Search Results

Search found 23474 results on 939 pages for 'xml import'.

Page 435/939 | < Previous Page | 431 432 433 434 435 436 437 438 439 440 441 442  | Next Page >

  • java timer on current instance

    - by hspim
    import java.util.Scanner; import java.util.Timer; import java.util.TimerTask; public class Boggle { Board board; Player player; Timer timer; boolean active; static Scanner in = new Scanner(System.in); public Boggle() { board = new Board(4); timer = new Timer(); } public void newGame() { System.out.println("Please enter your name: "); String line = in.nextLine(); player = new Player(line); active = true; board.shuffle(); System.out.println(board); timer.schedule(new timesUP(), 20000); while(active) { String temp = in.nextLine(); player.addGuess(temp); } } public void endGame() { active = false; int score = Scoring.calculate(player, board); System.out.println(score); } class timesUP extends TimerTask { public void run() { endGame(); } } public static void main(String[] args) { Boggle boggle = new Boggle(); boggle.newGame(); } } I have the above class which should perform a loop for a given length of time and afterwards invoke an instance method. Essentially I need the loop in newGame() to run for a minute or so before endGame() is invoked on the current instance. However, using the Timer class I'm not sure how I would invoke the method I need on the current instance since I can't pass any parameters to the timertasks run method? Is there an easy way to do this or am I going about this the wrong way? (note: this is a console project only, no GUI) ========== code edited I've changed the code to the above following the recommendations, and it works almost as I expect however the thread still doesnt seem to end properly. I was the while loop would die and control would eventually come back to the main method. Any ideas?

    Read the article

  • java.util.zip - ZipInputStream v.s. ZipFile

    - by lucho
    Hello, community! I have some general questions regarding the java.util.zip library. What we basically do is an import and an export of many small components. Previously these components were imported and exported using a single big file, e.g.: <component-type-a id="1"/> <component-type-a id="2"/> <component-type-a id="N"/> <component-type-b id="1"/> <component-type-b id="2"/> <component-type-b id="N"/> Please note that the order of the components during import is relevant. Now every component should occupy its own file which should be externally versioned, QA-ed, bla, bla. We decided that the output of our export should be a zip file (with all these files in) and the input of our import should be a similar zip file. We do not want to explode the zip in our system. We do not want opening separate streams for each of the small files. My current questions: Q1. May the ZipInputStream guarantee that the zip entries (the little files) will be read in the same order in which they were inserted by our export that uses ZipOutputStream? I assume reading is something like: ZipInputStream zis = new ZipInputStream(new BufferedInputStream(fis)); ZipEntry entry; while((entry = zis.getNextEntry()) != null) { //read from zis until available } I know that the central zip directory is put at the end of the zip file but nevertheless the file entries inside have sequential order. I also know that relying on the order is an ugly idea but I just want to have all the facts in mind. Q2. If I use ZipFile (which I prefer) what is the performance impact of calling getInputStream() hundreds of times? Will it be much slower than the ZipInputStream solution? The zip is opened only once and ZipFile is backed by RandomAccessFile - is this correct? I assume reading is something like: ZipFile zipfile = new ZipFile(argv[0]); Enumeration e = zipfile.entries();//TODO: assure the order of the entries while(e.hasMoreElements()) { entry = (ZipEntry) e.nextElement(); is = zipfile.getInputStream(entry)); } Q3. Are the input streams retrieved from the same ZipFile thread safe (e.g. may I read different entries in different threads simultaneously)? Any performance penalties? Thanks for your answers!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Converting IPv4 or IPv6 address to a long for comparisons

    - by Justin Akehurst
    In order to check if an IPv4 or IPv6 address is within a certain range, I've got code that takes an IPv4 address, turns that into a long, then does that same conversion on the upper/lower bound of the subnet, then checks to see if the long is between those values. I'd like to be able to do the same thing for IPv6, but saw nothing in the Python 2.6 standard libraries to allow me to do this, so I wrote this up: import socket, struct from array import array def ip_address_to_long(address): ip_as_long = None try: ip_as_long = socket.ntohl(struct.unpack('L', socket.inet_pton(socket.AF_INET, address))[0]) except socket.error: # try IPv6 try: addr = array('L', struct.unpack('!4L', socket.inet_pton(socket.AF_INET6, address))) addr.reverse() ip_as_long = sum(addr[i] << (i * 32) for i in range(len(addr))) except socket.error as se: raise ValueError('Invalid address') except Exception as e: print str(e) return ip_as_long My question is: Is there a simpler way to do this that I am missing? Is there a standard library call that can do this for me?

