Search Results

Search found 23474 results on 939 pages for 'xml import'.

Page 435/939 | < Previous Page | 431 432 433 434 435 436 437 438 439 440 441 442  | Next Page >

  • Avoiding nesting two for loops

    - by chavanak
    Hi, Please have a look at the code below: import string from collections import defaultdict first_complex=open( "residue_a_chain_a_b_backup.txt", "r" ) first_complex_lines=first_complex.readlines() first_complex_lines=map( string.strip, first_complex_lines ) first_complex.close() second_complex=open( "residue_a_chain_a_c_backup.txt", "r" ) second_complex_lines=second_complex.readlines() second_complex_lines=map( string.strip, second_complex_lines ) second_complex.close() list_1=[] list_2=[] for x in first_complex_lines: if x[0]!="d": list_1.append( x ) for y in second_complex_lines: if y[0]!="d": list_2.append( y ) j=0 list_3=[] list_4=[] for a in list_1: pass for b in list_2: pass if a==b: list_3.append( a ) kvmap=defaultdict( int ) for k in list_3: kvmap[k]+=1 print kvmap Normally I use izip or izip_longest to club two for loops, but this time the length of the files are different. I don't want a None entry. If I use the above method, the run time becomes incremental and useless. How am I supposed to get the two for loops going? Cheers, Chavanak

    Read the article

  • Python Imaging: YCbCr problems

    - by daver
    Hi, I'm doing some image processing in Python using PIL, I need to extract the luminance layer from a series of images, and do some processing on that using numpy, then put the edited luminance layer back into the image and save it. The problem is, I can't seem to get any meaningful representation of my Image in a YCbCr format, or at least I don't understand what PIL is giving me in YCbCr. PIL documentation claims YCbCr format gives three channels, but when I grab the data out of the image using np.asarray, I get 4 channels. Ok, so I figure one must be alpha. Here is some code I'm using to test this process: import Image as im import numpy as np pengIm = im.open("Data\\Test\\Penguins.bmp") yIm = pengIm.convert("YCbCr") testIm = np.asarray(yIm) grey = testIm[:,:,0] grey = grey.astype('uint8') greyIm = im.fromarray(grey, "L") greyIm.save("Data\\Test\\grey.bmp") I'm expecting a greyscale version of my image, but what I get is this jumbled up mess: http://i.imgur.com/zlhIh.png Can anybody explain to me where I'm going wrong? The same code in matlab works exactly as I expect.

    Read the article

  • How to properly close a process with NppExec?

    - by Sam the Great
    I'm not sure what's going on here, but the following code continues running even after I end the process in the NppExec console with Ctrl-C (during the execution of the while loop). I restarted my computer to stop the Ctrl key sends. However, if I run the script in Window's cmd prompt, Ctrl-C ends the script just fine. import time import win32com.client shell = win32com.client.Dispatch("WScript.Shell") time.sleep(2) while True: shell.SendKeys('^') # Ctrl key time.sleep(0.5) The NppExec run command I used was: cmd /C python -u "$(FULL_CURRENT_PATH)" Let me know if there is any more information I can provide. Thanks.

