Search Results

Search found 22471 results on 899 pages for 'firefox os'.

Page 348/899 | < Previous Page | 344 345 346 347 348 349 350 351 352 353 354 355  | Next Page >

• Why is the Amazon and Ubuntu One Music webapp part of common? Can it be removed without removing all others?

  - by DoDoGo

  I've just noticed that those two, which I have completely no use of, are part of the common package. This means I cannot remove them without removing everything. But I like all the other webapps, GMail, Docs and so on. I just don't want Amazon popping up in my launcher when I go there once a blue moon and not leaving until I turn Firefox off. Is there any way I can remove it without removing the rest?

  Read the article

• Dual boot centOS and Win7

  - by user1855965

  I posted this on stackoverflow, but it looks like superuser would be more appropriate. I have a CentOS 5 machine that runs Windows 7 as a dual boot. CentOS is the main OS and each OS is set up in a specific hard drive. This was set up before I joined the company and I don't really have need to run Windows now. My question is: can I, from CentOS, reformat the Windows HD, change GRUB settings and get the HD to be available on CentOS? Happy to provide more info if this helps. Many thanks for your help and apologies if this is a very simple issue... I don't want to blindly test things on this machine as it is used on a daily basis by several users.

  Read the article

• When controlling from VNC, only mouse cursor moves

  - by pgrytdal

  If I am accessing my computer through VNC, when I am in windows A (example: Terminal) and I change to Window B (example: Firefox) on the host computer, everything is fine and it switches. But on the computer or other device I'm accessing FROM, it doesn't switch windows. When I move the mouse, both on the host computer, and the device I'm accessing from, the mouse moves, but the window still doesn't switch. Can this be fixed?

  Read the article

• Procedure for dual booting (2 copies of Win-7) off 2 partitions on same disk

  - by Sam Holder

  What procedure should I follow to set a dual boot (both Win-7 x64) on a machine where (ideally): Both operating systems will be installed on the same physical disk in different partitions When booting into either operating system the contents of the other OS partition disk will not be seen (this just seems safer) Other hard drives in the system will be visible by both OS's 1 copy of Win7 is already installed. Is it as simple as shrinking the existing volume and creating the partition, then sticking the CD in and booting off it and formatting the new partition and then installing another copy of windows onto the new partition? Or will that not work? Or are there gotchas?

  Read the article

• Can I delete the OEM partition on the new Dell XPS 15?

  - by timepilot

  My new Dell XPS 15 L521X just arrived. I need to set this up to dual boot Linux. Sadly, the system comes with four primary partitions. I can't do a clean install at the moment, so one of the partitions will have to be deleted before I can install Linux. The layout is as follows: OEM: 39mb Hibernation: 8gb OS: 457gb Recovery: 12gb Obviously, I can't delete the Hibernation and OS partitions (will shrink to make space for Linux) and I'd like to keep the recovery partition if possible. So my question is what is on the small OEM partition? What functionality will I lose if I delete it?

  Read the article

• How do I add a boot from cd option to yaboot?

  - by Sergiu

  So I'm dual-booting Ubuntu 12.04.1 on my iMac G5 powepc alongside Mac OS X and I want to add a boot cd option to yaboot because I'm trying to boot a scratched Mac OS X installation DVD that takes a while to read and the frst bootstrap moves on too fast. How do I edit the timeout for the first bootstrap anyways? So, my main question is, how do I add a cd booting option to yaboot and then, how doI boot it? The devalias from OpenFrmware tells me that 1 have 2 cd-rom instaled, on is /ht/pci@3/ata-6/disk@0 and the other on ends with a 1 instead of a zero. These are the contents of my yaboot.conf file: yaboot.conf generated by the Ubuntu installer run: "man yaboot.conf" for details. Do not make changes until you have!! see also: /usr/share/doc/yaboot/examples for example configurations. For a dual-boot menu, add one or more of: bsd=/dev/hdaX, macos=/dev/hdaY, macosx=/dev/hdaZ boot="/dev/disk/by-id/scsi-SATA_ST3160023AS_5MT1GCWA-part2" device=/ht@0,f2000000/pci@3/k2-sata-root@c/@0/@0 partition=4 root="UUID=798a048f-ee48-49e0-bba3-111aed8dee04" timeout=12000 install=/usr/lib/yaboot/yaboot magicboot=/usr/lib/yaboot/ofboot enablecdboot macosx="/dev/disk/by-id/scsi-SATA_ST3160023AS_5MT1GCWA-part3" image=/boot/vmlinux label=Linux read-only initrd=/boot/initrd.img append="quiet splash" What do I add here so that yaboot will boot from my cd in like 3 minutes after startup? Thanks!