    Read the article

  • problem with running Servlet on Tomcat: InvocationTargetException

    - by Fahim
    Hi, I am new to Tomcat, and trying to run a simple HelloWorld servlet. I have installed Tomcat 6, and Jdk1.6 on Mandriva Linux, set CLASSPATH and JAVA_HOME. I have the following files and directories: $CATALINA_HOME/webapps/MyApp/WEB_INF/classes/TestServlet.class $CATALINA_HOME/webapps/MyApp/WEB_INF/web.xml My web.xml file contains the following: http://java.sun.com/xml/ns/javaee/web-app_2_5.xsd" version="2.5" <description>ZibJana Localization</description> <display-name>ZibJana Localization</display-name> <!-- Define the servlets for this application--> <servlet> <servlet-name>ZibJana</servlet-name> <servlet-class>TestServlet</servlet-class> </servlet> <servlet-mapping> <servlet-name>ZibJana</servlet-name> <url-pattern>*</url-pattern> </servlet-mapping> But when I try to invoke my servlet with url http://localhost:8080/MyApp, tomcat fails to launch launch the servlet. I checked in the $CATALINA_HOME/logs/catalina.out log-file and found the following error, which occurs every time I start tomcat service. INFO: Deploying web application directory MyApp 16-Mar-2010 12:05:38 AM org.apache.tomcat.util.digester.Digester endElement SEVERE: End event threw exception java.lang.reflect.InvocationTargetException at sun.reflect.GeneratedMethodAccessor18.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) Please let me know where my mistake is. Thanks in advance.

    Read the article

  • How to make a request from an android app that can enter a Spring Security secured webservice method

    - by johnrock
    I have a Spring Security (form based authentication) web app running CXF JAX-RS webservices and I am trying to connect to this webservice from an Android app that can be authenticated on a per user basis. Currently, when I add an @Secured annotation to my webservice method all requests to this method are denied. I have tried to pass in credentials of a valid user/password (that currently exists in the Spring Security based web app and can log in to the web app successfully) from the android call but the request still fails to enter this method when the @Secured annotation is present. The SecurityContext parameter returns null when calling getUserPrincipal(). How can I make a request from an android app that can enter a Spring Security secured webservice method? Here is the code I am working with at the moment: Android call: httpclient.getCredentialsProvider().setCredentials( //new AuthScope("192.168.1.101", 80), new AuthScope(null, -1), new UsernamePasswordCredentials("joeuser", "mypassword")); String userAgent = "Android/" + getVersion(); HttpGet httpget = new HttpGet(MY_URI); httpget.setHeader("User-Agent", userAgent); httpget.setHeader("Content-Type", "application/xml"); HttpResponse response; try { response = httpclient.execute(httpget); HttpEntity entity = response.getEntity(); ... parse xml Webservice Method: @GET @Path("/payload") @Produces("application/XML") @Secured({"ROLE_USER","ROLE_ADMIN","ROLE_GUEST"}) public Response makePayload(@Context Request request, @Context SecurityContext securityContext){ Payload payload = new Payload(); payload.setUsersOnline(new Long(200)); if (payload == null) { return Response.noContent().build(); } else{ return Response.ok().entity(payload).build(); } }

    Read the article

  • Eclipse keyword highlighting in in my own text editor

    - by Torok Balint
    I made a simple text editor in eclipse to which I added some simple WordRule based syntax highlighting to highlight the language keywords. The problem is that when a keyword is part of an identifier (eg. "import" is part of "extra_import"), then "import" is highlighted in "extra_import". How can I stop eclipse to highlight a a keyword if it is only a sub string of another string? Anlther question; is there a regular expression based IRule? What is the purpose of WhitespaceRule? White spaces are usually not highlighted. Thaks

    Read the article

  • How do I use timezones with a datetime object in python?