    Read the article

  • keyDown works but i get beeps

    - by Oscar
    I just got my keydown method to work. But i get system beep everytime i press key. i have no idea whats wrong. Googled for hours and all people say is that if you have your keyDown method you should also implement the acceptsFirstResponder. did that to and it still doesn't work. #import <Cocoa/Cocoa.h> #import "PaddleView.h" #import "BallView.h" @interface GameController : NSView { PaddleView *leftPaddle; PaddleView *rightPaddle; BallView * ball; CGPoint ballVelocity; int gameState; int player1Score; int player2Score; } @property (retain) IBOutlet PaddleView *leftPaddle; @property (retain) IBOutlet PaddleView *rightPaddle; @property (retain) IBOutlet BallView *ball; - (void)reset:(BOOL)newGame; @end #import "GameController.h" #define GameStateRunning 1 #define GameStatePause 2 #define BallSpeedX 0.2 #define BallSpeedY 0.3 #define CompMoveSpeed 15 #define ScoreToWin 5 @implementation GameController @synthesize leftPaddle, rightPaddle, ball; - (id)initWithCoder:(NSCoder *)aDecoder { self = [super initWithCoder:aDecoder]; if(self) { gameState = GameStatePause; ballVelocity = CGPointMake(BallSpeedX, BallSpeedY); [NSTimer scheduledTimerWithTimeInterval:0.001 target:self selector:@selector(gameLoop) userInfo:nil repeats:YES]; } return self; } - (void)gameLoop { if(gameState == GameStateRunning) { [ball setFrameOrigin:CGPointMake(ball.frame.origin.x + ballVelocity.x, ball.frame.origin.y + ballVelocity.y)]; if(ball.frame.origin.x + 15 > self.frame.size.width || ball.frame.origin.x < 0) { ballVelocity.x =- ballVelocity.x; } if(ball.frame.origin.y + 35 > self.frame.size.height || ball.frame.origin.y < 0) { ballVelocity.y =- ballVelocity.y; } } if(CGRectIntersectsRect(ball.frame, leftPaddle.frame)) { if(ball.frame.origin.x > leftPaddle.frame.origin.x) { ballVelocity.x =- ballVelocity.x; } } if(CGRectIntersectsRect(ball.frame, rightPaddle.frame)) { if(ball.frame.origin.x +15 > rightPaddle.frame.origin.x) { ballVelocity.x =- ballVelocity.x; } } if(ball.frame.origin.x <= self.frame.size.width / 2) { if(ball.frame.origin.y < leftPaddle.frame.origin.y + 75 && leftPaddle.frame.origin.y > 0) { [leftPaddle setFrameOrigin:CGPointMake(leftPaddle.frame.origin.x, leftPaddle.frame.origin.y - CompMoveSpeed)]; } if(ball.frame.origin.y > leftPaddle.frame.origin.y +75 && leftPaddle.frame.origin.y < 700 - leftPaddle.frame.size.height ) { [leftPaddle setFrameOrigin:CGPointMake(leftPaddle.frame.origin.x, leftPaddle.frame.origin.y + CompMoveSpeed)]; } } if(ball.frame.origin.x <= 0) { player2Score++; [self reset:(player2Score >= ScoreToWin)]; } if(ball.frame.origin.x + 15 > self.frame.size.width) { player1Score++; [self reset:(player1Score >= ScoreToWin)]; } } - (void)reset:(BOOL)newGame { gameState = GameStatePause; [ball setFrameOrigin:CGPointMake((self.frame.size.width + 7.5) / 2, (self.frame.size.height + 7.5)/2)]; if(newGame) { if(player1Score > player2Score) { NSLog(@"Player 1 Wins!"); } else { NSLog(@"Player 2 Wins!"); } player1Score = 0; player2Score = 0; } else { NSLog(@"Press key to serve"); } NSLog(@"Player 1: %d",player1Score); NSLog(@"Player 2: %d",player2Score); } - (void)moveRightPaddleUp { if(rightPaddle.frame.origin.y < 700 - rightPaddle.frame.size.height) { [rightPaddle setFrameOrigin:CGPointMake(rightPaddle.frame.origin.x, rightPaddle.frame.origin.y + 20)]; } } - (void)moveRightPaddleDown { if(rightPaddle.frame.origin.y > 0) { [rightPaddle setFrameOrigin:CGPointMake(rightPaddle.frame.origin.x, rightPaddle.frame.origin.y - 20)]; } } - (BOOL)acceptsFirstResponder { return YES; } - (void)keyDown:(NSEvent *)theEvent { if ([theEvent modifierFlags] & NSNumericPadKeyMask) { NSString *theArrow = [theEvent charactersIgnoringModifiers]; unichar keyChar = 0; if ( [theArrow length] == 0 ) { return; // reject dead keys } if ( [theArrow length] == 1 ) { keyChar = [theArrow characterAtIndex:0]; if ( keyChar == NSLeftArrowFunctionKey ) { gameState = GameStateRunning; } if ( keyChar == NSRightArrowFunctionKey ) { } if ( keyChar == NSUpArrowFunctionKey ) { [self moveRightPaddleUp]; } if ( keyChar == NSDownArrowFunctionKey ) { [self moveRightPaddleDown]; } [super keyDown:theEvent]; } } else { [super keyDown:theEvent]; } } - (void)drawRect:(NSRect)dirtyRect { } - (void)dealloc { [ball release]; [rightPaddle release]; [leftPaddle release]; [super dealloc]; } @end