  Read the article

• Screen going blank

  - by Deena

  When I am watching videos via VLC or watching videos in Firefox - even when I simply click DASH HOME - Screen goes blank - nothing working - I needed to restart to recover. Not sure which is causing this issue. Is it because of Graphics Card problem - Not installed any proprietary drivers. OS : Ubuntu 12.04 Graphics Card : 1 GB - [AMD/ATI] RV710 [Radeon HD 4350/4550] Could you help me on this. Regards, Deena

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• How to automatically mount a folder and change ownership from root in virtualbox

  - by Fiztban

  It is my first time using virtualbox and ubuntu (14.04), I am on a host Windows 7 OS. I am trying to mount a shared folder that has files I need to access both in the virtualbox and on the windows OS. I have successfully mounted them using the vboxsf from the Guest Additions installed. To mount I used the command sudo mount -t vboxsf <dir name in vbox> <directory in linux for example I used sudo mount -t vboxsf Test /home/user/Test I found several ways of mounting the directories automatically upon startup using for example the /etc/rc.local method (here) where you modify said file appending the command to it (without sudo). Or by using the fstab method (here). I prefer the rc.local method personally. Once mounted it has permissions dr-xr-xr-x however once mounted the directory is of root ownership and chown user /home/user/Test has no effect. This means I cannot make or change files in it as a normal user. In the VirtualBox the directory to be shared is not set as read-only. Is there a way to automatically mount the shared folder and assign ownership to my non root user?

  Read the article

• How to install windows on a server with no CD or DVD drive

  - by user29266

  I've found a few posts on this site, however my situation is different. I have a new Dell server with no OS installed. I would like to install Windows 2008 Web Edition. I have a few USB ports and Ethernet. No CD or DVD drives. Is this article the best & only way to proceed? Installing Windows 2008 via USB thumbdrive or should I just get a external hardrive and hook it up to a usb. Once the OS is installed I'll never need a DVD drive again - so that's idea is a waste of money.

  Read the article

• Top causes of slow ssh logins

  - by Peter Lyons

  I'd love for one of you smart and helpful folks to post a list of common causes of delays during an ssh login. Specifically, there are 2 spots where I see a range from instantaneous to multi-second delays. Between issuing the ssh command and getting a login prompt and between entering the passphrase and having the shell load Now, specifically I'm looking at ssh details only here. Obviously network latency, speed of the hardware and OSes involved, complex login scripts, etc can cause delays. For context I ssh to a vast multitude of linux distributions and some Solaris hosts using mostly Ubuntu, CentOS, and MacOS X as my client systems. Almost all of the time, the ssh server configuration is unchanged from the OS's default settings. What ssh server configurations should I be interested in? Are there OS/kernel parameters that can be tuned? Login shell tricks? Etc?

