Search Results

Search found 36506 results on 1461 pages for 'unsigned long long int'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 41/1461 | < Previous Page | 37 38 39 40 41 42 43 44 45 46 47 48  | Next Page >

  • sudo taking long time

    - by Sam
    On a Ubuntu 9 64bit Linux machine, sudo takes longer time to start. "sudo echo hi" takes 2-3 minutes. strace on sudo tells poll("/etc/pam.d/system-auth", POLLIN) timesout after 5 seconds and there are multiple calls(may be a loop) to same system call (which causes 2-3min delay). Any idea why sudo has to wait for /etc/pam.d/system-auth? Any tunable to make sudo to timeout faster? Thanks Samuel

    Read the article

  • Long connection times from PHP to MySQL on EC2

    - by Erik Giberti
    I'm having an intermittent issue connecting to a database slave with InnoDB. Intermittently I get connections taking longer than 2 seconds. These servers are hosted on Amazon's EC2. The app server is PHP 5.2/Apache running on Ubuntu. The DB slave is running Percona's XtraDB 5.1 on Ubuntu 9.10. It's using an EBS Raid array for the data storage. We already use skip name resolve and bind to address 0.0.0.0. This is a stub of the PHP code that's failing $tmp = mysqli_init(); $start_time = microtime(true); $tmp-options(MYSQLI_OPT_CONNECT_TIMEOUT, 2); $tmp-real_connect($DB_SERVERS[$server]['server'], $DB_SERVERS[$server]['username'], $DB_SERVERS[$server]['password'], $DB_SERVERS[$server]['schema'], $DB_SERVERS[$server]['port']); if(mysqli_connect_errno()){ $timer = microtime(true) - $start_time; mail($errors_to,'DB connection error',$timer); } There's more than 300Mb available on the DB server for new connections and the server is nowhere near the max allowed (60 of 1,200). Loading on both servers is < 2 on 4 core m1.xlarge instances. Some highlights from the mysql config max_connections = 1200 thread_stack = 512K thread_cache_size = 1024 thread_concurrency = 16 innodb-file-per-table innodb_additional_mem_pool_size = 16M innodb_buffer_pool_size = 13G Any help on tracing the source of the slowdown is appreciated. [EDIT] I have been updating the sysctl values for the network but they don't seem to be fixing the problem. I made the following adjustments on both the database and application servers. net.ipv4.tcp_window_scaling = 1 net.ipv4.tcp_sack = 0 net.ipv4.tcp_timestamps = 0 net.ipv4.tcp_fin_timeout = 20 net.ipv4.tcp_keepalive_time = 180 net.ipv4.tcp_max_syn_backlog = 1280 net.ipv4.tcp_synack_retries = 1 net.core.rmem_max = 16777216 net.core.wmem_max = 16777216 net.ipv4.tcp_rmem = 4096 87380 16777216 net.ipv4.tcp_wmem = 4096 87380 16777216 [EDIT] Per jaimieb's suggestion, I added some tracing and captured the following data using time. This server handles about 51 queries/second at this the time of day. The connection error was raised once (at 13:06:36) during the 3 minute window outlined below. Since there was 1 failure and roughly 9,200 successful connections, I think this isn't going to produce anything meaningful in terms of reporting. Script: date /root/database_server.txt (time mysql -h database_Server -D schema_name -u appuser -p apppassword -e '') /dev/null 2 /root/database_server.txt Results: === Application Server 1 === Mon Feb 22 13:05:01 EST 2010 real 0m0.008s user 0m0.001s sys 0m0.000s Mon Feb 22 13:06:01 EST 2010 real 0m0.007s user 0m0.002s sys 0m0.000s Mon Feb 22 13:07:01 EST 2010 real 0m0.008s user 0m0.000s sys 0m0.001s === Application Server 2 === Mon Feb 22 13:05:01 EST 2010 real 0m0.009s user 0m0.000s sys 0m0.002s Mon Feb 22 13:06:01 EST 2010 real 0m0.009s user 0m0.001s sys 0m0.003s Mon Feb 22 13:07:01 EST 2010 real 0m0.008s user 0m0.000s sys 0m0.001s === Database Server === Mon Feb 22 13:05:01 EST 2010 real 0m0.016s user 0m0.000s sys 0m0.010s Mon Feb 22 13:06:01 EST 2010 real 0m0.006s user 0m0.010s sys 0m0.000s Mon Feb 22 13:07:01 EST 2010 real 0m0.016s user 0m0.000s sys 0m0.010s [EDIT] Per a suggestion received on a LinkedIn question, I tried setting the back_log value higher. We had been running the default value (50) and increased it to 150. We also raised the kernel value /proc/sys/net/core/somaxconn (maximum socket connections) to 256 on both the application and database server from the default 128. We did see some elevation in processor utilization as a result but still received connection timeouts.

    Read the article

  • How to improve long text readability in Chrome?

    - by amiregelz
    I need to start reading The TCP/IP Guide. I have to admit that compared to other informative guides/tutorials/articles out there, this guide isn't so cluttered. However, I still find it a little bit hard to read, especially when reading for several hours. I don't know if it's the font, the contrast or the spacing, but this is why I've always preferred learning from books rather than from the internet. What can I do to make this guide more readable? I am reading it on Google Chrome.