    Read the article

  • No route matches when trying to edit

    - by mmichael
    Here's the scoop: I've created a test app that allows users to create ideas and then add "bubbles" to these ideas. Currently, a bubble is just text. I've successfully linked bubbles to ideas. Furthermore, when a user goes to view an idea it lists all of the bubbles attached to that idea. The user can even delete the bubble for any given idea. My problem lies in editing bubbles. When a user views an idea, he sees the idea's content as well as any bubbles for that idea. As a result, I've set all my bubble controls (editing and deleting) inside the ideas "show" view. My code for editing a bubble for an idea is <%= link_to 'Edit Bubble', edit_idea_bubble_path %>. I ran rake routes to find the correct path for editing bubbles and that is what was listed. Here's my error: No route matches {:action=>"edit", :controller=>"bubbles"} In my bubbles controller I have: def edit @idea = Idea.find(params[:idea_id]) @bubble = @idea.bubbles.find(params[:id]) end def update @idea = Idea.find(params[:idea_id]) @bubble = @idea.bubbles.find(params[:id]) respond_to do |format| if @bubble.update_attributes(params[:bubble]) format.html { redirect_to(@bubble, :notice => 'Bubble was successfully updated.') } format.xml { head :ok } else format.html { render :action => "Edit" } format.xml { render :xml => @bubble.errors, :status => :unprocessable_entity } end end end To go a step further, I have the following in my routes.rb file resources :ideas do resources :bubbles end So far everything seems to function except when I try to edit a bubble. I'd love some guidance. Thanks!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Getting force close when i add view to other view when a thread is running

    - by Praveena
    Hi, I am getting the below error 12-30 05:40:40.484: ERROR/AndroidRuntime(413): Uncaught handler: thread Thread-10 exiting due to uncaught exception 12-30 05:40:40.494: ERROR/AndroidRuntime(413): android.view.ViewRoot$CalledFromWrongThreadException: Only the original thread that created a view hierarchy can touch its views. 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.ViewRoot.checkThread(ViewRoot.java:2629) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.ViewRoot.requestLayout(ViewRoot.java:545) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.View.requestLayout(View.java:7657) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.View.requestLayout(View.java:7657) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.View.requestLayout(View.java:7657) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.View.requestLayout(View.java:7657) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.View.requestLayout(View.java:7657) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.ViewGroup.addView(ViewGroup.java:1749) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.ViewGroup.addView(ViewGroup.java:1708) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.ViewGroup.addView(ViewGroup.java:1688) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at com.wwwww.shout.presentationLayer.Shout$1.run(Shout.java:137) and my code is myProgressDialog = ProgressDialog.show(Shout.this,"","Loading...",true); new Thread() { public void run() { String xml; xml="<spGetUserMessages><SearchLocation></SearchLocation></spGetUserMessages>"; messages =parse.GetGetUserMessages(dataparsing.ILGetUserMessages(xml)); myProgressDialog.dismiss(); ((LinearLayout)findViewById(R.id.LinearlayoutMessage)).addView(iiii); } }.start(); at the time of adding views to the layout i am getting the above error.what is the wrong in this.Please give me some suggestions.Thanks in advance

    Read the article

  • java.util.zip - ZipInputStream v.s. ZipFile

    - by lucho
    Hello, community! I have some general questions regarding the java.util.zip library. What we basically do is an import and an export of many small components. Previously these components were imported and exported using a single big file, e.g.: <component-type-a id="1"/> <component-type-a id="2"/> <component-type-a id="N"/> <component-type-b id="1"/> <component-type-b id="2"/> <component-type-b id="N"/> Please note that the order of the components during import is relevant. Now every component should occupy its own file which should be externally versioned, QA-ed, bla, bla. We decided that the output of our export should be a zip file (with all these files in) and the input of our import should be a similar zip file. We do not want to explode the zip in our system. We do not want opening separate streams for each of the small files. My current questions: Q1. May the ZipInputStream guarantee that the zip entries (the little files) will be read in the same order in which they were inserted by our export that uses ZipOutputStream? I assume reading is something like: ZipInputStream zis = new ZipInputStream(new BufferedInputStream(fis)); ZipEntry entry; while((entry = zis.getNextEntry()) != null) { //read from zis until available } I know that the central zip directory is put at the end of the zip file but nevertheless the file entries inside have sequential order. I also know that relying on the order is an ugly idea but I just want to have all the facts in mind. Q2. If I use ZipFile (which I prefer) what is the performance impact of calling getInputStream() hundreds of times? Will it be much slower than the ZipInputStream solution? The zip is opened only once and ZipFile is backed by RandomAccessFile - is this correct? I assume reading is something like: ZipFile zipfile = new ZipFile(argv[0]); Enumeration e = zipfile.entries();//TODO: assure the order of the entries while(e.hasMoreElements()) { entry = (ZipEntry) e.nextElement(); is = zipfile.getInputStream(entry)); } Q3. Are the input streams retrieved from the same ZipFile thread safe (e.g. may I read different entries in different threads simultaneously)? Any performance penalties? Thanks for your answers!