  Read the article

• Win7 Professional x64 16GB (4.99GB usable)

  - by Killrawr

  I've installed Corsair Vengeance CMZ16GX3M2A1600C10, 2x8GB, DDR3-1600, PC3-12800, CL10, DIMM and my BIOS picks up that there is 16GB, Windows says there is 16GB, CPU-z says there is 16GB. But it only says I can use 4.99GB out of 16GB. Motherboard is P55-GD65 (MS-7583) Supports four unbuffered DIMM of 1.5 Volt DDR3 1066/1333/1600*/2000*/2133* (OC) DRAM, 16GB Max Windows (Above screenshot specifies that I am on a System type: 64-bit OS) CPU-z Microsoft says that the physical memory limit on a 64 bit win7 professional operating system is 192GB. Dxdiag Run Command BIOS Screenshot #1 BIOS Screenshot #2 Why is my OS limiting me to just over a quarter of the available memory? is there anyway to increase it?

  Read the article

• Solaris 11 installed, no updates?

  - by Paul De Niro

  I was messing around with solaris and decided to give Solaris 11 a try so I downloaded it from the Oracle website. After installing the OS, I went into the package manager and did an update. It told me that there were to available updates! I find this hard to believe considering that it's running a vulnerable version of firefox and java, its own in-house software product! Many of the other software products that came with the default install are also out of date and vulnerable. Is this normal for an Oracle install, or did I do something wrong with the upgrade process? I typed "pkg update" at the prompt, and I noticed that it did call out to pkg.oracle.com looking for updates. I find it bizarre that there are no updates available for an OS that was released a couple months ago with vulnerable software...

  Read the article

• How to delete a folder in python when [Error 32] is present

  - by harish

  I am using python 2.7. I want to delete a folder which may or may not be empty. The folder is handled by thread for file-monitoring. I am not able to kill thread but wanted to delete this folder any how. I tried with os.rmdir(Location) shutil.rmtree(Location) os.unlink(Location) But, it didn't work. It is showing error as [Error 32] The process cannot access the file because it is being used by another process: 'c:\\users\\cipher~1\\appdata\\local\\temp\\fis\\a0c433973524de528420bbd56f8ede609e6ea700' I want to delete folder a0c433973524de528420bbd56f8ede609e6ea700 or delete whole path will also suffice.

  Read the article

• How to use HFS formatted pen drive in Windows 7?

  - by row-sun

  I recently used disk utility in my mac book pro to format my 8 GB pen drive to install OS X. After that I formatted my pen drive from disk utility as FAT32 so that I would be able to use it in windows. But in windows the pen drive does not show up. When I right click on my computer and click manage and then disk management, the pen drive is listed there, but it doesn't show up in the explorer and I cant use it. I tried to do many things but I'm still not being able to use it in windows though I can use it in Mac OS X. Could anyone help? Thanks.

  Read the article

• Starting VM as an executable with as low overhead as possible

  - by Robert Koritnik

  Is there a solution to create a virtual machine and start it by having an executable file, that will start the machine? If possible to start as quickly as possible. Strange situation? Not at all. Read on... Real life scenario Since we can't have domain controller on a non-server OS it would be nice to have domain controller in an as thin as possible machine (possibly Samba or similar because we'd like to make it startup as quickly as possible - in a matter of a few seconds) packed in a single executable. We could then configure our non-server OS to run the executable when it starts and before user logs in. This would make it possible to login into a domain.

  Read the article

• Installation on SSD with Windows preinstalled

  - by ebbot

  I bought a laptop with this fancy SSD drive, fancy new UEFI aso. I figured at first Windows out Ubuntu in but after doing 3 DoA on 3 laptops in one day I realized that maybe keeping Windows could come in handy. So dual boot it is. And this is what I've got: Disk 1 - 500 Gb HD 300 Mb Windoze only says "Healthy" don't know what it's for. 600 Mb "Healthy (EFI partition)" 186.30 Gb NTFS "OS (C:)" "Healthy (Boot, Page File, Crash Dump, Primary Partition)" 258.45 Gb NTFS "Data (D:)" "Healthy" 20.00 Gb "Healthy (Recovery Partition)" Disk 2 - 24 Gb SSD 4.00 Gb "Healthy (OEM Partition)" 18.36 Gb "Healthy (Primary Partition)" So I'm not sure what the first partition on each drive does (the 300 Gb on the HD and the OEM Partition on the SSD. Nor do I know what Data (D:). I think the 2nd partition on the SSD is for some speedup of Windoze. I'm debating if I should shrink the OS (C:) drive to around 120 GB or so. Clear the Data (D:) and also use the whole SSD for Ubuntu. That would leave me 24 Gb for e.g. / on the SSD and some 320 Gb on the HD for /home and swap. Is this a reasonable setup? Do I need to configure fstab for the SSD differently to a HD?

