; SimNo = xxxxx; }; } ); }

    Read the article

  • Finding the most frequent subtrees in a collection of (parse) trees

    - by peter.murray.rust
    I have a collection of trees whose nodes are labelled (but not uniquely). Specifically the trees are from a collection of parsed sentences (see http://en.wikipedia.org/wiki/Treebank). I wish to extract the most common subtrees from the collection - performance is not (yet) an issue. I'd be grateful for algorithms (ideally Java) or pointers to tools which do this for treebanks. Note that order of child nodes is important. EDIT @mjv. We are working in a limited domain (chemistry) which has a stylised language so the varirty of the trees is not huge - probably similar to children's readers. Simple tree for "the cat sat on the mat". <sentence> <nounPhrase> <article/> <noun/> </nounPhrase> <verbPhrase> <verb/> <prepositionPhrase> <preposition/> <nounPhrase> <article/> <noun/> </nounPhrase> </prepositionPhrase> </verbPhrase> </sentence> Here the sentence contains two identical part-of-speech subtrees (the actual tokens "cat". "mat" are not important in matching). So the algorithm would need to detect this. Note that not all nounPhrases are identical - "the big black cat" could be: <nounPhrase> <article/> <adjective/> <adjective/> <noun/> </nounPhrase> The length of sentences will be longer - between 15 to 30 nodes. I would expect to get useful results from 1000 trees. If this does not take more than a day or so that's acceptable. Obviously the shorter the tree the more frequent, so nounPhrase will be very common. EDIT If this is to be solved by flattening the tree then I think it would be related to Longest Common Substring, not Longest Common Sequence. But note that I don't necessarily just want the longest - I want a list of all those long enough to be "interesting" (criterion yet to be decided).

    Read the article

  • How to parse a Zend URL for parameters?

    - by wizzard
    I am trying to extract the GET parameters from a ZF REST URL. It's not the current request and I don't want to call the URL or execute the route, I just need the parameters. I'm looking for a utility function like parse_url(), but for the Zend REST format. Is there one, or do I have to reinvent the wheel? I've tried a few things like creating a new Zend_Controller_Request_Http but the parameters aren't being populated. It is a valid HTTP URL. Edit: Upon request, a sample Zend URL: http://localhost/index/index/param1/foo/param2/bar So I am just trying to get param1 and param2 out of this URL.

    Read the article

  • How to parse a tar file in C++

    - by Brendan Long
    What I want to do is download a .tar file with multiple directories with 2 files each. The problem is I can't find a way to read the tar file without actually extracting the files (using tar). The perfect solution would be something like: #include <easytar> Tarfile tar("somefile.tar"); std::string currentFile, currentFileName; for(int i=0; i<tar.size(); i++){ file = tar.getFileText(i); currentFileName = tar.getFileName(i); // do stuff with it } I'm probably going to have to write this myself, but any ideas would be appreciated..

    Read the article

< Previous Page | 31 32 33 34 35 36 37 38 39 40 41 42  | Next Page >