    Read the article

  • Win 7 laptop taking a long time to log on when off the domain

    - by pigeon
    I've clicked through on a few forums but unable to find a suggestion for this issue. I have a user with a HP laptop which will boot perfectly fine whilst connected to the network but at home it will take 4 minutes to log on. Some suggestions I have had is that its looking for the DNS server of the domain. Another was that it was suggested it was a roaming profile (it isn't). So hoping someone has encountered Windows 7 acting like this and has some suggestions. The other users on this domain don't have the issue and its a mix of XP and Win 7 client PCs.

    Read the article

  • How long are fragmented TCP fragments kept in the TCP server

    - by Justin
    Suppose that a given TCP fragment is fragmented into two IP datagrams, and that the first datagram arrives to the TCP server, but the second datagram never arrives. After a certain amount of time the TCP server sends a keepalive, and determines that the client is alive. What does the TCP server then do with this first datagram? Does is wait for the second datagram to arrive, or does it discard the first datagram?

    Read the article

  • MySQL taking a long time to start

    - by Dscoduc
    I'm running Windows Server 2008 with MySQL installed and every time I reboot the server the MySQL Service doesn't start right away. A look into the Windows Eventlog shows that the MySQL Service was hung at startup. Looking at the Services.msc console shows the service state at Starting... Eventually, like 10 minutes, the MySQL Service actually finishes the startup process and the database becomes available for my Wordpress server... I looked at the MySQL .err files and didn't find anything that would indicate a delay in the statup process... Can anyone suggest a way to determine what is causing the delay, and more importantly, how to prevent the delay in the MySQL Startup?

    Read the article

  • MS Vista taking too long to identify Wi-Fi connection [closed]

    - by I_M_SUPER_USER
    I with few of my flat-mates share internet connection by using ASL cable into one laptop and then making Adhoc private network so that we all can enjoy internet connectivity. It all worked wonderful few initial days, but now my MS vista is taking much time to identify that adhoc network and it though I am connected to my friend, it takes 5-10 minutes untill I use internet.

    Read the article

  • Listing the routing table takes long time to complete

    - by Rafal Rawicki
    When I print routes defined on my computer using route, it takes about 5 to 20 seconds to complete. Why does it take so much time? With VPN enabled: $ time sudo route Kernel IP routing table (...) real 0m21.423s user 0m0.000s sys 0m0.012s With no VPN, this is about 5 seconds - still, computer can do a lot in this time. I've repeated my measurements few times, getting very similar results each try. My machine is Ubuntu with 3.0.0 kernel, but as far as I know, route on the other computers works the same way.

    Read the article

  • IBM x3620 Server takes a long time to boot past UEFI to OS

    - by Joel Coel
    I have a pair of IBM System x3620 servers. These servers do fine once they finally reach the point where the operating system takes over, but it takes them forever to get past the new-fangled UEFI boot system... a good five minutes or so; maybe longer. I haven't timed it, but it's the kind of thing where you go get a cup of coffee while you wait and it's still going when you come back. Normally the only time I shut these down is for a monthly maintenance cycle (usually just windows updates), and so it's not a big deal. But in the case where I might have an outage I'd sure like to get that 5 minutes back. Is there anything I can do to tell them to just go ahead and boot already?

    Read the article

  • Huge excel sheet taking too long to update links or calculate formulae

    - by user7231
    I have Excel sheet with 5000 rows and columns till AY (size 12MB). Except for the first 6 columns, rest contain either vlookups or formulae. All the vlookups are in separate Excel sheet. I have changed the Excel setting to manually update the links and calculate formulae. Now everytime I try to update the links, either the Excel sheet hangs or it takes something like 15 minutes. Any ideas on how I can get it done quickly.

    Read the article

  • Long string insertion with sed

    - by Luis Varca
    I am trying to use this expression to insert the contents of one text file into another after a give string. This is a simple bash script: TEXT=`cat file1.txt` sed -i "/teststring/a \ $TEXT" file2.txt This returns an error, "sed: -e expression #1, char 37: unknown command: `M'" The issue is in the fact that the contents of file1.txt are actually a private certificate so it's a large amount of text and unusual characters which seems to be causing an issue. If I replace $TEXT with a simple ASCII value it works but when it reads the large content of file1.txt it fails with that error. Is there some way to carry out this action? Is my syntax off with sed or my quote placement wrong?

    Read the article

  • Windows Phone 7 Emulator is very long to load

    - by Frederick Marcoux
    I have the Windows Phone 7.1 SDK on my computer with Visual Studio 2010 Ultimate. I have developped an application but when I want to start it in emulator, it takes about 2 hours to load it, and it's just the O/S! The application isn't started! Is there a way to view the Task Managerof Windows Phone to know why it doesn't load? Specs: Intel Core 2 Duo 3.0Ghz VT-x 2GB of DDR2 RAM (800Mhz) Windows 7 Professionnal SP1 64-bit

    Read the article

  • Tape vs SSDs backups regarding long-term storage reliability

    - by user66131
    My question is very specifically about solid state drives, not regular hard drives. I would like to put in place a grandfather-father-son backup scheme, with the SSDs being used for the grandfather and father portions, and the yearly grandfather would be locked in a safe offsite for maybe 5-10 years. Can I expect that after this period of time the data would be preserved as well as it would be on a tape?