  Read the article

• Blacklist a single access point of a wireless network

  - by Zr40

  At my university, one of the wireless access points is failing. When something tries to associate to the network using that access point, it deassociates the client, claiming 802.1X authentication failure. Other access points do work normally using the same credentials. The issue has been reported, but after a month it still has still not been fixed. Now, I'm looking for a way to blacklist the access point's BSSID, so the OS prefers other access points on the same SSID. How can I blacklist specific BSSIDs in either Mac OS X Snow Leopard or Windows 7?

  Read the article

• What are the major distinctions between PureDarwin and FreeBSD?

  - by ??????? ???????????

  I'm looking to install a different unix on my workstation to acquire some perspective on GNU/Linux and out of curiosity. I have narrowed my options down to these two. The reason for considering PureDarwin is because I have very little experience with Apple's products. So my question is will installing and using PureDarwin give me a closer understanding of OSX than would running FreeBSD? What I have in mind are day to day routines like adding users, installing software and configuring various aspects of the underlying OS. I know that the GUI of OSX would not be available, but that is not a concern. As a secondary, less important question, can I buy OS X in the apple store and run it in a virtual machine or does that violate their EULA?

  Read the article

• Mozilla sort un SDK pour JetPack, la révolution est en marche dans le développement des extensions d

  Mozilla sort un SDK pour JetPack La révolution dans le développement des extensions de Firefox est en marche La Fondation Mozilla est consciente que l'arrivée de Chrome et de ses extensions - visiblement plus simples à créer - représente un danger pour sa communauté de développeurs. Elle n'a certes pas lancé le projet pour cela, mais JetPack devrait cependant l'aider à rester dans la course et à conserver son attrait. Pour mémoire JetPack est un pr...

  Read the article

• Debian doesn't boot after removing secondary hard drive

  - by Daveel

  In the beginning I had Debian 6 running on one hard drive (/dev/sda1). Then I decided to keep all my stuff(pics, videos, etc..) in another slave hard drive (/dev/sdb1). So sda1 has Debian OS sdb1 doesn't contain any OS files I have made it to mount automatically by adding a row in /etc/fstab (UUID and directory to mount to) Time have passed and when I tried to change that secondary hard drive with another hard drive with bigger capacity, for some reason Debian won't boot (just itself sda1) after removing secondary hard drive (sdb1) But if I plug sdb1 back, it boots just fine. I tried to comment line out from /etc/fstab, so it doesn't mount And also did update-grub after umount /dev/sdb1 What's the right way to remove hard drive secondary hard drive?

  Read the article

• Compiz problems in Ubuntu 12.10

  - by Antonio Raffaele Iannaccone

  I have installed ubuntu 12.10 x64 on my notebook and I wanted to make a little customization in the UI, so i downloaded Compiz Settings Manager and opened it up. Once I opened it up, I found out that in the compiz are not all those settings and animations (that I could apply like on the photos, videos etc.) so I reinstalled it few times. Once I get bored with the reinstalling I checked one field in there and Ubuntu (OS) started to get "lagged" (Dash get hid, OS started to do not respond very well). So please, can anyone help me? How can I customize my ubuntu without get lagged and with all the animations that have to be available in the compiz? Thanks to all! thank you! It seems that it helped to fix the Dash-hide problem, but I still do not have all the animations and features that have to be in the Compiz (program). Can you help me with this too please? Thanks a lot!