    Read the article

  • Event handling for keyboard strokes

    - by david
    Hey, I'm trying to get familiar with the whole keyboard event detection thing. Here's my sample code. <fx:Script> <![CDATA[ import flash.events.KeyboardEvent; import mx.controls.Alert; private function init():void{ addEventListener(KeyboardEvent.KEY_DOWN,reportKeyDown); } private function reportKeyDown(event:KeyboardEvent):void { Alert.show("a key was pressed"); } ]]> </fx:Script> As you can see, I'm at stage 0 of playing around with it, but it won't work. Anyone has any idea what I should be doing instead? Thanks

    Read the article

  • Importing an Excel WorkSheet into a Datatable

    - by Nick LaMarca
    I have been asked to create import functionality in my application. I am getting an excel worksheet as input. The worksheet has column headers followed by data. The users want to simply select an xls file from their system, click upload and the tool deletes the table in the database and adds this new data. I thought the best way would be too bring the data into a datatable object and do a foeach for every row in the datatable insert row by row into the db. My question is what can anyone give me code to open an excel file, know what line the data starts on in the file, and import the data into a datable object?

    Read the article

  • Gui problem after rewriting to MVC

    - by trevor_nise
    I'm practicing MVC style programming. I have a Mastermind game in a single file, working with no problems (maybe apart of the fact that "Check" button is invisible at start). http://paste.pocoo.org/show/226726/ But when I've rewritten it to model, view, controller files - when I click on empty Pin (that should be updated, and repainted with new color) - noting happens. Can anybody see any problems here ? I've tried placing repaint() in different places, but it simply does not work at all :/ Main : public class Main { public static void main(String[] args){ Model model = new Model(); View view = new View("Mastermind", 400, 590, model); Controller controller = new Controller(model, view); view.setVisible(true); } } Model : import java.util.Random; public class Model{ static final int LINE = 5, SCORE = 10, OPTIONS = 20; Pin pins[][] = new Pin[21][LINE]; int combination[] = new int[LINE]; int curPin = 0; int turn = 1; Random generator = new Random(); int repaintPin; boolean pinsRepaint=false; int pinsToRepaint; boolean isUpdate = true, isPlaying = true, isRowFull = false; static final int HIT_X[] = {270,290,310,290,310}, HIT_Y[] = {506,496,496,516,516}; public Model(){ for ( int i=0; i < SCORE; i++ ){ for ( int j = 0; j < LINE; j++ ){ pins[i][j] = new Pin(20,0); pins[i][j].setPosition(j*50+30,510-i*50); pins[i+SCORE][j] = new Pin(8,0); pins[i+SCORE][j].setPosition(HIT_X[j],HIT_Y[j]-i*50); } } for ( int i=0; i < LINE; i++ ){ pins[OPTIONS][i] = new Pin( 20, i+2 ); pins[OPTIONS][i].setPosition( 370,i * 50 + 56); } } void fillHole(int color) { pins[turn-1][curPin].setColor(color+1); pinsRepaint = true; pinsToRepaint = turn; curPin = (curPin+1) % LINE; if (curPin == 0){ isRowFull = true; } pinsRepaint = false; pinsToRepaint = 0; } void check() { int junkPins[] = new int[LINE], junkCode[] = new int[LINE]; int pinCount = 0, pico = 0; for ( int i = 0; i < LINE; i++ ) { junkPins[i] = pins[turn-1][i].getColor(); junkCode[i] = combination[i]; } for ( int i = 0; i < LINE; i++ ){ if (junkPins[i]==junkCode[i]) { pins[turn+SCORE][pinCount].setColor(1); pinCount++; pico++; junkPins[i] = 98; junkCode[i] = 99; } } for ( int i = 0; i < LINE; i++ ){ for ( int j = 0; j < LINE; j++ ) if (junkPins[i]==junkCode[j]) { pins[turn+SCORE][pinCount].setColor(2); pinCount++; junkPins[i] = 98; junkCode[j] = 99; j = LINE; } } pinsRepaint = true; pinsToRepaint = turn + SCORE; pinsRepaint = false; pinsToRepaint=0; if ( pico == LINE ){ isPlaying = false; } else if ( turn >= 10 ){ isPlaying = false; } else{ curPin = 0; isRowFull = false; turn++; } } void combination() { for ( int i = 0; i < LINE; i++ ){ combination[i] = generator.nextInt(6) + 1; } } } class Pin{ private int color, X, Y, radius; public Pin(){ X = 0; Y = 0; radius = 0; color = 0; } public Pin( int r,int c ){ X = 0; Y = 0; radius = r; color = c; } public int getX(){ return X; } public int getY(){ return Y; } public int getRadius(){ return radius; } public void setRadius(int r){ radius = r; } public void setPosition( int x,int y ){ this.X = x ; this.Y = y ; } public void setColor( int c ){ color = c; } public int getColor() { return color; } } View: import java.awt.*; import javax.swing.*; public class View extends Frame{ Model model; JButton checkAnswer; private JPanel button; private static final Color COLORS[] = {Color.black, Color.white, Color.red, Color.yellow, Color.green, Color.blue, new Color(7, 254, 250)}; public View(String name, int w, int h, Model m){ model = m; setTitle( name ); setSize( w,h ); setResizable( false ); this.setLayout(new BorderLayout()); button = new JPanel(); button.setSize( new Dimension(400, 100)); button.setVisible(true); checkAnswer = new JButton("Check"); checkAnswer.setSize( new Dimension(200, 30)); button.add( checkAnswer ); this.add( button, BorderLayout.SOUTH); button.setVisible(true); } @Override public void paint( Graphics g ) { g.setColor( new Color(238, 238, 238)); g.fillRect( 0,0,400,590); for ( int i=0; i < model.pins.length; i++ ) { paintPins(model.pins[i][0],g); paintPins(model.pins[i][1],g); paintPins(model.pins[i][2],g); paintPins(model.pins[i][3],g); paintPins(model.pins[i][4],g); } } @Override public void update( Graphics g ) { if ( model.isUpdate ) { paint(g); } else { model.isUpdate = true; paintPins(model.pins[model.repaintPin-1][0],g); paintPins(model.pins[model.repaintPin-1][1],g); paintPins(model.pins[model.repaintPin-1][2],g); paintPins(model.pins[model.repaintPin-1][3],g); paintPins(model.pins[model.repaintPin-1][4],g); } } void repaintPins( int pin ) { model.repaintPin = pin; model.isUpdate = false; repaint(); } public void paintPins(Pin p, Graphics g ){ int X = p.getX(); int Y = p.getY(); int color = p.getColor(); int radius = p.getRadius(); int x = X-radius; int y = Y-radius; if (color > 0){ g.setColor( COLORS[color]); g.fillOval( x,y,2*radius,2*radius ); } else{ g.setColor( new Color(238, 238, 238) ); g.drawOval( x,y,2*radius-1,2*radius-1 ); } g.setColor( Color.black ); g.drawOval( x,y,2*radius,2*radius ); } } Controller: import java.awt.*; import java.awt.event.*; public class Controller implements MouseListener, ActionListener { private Model model; private View view; public Controller(Model m, View v){ model = m; view = v; view.addWindowListener( new WindowAdapter(){ public void windowClosing(WindowEvent e){ System.exit(0); } }); view.addMouseListener(this); view.checkAnswer.addActionListener(this); model.combination(); } public void actionPerformed( ActionEvent e ) { if(e.getSource() == view.checkAnswer){ if(model.isRowFull){ model.check(); } } } public void mousePressed(MouseEvent e) { Point mouse = new Point(); mouse = e.getPoint(); if (model.isPlaying){ if (mouse.x > 350) { int button = 1 + (int)((mouse.y - 32) / 50); if ((button >= 1) && (button <= 5)){ model.fillHole(button); if(model.pinsRepaint){ view.repaintPins( model.pinsToRepaint ); } } } } } public void mouseClicked(MouseEvent e) {} public void mouseReleased(MouseEvent e){} public void mouseEntered(MouseEvent e) {} public void mouseExited(MouseEvent e) {} }