    Read the article

  • Moving folders take long in windows 7

    - by acidzombie24
    What can i do to fix this? maybe drop permission properties? maybe not. I have a large folder with 100k files. I moved it into my archive folder and its taking forever to move. Why is that? I know on XP it takes <1sec but not on windows 7. I am sure its a permission thing, is there a way i can disable it and make it faster?

    Read the article

  • HP Laptop recognizes hard drive just long enough to install windows

    - by Joe
    I have an HP laptop, DV6500 (CTO). It refused to boot one day, so I ran some diagnostics (a friend lent me "Hirens Boot Disk", "UBCD" and "PC DR 6"). Everything passed, except for the hdd. I replaced the HDD with a used drive of unknown condition. Installed windows with no problems. Installed the wireless driver, tried to reboot ... no luck. So I went to Best Buy, bought a brand new Western Digital 320gb HDD. Put it in the machine, installed windows (vista home premium). Installed the wired networking driver. Tried to reboot. No luck. Put the first hdd back in the machine, reinstalled windows. Started to install some drivers, went to reboot, and the machine won't come back to life. Put the second hdd in the machine, rinse wash and repeat. I've replaced the memory, even though it passed diagnostics. Problem exists with both brand new memory, and old memory. The BIOS recognizes the hard drive. The computer freezes directly after the bios splash screen, and there is no hard drive activity light. I've tried two linux live distros (gentoo and ubuntu). Neither would run on this laptop, but will on a different HP laptop. UBCD and Hirens Boot Disk both ran, as did PC Doctor 6 which refuses to test anything (gets stuck at "enumerating hard disks"). Is there anything else I can try?

    Read the article

  • How long does it take for a server to get 'off greylisting'

    - by Michael
    Hi all, I asked a question regarding email delays a few months ago, and I think I found a workaround. I changed our email from "[email protected]" to "[email protected]", and it seems to work instantly again. After reading some articles, I believe this could be due to some form of greylisting, though some servers might call it something else -- if a server like yahoo or gmail receive email from a server that it is not used to receiving email from, then sometimes the delay occurs. But a name such as yahoo, gmail, which requires a user to sign up manually -- this delay can be avoided. My question is this: does anyone know more about this issue -- especially since it would be nice to send an email from our own site, instead of needing to use a whitelisted server? Thanks!

    Read the article

  • Dir and Findstr commands taking a long time to complete in Batch File

    - by user2405934
    dir %DRIVE_NAME%: /S /C /A-D /Q /T:C | findstr ".zip$ .doc$ .xls$ .xpt$ .cpt$ .cpo$ .xlsx$ .pdf$ .dat$ .txt$ .docx$ .csv$" >> file.info I am using above command to list all information in file, as below: 03/27/2013 01:02 PM 86,280 uusr\fr02 h123_frf67_rk_20140327.txt 03/27/2013 01:02 PM 5,513 usr\fr02 h123_frf67_rk_20140328.txt %DRIVE_NAME%: is mapped drive. Folders will be the same; not more than 100 folders and their sub-folders, and there will only be 2 or 3 files at time in any one of the folders. Now the issues is that for one folder it works perfect, but for 80 to 90 folders it is taking too much time. I think it's because of findstr and the different extensions used. Is there any way to make it faster?

    Read the article

  • Network folder image thumbnails taking long time to load

    - by Steve
    Our internal network folder can take up to 5 seconds to generate a thumbnail for each photo in a network folder. Usually, only 10% of thumbnails actually display; the rest are default jpg icons. A thumbs.db file already exists inside this folder, so presumably the thumbnails have been generated before. Why do they have to be generated again? The PC is Win7 64-bit. The server is Windows 2003 Server SP2.

    Read the article

  • Web server freezing or taking too long to load page sometimes

    - by Samer
    This is happens once in a while, but sometimes when I try to load a web page from my server it just freezes there for a minute trying to load it. I'm not sure what's causing the issue, or have been able to recreate it. My guess is that one of the softwares I listed below is freezing or something. What are some techniques I can use to troubleshoot the situation? Specs: nginx php-fpm php5.5 freebsd 9.1

    Read the article

  • Squid closing the connection on long HTTP GET requests

    - by Rhys
    When running a database query on a specific external site we use, Squid seems to cut off the connection after a consistent period of time (just over a minute). The query is submitted through a standard web form is that uses GET to query their database. Firefox 3 just displays a blank page. Internet Explorer throws a 'Page Cannot Be Displayed' error (tested in v6 and v8). When we perform the same query on the same machine, but bypass the Squid proxy, it works fine. The query takes about two and a half minutes to complete. There are a few timeout settings in Squid, but I honestly don't know what one to be looking at. Any possible solutions would be much appreciated. Cheers

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 37 38 39 40 41 42 43 44 45 46 47 48  | Next Page >