  Read the article

• Le succès de Windows 7 se confirme en entreprise et présage une adoption rapide et massive, selon Fo

  Mise à jour du 27/05/10 Le succès de Windows 7 se confirme en entreprise Et présage une adoption rapide et massive, selon Forrester Nouvelle étude à 500 $ pour le cabinet Forrester... qui accepte néanmoins de livrer quelques conclusions pour 0 Euro. « Corporate Desktop Operating System And Browser Trends, Q2 2009 To Q2 2010 » nous apprend donc que Windows 7 arrive (sic) et que Firefox et Chrome ne cessent de progresser (une constatation déjà fait...

  Read the article

• Why am I getting [mount error(22): Invalid argument] while trying to mount SMB network drive?

  - by Steve_

  Disclaimer: I am very new to Linux :) Anyway, onward: I have a fresh instance of Ubuntu Server (12.04.1 LTS) running on my network and I want to mount a network drive to the server so I can access the contents. The network drive is a SAMBA compatible drive running Darwin OS. If I run the following command: smbclient -L //192.168.0.2 -U myuser It prompts me for the password and then displays output similar to: Domain=[SERVER01] OS=[Darwin] Server=[@(#)PROGRAM:smbd PROJECT:smbx-105.4.0] Sharename Type Comment --------- ---- ------- Comp Staff's Public Folder Disk CompRaid03 Disk Dropbox Disk Groups Disk IPC$ IPC Public Disk Users Disk compstaff Disk However, when I try and mount the CompRaid03 share, using this command: sudo mount -t cifs //192.168.0.2/CompRaid03 /mnt/myshare -o username=myuser I get the same password prompt, but after putting the correct password in, I received this error: mount error(22): Invalid argument dmesg | tail returns: [23576.037373] CIFS VFS: cifs_mount failed w/return code = -22 I don't understand what is wrong with this command. I've managed to mount a share on my current (Windows 8) machine using basically the same command but with a different IP address and share name (obviously). I've spent a good few hours trying to solve this and got no where. Any help or pointers would be greatly appreciated. Thanks Steve EDIT As suggested I've also trued using "user=" instead of "username=": sudo mount -t cifs //192.168.0.2/CompRaid03 /mnt/svnrepo -o user=myuser This results in the same "Invalid argument" error.

  Read the article

• What does this error mean (Can't create TCP/IP socket (24))?

  - by user105196

  I have web server with OS RHEL 6.2 and Mysql 5.5.23 on another server and the web server can read from Mysql server without problem, but some time I got this error: [Sun Sep 23 06:13:07 2012] [error] [client XXXXX] DBI connect('XXXX:192.168.1.2:3306','XXX',...) failed: Can't create TCP/IP socket (24) at /var/www/html/file.pm line 199. my question : What does this error mean (Can't create TCP/IP socket (24))? is it OS error or Mysql error ? perl -v This is perl, v5.10.1 (*) built for x86_64-linux-thread-multi mysql -V mysql Ver 14.14 Distrib 5.5.23, for Linux (x86_64) using readline 5.1 su - mysql -s /bin/bash -c 'ulimit -a' core file size (blocks, -c) 0 data seg size (kbytes, -d) unlimited scheduling priority (-e) 0 file size (blocks, -f) unlimited pending signals (-i) 127220 max locked memory (kbytes, -l) 64 max memory size (kbytes, -m) unlimited open files (-n) 1024 pipe size (512 bytes, -p) 8 POSIX message queues (bytes, -q) 819200 real-time priority (-r) 0 stack size (kbytes, -s) 10240 cpu time (seconds, -t) unlimited max user processes (-u) 1024 virtual memory (kbytes, -v) unlimited file locks (-x) unlimited

  Read the article

< Previous Page | 344 345 346 347 348 349 350 351 352 353 354 355  | Next Page >