    Read the article

  • In an ASP.NET MVC site, where would the JQuery code go?

    - by Maxim Z.
    I'm just getting started with ASP.NET MVC. I'm going to be using JQuery on the website I'm making, but I'm not really sure about one thing: where would JQuery code be placed? This concerns two things: Where do I import the JQuery JavaScript file? (I've been thinking that the Master page would be a good place to do this; am I right, or do I have to import it in each view?) Should all my JQuery code be referenced from the Master page (i.e., I store my code that uses JQuery in a separate .js file and reference it in a <script> tag)? Thanks in advance.

    Read the article

  • setting url in yaml file for google app engin (page not found) problem

    - by mswallace
    I am new to python and I am super excited to learn. I am building my first app on app engin and I am not totally understanding why my yaml file is not resolving to the url that I set up. here is the code handlers: - url: .* script: main.py - url: /letmein/.* script: letmein.py so if I go to http://localhost:8080/letmein/ I get a link is brooken or page not found error. here is the python code that I have in letmein.py from google.appengine.ext import webapp from google.appengine.ext.webapp import util class LetMeInHandler(webapp.RequestHandler): def get(self): self.response.out.write('letmein!') def main(): application = webapp.WSGIApplication([('/letmein/', LetMeInHandler)], debug=True) util.run_wsgi_app(application) if __name__ == '__main__': main() thanks in advance for the help!