    - by jidar
    How do I properly represent a different timezone in my timezone? The below example only works because I know that EDT is one hour ahead of me, so I can uncomment the subtraction of myTimeZone() import datetime, re from datetime import tzinfo class myTimeZone(tzinfo): """docstring for myTimeZone""" def utfoffset(self, dt): return timedelta(hours=1) def myDateHandler(aDateString): """u'Sat, 6 Sep 2008 21:16:33 EDT'""" _my_date_pattern = re.compile(r'\w+\,\s+(\d+)\s+(\w+)\s+(\d+)\s+(\d+)\:(\d+)\:(\d+)') day, month, year, hour, minute, second = _my_date_pattern.search(aDateString).groups() month = [ 'JAN', 'FEB', 'MAR', 'APR', 'MAY', 'JUN', 'JUL', 'AUG', 'SEP', 'OCT', 'NOV', 'DEC' ].index(month.upper()) + 1 dt = datetime.datetime( int(year), int(month), int(day), int(hour), int(minute), int(second) ) # dt = dt - datetime.timedelta(hours=1) # dt = dt - dt.tzinfo.utfoffset(myTimeZone()) return (dt.year, dt.month, dt.day, dt.hour, dt.minute, dt.second, 0, 0, 0) def main(): print myDateHandler("Sat, 6 Sep 2008 21:16:33 EDT") if __name__ == '__main__': main()

    Read the article

  • How to properly close a process with NppExec?

    - by Sam the Great
    I'm not sure what's going on here, but the following code continues running even after I end the process in the NppExec console with Ctrl-C (during the execution of the while loop). I restarted my computer to stop the Ctrl key sends. However, if I run the script in Window's cmd prompt, Ctrl-C ends the script just fine. import time import win32com.client shell = win32com.client.Dispatch("WScript.Shell") time.sleep(2) while True: shell.SendKeys('^') # Ctrl key time.sleep(0.5) The NppExec run command I used was: cmd /C python -u "$(FULL_CURRENT_PATH)" Let me know if there is any more information I can provide. Thanks.

    Read the article

  • Starting with NHibernate

    - by George
    I'm having major difficulties to start off with NHiberante. Main problems: Where my hbm.xml files should reside? I create a Mappings folder but I received an error "Could not find xxx.hbm.xml file." I tried to load the specific class through the dialect cf.AddClass(typeof(xxx)); but it still gives me the same error (the files are marked as embebed resources. Also I'm having major problems in connection to it. I stopped trying to use the cfg xml file and tried a more direct approach with a library I have here. Configuration cfg = new Configuration(); cfg.AddClass(typeof(Tag)); ISessionFactory sessions = cfg.BuildSessionFactory(); AgnosticConnectionHandler agch = new AgnosticConnectionHandler("xxx","xxx","geo_biblio","localhost", 5432,DatabaseInstance.PostgreSQL); ISession sessao = sessions.OpenSession(agch.GetConnection); ITransaction tx = sessao.BeginTransaction(); Tag tag1 = new Tag(); tag1.NomeTag = "Teste Tag NHibernate!!!"; sessao.Save(tag1); tx.Commit(); sessao.Close(); Any tips for me? I'm getting the exception in line 2 of this code, and still not sure what to do. Any help is appreciated. Thanks

    Read the article

  • setting url in yaml file for google app engin (page not found) problem

    - by mswallace
    I am new to python and I am super excited to learn. I am building my first app on app engin and I am not totally understanding why my yaml file is not resolving to the url that I set up. here is the code handlers: - url: .* script: main.py - url: /letmein/.* script: letmein.py so if I go to http://localhost:8080/letmein/ I get a link is brooken or page not found error. here is the python code that I have in letmein.py from google.appengine.ext import webapp from google.appengine.ext.webapp import util class LetMeInHandler(webapp.RequestHandler): def get(self): self.response.out.write('letmein!') def main(): application = webapp.WSGIApplication([('/letmein/', LetMeInHandler)], debug=True) util.run_wsgi_app(application) if __name__ == '__main__': main() thanks in advance for the help!