    Read the article

  • Converting IPv4 or IPv6 address to a long for comparisons

    - by Justin Akehurst
    In order to check if an IPv4 or IPv6 address is within a certain range, I've got code that takes an IPv4 address, turns that into a long, then does that same conversion on the upper/lower bound of the subnet, then checks to see if the long is between those values. I'd like to be able to do the same thing for IPv6, but saw nothing in the Python 2.6 standard libraries to allow me to do this, so I wrote this up: import socket, struct from array import array def ip_address_to_long(address): ip_as_long = None try: ip_as_long = socket.ntohl(struct.unpack('L', socket.inet_pton(socket.AF_INET, address))[0]) except socket.error: # try IPv6 try: addr = array('L', struct.unpack('!4L', socket.inet_pton(socket.AF_INET6, address))) addr.reverse() ip_as_long = sum(addr[i] << (i * 32) for i in range(len(addr))) except socket.error as se: raise ValueError('Invalid address') except Exception as e: print str(e) return ip_as_long My question is: Is there a simpler way to do this that I am missing? Is there a standard library call that can do this for me?

    Read the article

  • How to set the size of a wx.aui.AuiManager Pane that is centered?

    - by aF
    Hello, I have three panes with the InfoPane center option. I want to know how to set their size. Using this code: import wx import wx.aui class MyFrame(wx.Frame): def __init__(self, parent, id=-1, title='wx.aui Test', pos=wx.DefaultPosition, size=(800, 600), style=wx.DEFAULT_FRAME_STYLE): wx.Frame.__init__(self, parent, id, title, pos, size, style) self._mgr = wx.aui.AuiManager(self) # create several text controls text1 = wx.TextCtrl(self, -1, 'Pane 1 - sample text', wx.DefaultPosition, wx.Size(200,150), wx.NO_BORDER | wx.TE_MULTILINE) text2 = wx.TextCtrl(self, -1, 'Pane 2 - sample text', wx.DefaultPosition, wx.Size(200,150), wx.NO_BORDER | wx.TE_MULTILINE) text3 = wx.TextCtrl(self, -1, 'Main content window', wx.DefaultPosition, wx.Size(200,150), wx.NO_BORDER | wx.TE_MULTILINE) # add the panes to the manager self._mgr.AddPane(text1, wx.CENTER) self._mgr.AddPane(text2, wx.CENTER) self._mgr.AddPane(text3, wx.CENTER) # tell the manager to 'commit' all the changes just made self._mgr.Update() self.Bind(wx.EVT_CLOSE, self.OnClose) def OnClose(self, event): # deinitialize the frame manager self._mgr.UnInit() # delete the frame self.Destroy() app = wx.App() frame = MyFrame(None) frame.Show() app.MainLoop() I want to know what is called when we change the size of the panes. If you tell me that, I can do the rest by myself :)

    Read the article

  • How do I use timezones with a datetime object in python?

    - by jidar
    How do I properly represent a different timezone in my timezone? The below example only works because I know that EDT is one hour ahead of me, so I can uncomment the subtraction of myTimeZone() import datetime, re from datetime import tzinfo class myTimeZone(tzinfo): """docstring for myTimeZone""" def utfoffset(self, dt): return timedelta(hours=1) def myDateHandler(aDateString): """u'Sat, 6 Sep 2008 21:16:33 EDT'""" _my_date_pattern = re.compile(r'\w+\,\s+(\d+)\s+(\w+)\s+(\d+)\s+(\d+)\:(\d+)\:(\d+)') day, month, year, hour, minute, second = _my_date_pattern.search(aDateString).groups() month = [ 'JAN', 'FEB', 'MAR', 'APR', 'MAY', 'JUN', 'JUL', 'AUG', 'SEP', 'OCT', 'NOV', 'DEC' ].index(month.upper()) + 1 dt = datetime.datetime( int(year), int(month), int(day), int(hour), int(minute), int(second) ) # dt = dt - datetime.timedelta(hours=1) # dt = dt - dt.tzinfo.utfoffset(myTimeZone()) return (dt.year, dt.month, dt.day, dt.hour, dt.minute, dt.second, 0, 0, 0) def main(): print myDateHandler("Sat, 6 Sep 2008 21:16:33 EDT") if __name__ == '__main__': main()

    Read the article

  • Is it right that Strophe.addHandler reads only first node from response?

    - by markcial
    I'm starting to learn strophe library usage and when i use addHandler to parse response it seems to read only first node of xml response so when i receive a xml like that : <body xmlns='http://jabber.org/protocol/httpbind'> <presence xmlns='jabber:client' from='test2@localhost' to='test2@localhost' type='avaliable' id='5593:sendIQ'> <status/> </presence> <presence xmlns='jabber:client' from='test@localhost' to='test2@localhost' xml:lang='en'> <status /> </presence> <iq xmlns='jabber:client' from='test2@localhost' to='test2@localhost' type='result'> <query xmlns='jabber:iq:roster'> <item subscription='both' name='test' jid='test@localhost'> <group>test group</group> </item> </query> </iq> </body> With the handler testHandler used like that : connection.addHandler(testHandler,null,"presence"); function testHandler(stanza){ console.log(stanza); } It only logs : <presence xmlns='jabber:client' from='test2@localhost' to='test2@localhost' type='avaliable' id='5593:sendIQ'> <status/> </presence> What i am missing? is it a right behaviour? Should i add more handlers to get the other stanzas? Thanks for advance

    Read the article

  • Problem evaluating NULL in an IIF statement (Access)

    - by Mohgeroth
    Item in the recordset rstImportData("Flat Size") is = Null With that, given the following statement: IIF(IsNull(rstImportData("Flat Size")), Null, cstr(rstImportData("Flat Size"))) Result: Throws error 94: Invalid use of Null If I change the statement by removing the type conversion upon a false comparison: IIF(IsNull(rstImportData("Flat Size")), Null, 0) Result: Null It returns Null as it should have the first time. It appears that I cannot do a type conversion in an IIF if the value passed in should ever be null even if it passes an IIF test, it still attempts to evaluate it at both the true and false answer. The only reason I'm using IIF like this is because I have a 25 line comparison to compare data from an Import against a matching record in a database to see if I need to append the prior to history. Any thoughts? The way data is imported there will be null dates and where the spreadsheet import is in a string format I must convert either side to the other to compare the values properly but if either side is null this exception occurs :(

    Read the article

  • Haskell Ord instance with a Set

    - by mvid
    I have some code that I would like to use to append an edge to a Node data structure: import Data.Set (Set) import qualified Data.Set as Set data Node = Vertex String (Set Node) deriving Show addEdge :: Node -> Node -> Node addEdge (Vertex name neighbors) destination | Set.null neighbors = Vertex name (Set.singleton destination) | otherwise = Vertex name (Set.insert destination neighbors) However when I try to compile I get this error: No instance for (Ord Node) arising from a use of `Set.insert' As far as I can tell, Set.insert expects nothing but a value and a set to insert it into. What is this Ord?

    Read the article

  • GWT combobox not displaying correctly

    - by James
    Hi, I am using GWT with GWT-EXT running in glassfish. I create 2 combo boxes as follows: import com.extjs.gxt.ui.client.widget.form.ComboBox; import com.extjs.gxt.ui.client.widget.form.SimpleComboBox; this.contentPanel = new ContentPanel(); this.contentPanel.setFrame(true); this.contentPanel.setSize((int)(Window.getClientWidth()*0.95), 600); this.contentPanel.setLayout(new FitLayout()); initWidget(this.contentPanel); SimpleComboBox<String> combo = new SimpleComboBox<String>(); combo.setEmptyText("Select a topic..."); combo.add("String1"); combo.add("String2"); this.contentPanel.add(combo); ComboBox combo1 = new ComboBox(); combo1.setEmptyText("Select a topic..."); ListStore topics = new ListStore(); topics.add("String3"); topics.add("String4"); combo.setStore(topics); this.contentPanel.add(combo1); When these are loaded in the browser (IE 8.0, Firefox 3.6.6 or Chrome 10.0) the combo boxes are shown but don't have the pull down arrow. They look like a text field with the "Select a topic..." text. When you select the text it disappears and if you type a character and then delete it the options are shown (i.e. pull down is invoked) however, there is still no pull down arrow. Does anyone know what the issue might be? Or how I can investigate further? Is it possible to see the actual HTML the browser is getting, when I View Page Source I only get the landing page HTML. As an additional I also have a import com.google.gwt.user.client.ui.Grid that does not render correctly. It is in table format but has no grid lines or header bar etc. Cheers, James

    Read the article

  • What's the right way to use idlestartup on python 2.6.5?

    - by user210481
    Idlestartup is analogous to pythonstartup variable, but for IDLE, instead of command line. But it seems not to work properly. I'm using python 2.6.5 on Windows. I have the following script assigned to it: from pprint import pprint import sys newPath = 'C:\\Python26\test') sys.path.append(newPath) print "initial config loaded" Both variables Idlestartup and pythonstartup are assigned to the same file (script above). When running IDLE, pprint and sys are NOT available, the final message is NOT printed, but newPath was added to sys.path. Running the command line, pprint and sys are available, the final message is printed and newPath was added to sys.path. Is it a bug? Am I doing something wrong? Thanks

    Read the article

  • How to make a request from an android app that can enter a Spring Security secured webservice method

    - by johnrock
    I have a Spring Security (form based authentication) web app running CXF JAX-RS webservices and I am trying to connect to this webservice from an Android app that can be authenticated on a per user basis. Currently, when I add an @Secured annotation to my webservice method all requests to this method are denied. I have tried to pass in credentials of a valid user/password (that currently exists in the Spring Security based web app and can log in to the web app successfully) from the android call but the request still fails to enter this method when the @Secured annotation is present. The SecurityContext parameter returns null when calling getUserPrincipal(). How can I make a request from an android app that can enter a Spring Security secured webservice method? Here is the code I am working with at the moment: Android call: httpclient.getCredentialsProvider().setCredentials( //new AuthScope("192.168.1.101", 80), new AuthScope(null, -1), new UsernamePasswordCredentials("joeuser", "mypassword")); String userAgent = "Android/" + getVersion(); HttpGet httpget = new HttpGet(MY_URI); httpget.setHeader("User-Agent", userAgent); httpget.setHeader("Content-Type", "application/xml"); HttpResponse response; try { response = httpclient.execute(httpget); HttpEntity entity = response.getEntity(); ... parse xml Webservice Method: @GET @Path("/payload") @Produces("application/XML") @Secured({"ROLE_USER","ROLE_ADMIN","ROLE_GUEST"}) public Response makePayload(@Context Request request, @Context SecurityContext securityContext){ Payload payload = new Payload(); payload.setUsersOnline(new Long(200)); if (payload == null) { return Response.noContent().build(); } else{ return Response.ok().entity(payload).build(); } }

    Read the article

  • Dynamically creating page definitions in Cherrypy

    - by Hugh
    Hi, I've been looking around the CherryPy documentation, but can't quite get my head around what I want to do. I suspect it might be more of a Python thing than a CherryPy thing... My current class looks something like this: import managerUtils class WebManager: def A(self, **kwds): return managerUtils.runAction("A", kwds) A.enabled = True def B(self, **kwds): return managerUtils.runAction("B", kwds) B.enabled = True def C(self, **kwds): return managerUtils.runAction("C", kwds) C.enabled = True Obviously there's a lot of repetition in here. in managerUtils.py, I have a dict that's something like: actions = {'A': functionToRunForA, 'B': functionToRunForB, 'C': functionToRunForC} Okay, so that's a slightly simplistic view of it, but I'm sure you get the idea. I want to be able to do something like: import managerUtils class WebManager: def __init__(self): for action in managerUtils.actions: f = registerFunction(action) f.enabled = True Any ideas of how to do this?

    Read the article

  • Condition checking vs. Exception handling

    - by Aidas Bendoraitis
    When is exception handling more preferable than condition checking? There are many situations where I can choose using one or the other. For example, this is a summing function which uses a custom exception: # module mylibrary class WrongSummand(Exception): pass def sum_(a, b): """ returns the sum of two summands of the same type """ if type(a) != type(b): raise WrongSummand("given arguments are not of the same type") return a + b # module application using mylibrary from mylibrary import sum_, WrongSummand try: print sum_("A", 5) except WrongSummand: print "wrong arguments" And this is the same function, which avoids using exceptions # module mylibrary def sum_(a, b): """ returns the sum of two summands if they are both of the same type """ if type(a) == type(b): return a + b # module application using mylibrary from mylibrary import sum_ c = sum_("A", 5) if c is not None: print c else: print "wrong arguments" I think that using conditions is always more readable and manageable. Or am I wrong? What are the proper cases for defining APIs which raise exceptions and why?

    Read the article

  • Python: Converting a tuple to a string with 'err'

    - by skylarking
    Given this : import os import subprocess def check_server(): cl = subprocess.Popen(["nmap","10.7.1.71"], stdout=subprocess.PIPE) result = cl.communicate() print result check_server() check_server() returns this tuple: ('\nStarting Nmap 4.53 ( http://insecure.org ) at 2010-04-07 07:26 EDT\nInteresting ports on 10.7.1.71:\nNot shown: 1711 closed ports\nPORT STATE SERVICE\n21/tcp open ftp\n22/tcp open ssh\n80/tcp open http\n\nNmap done: 1 IP address (1 host up) scanned in 0.293 seconds\n', None) Changing the second line in the method to result, err = cl.communicate() results in check_server() returning : Starting Nmap 4.53 ( http://insecure.org ) at 2010-04-07 07:27 EDT Interesting ports on 10.7.1.71: Not shown: 1711 closed ports PORT STATE SERVICE 21/tcp open ftp 22/tcp open ssh 80/tcp open http Nmap done: 1 IP address (1 host up) scanned in 0.319 seconds Looks to be the case that the tuple is converted to a string, and the \n's are being stripped.... but how? What is 'err' and what exactly is it doing?

    Read the article

< Previous Page | 431 432 433 434 435 436 437 438 439 440 441 442  | Next Page >