    Read the article

  • Avoiding nesting two for loops

    - by chavanak
    Hi, Please have a look at the code below: import string from collections import defaultdict first_complex=open( "residue_a_chain_a_b_backup.txt", "r" ) first_complex_lines=first_complex.readlines() first_complex_lines=map( string.strip, first_complex_lines ) first_complex.close() second_complex=open( "residue_a_chain_a_c_backup.txt", "r" ) second_complex_lines=second_complex.readlines() second_complex_lines=map( string.strip, second_complex_lines ) second_complex.close() list_1=[] list_2=[] for x in first_complex_lines: if x[0]!="d": list_1.append( x ) for y in second_complex_lines: if y[0]!="d": list_2.append( y ) j=0 list_3=[] list_4=[] for a in list_1: pass for b in list_2: pass if a==b: list_3.append( a ) kvmap=defaultdict( int ) for k in list_3: kvmap[k]+=1 print kvmap Normally I use izip or izip_longest to club two for loops, but this time the length of the files are different. I don't want a None entry. If I use the above method, the run time becomes incremental and useless. How am I supposed to get the two for loops going? Cheers, Chavanak

    Read the article

  • keyDown works but i get beeps

    - by Oscar
    I just got my keydown method to work. But i get system beep everytime i press key. i have no idea whats wrong. Googled for hours and all people say is that if you have your keyDown method you should also implement the acceptsFirstResponder. did that to and it still doesn't work. #import <Cocoa/Cocoa.h> #import "PaddleView.h" #import "BallView.h" @interface GameController : NSView { PaddleView *leftPaddle; PaddleView *rightPaddle; BallView * ball; CGPoint ballVelocity; int gameState; int player1Score; int player2Score; } @property (retain) IBOutlet PaddleView *leftPaddle; @property (retain) IBOutlet PaddleView *rightPaddle; @property (retain) IBOutlet BallView *ball; - (void)reset:(BOOL)newGame; @end #import "GameController.h" #define GameStateRunning 1 #define GameStatePause 2 #define BallSpeedX 0.2 #define BallSpeedY 0.3 #define CompMoveSpeed 15 #define ScoreToWin 5 @implementation GameController @synthesize leftPaddle, rightPaddle, ball; - (id)initWithCoder:(NSCoder *)aDecoder { self = [super initWithCoder:aDecoder]; if(self) { gameState = GameStatePause; ballVelocity = CGPointMake(BallSpeedX, BallSpeedY); [NSTimer scheduledTimerWithTimeInterval:0.001 target:self selector:@selector(gameLoop) userInfo:nil repeats:YES]; } return self; } - (void)gameLoop { if(gameState == GameStateRunning) { [ball setFrameOrigin:CGPointMake(ball.frame.origin.x + ballVelocity.x, ball.frame.origin.y + ballVelocity.y)]; if(ball.frame.origin.x + 15 > self.frame.size.width || ball.frame.origin.x < 0) { ballVelocity.x =- ballVelocity.x; } if(ball.frame.origin.y + 35 > self.frame.size.height || ball.frame.origin.y < 0) { ballVelocity.y =- ballVelocity.y; } } if(CGRectIntersectsRect(ball.frame, leftPaddle.frame)) { if(ball.frame.origin.x > leftPaddle.frame.origin.x) { ballVelocity.x =- ballVelocity.x; } } if(CGRectIntersectsRect(ball.frame, rightPaddle.frame)) { if(ball.frame.origin.x +15 > rightPaddle.frame.origin.x) { ballVelocity.x =- ballVelocity.x; } } if(ball.frame.origin.x <= self.frame.size.width / 2) { if(ball.frame.origin.y < leftPaddle.frame.origin.y + 75 && leftPaddle.frame.origin.y > 0) { [leftPaddle setFrameOrigin:CGPointMake(leftPaddle.frame.origin.x, leftPaddle.frame.origin.y - CompMoveSpeed)]; } if(ball.frame.origin.y > leftPaddle.frame.origin.y +75 && leftPaddle.frame.origin.y < 700 - leftPaddle.frame.size.height ) { [leftPaddle setFrameOrigin:CGPointMake(leftPaddle.frame.origin.x, leftPaddle.frame.origin.y + CompMoveSpeed)]; } } if(ball.frame.origin.x <= 0) { player2Score++; [self reset:(player2Score >= ScoreToWin)]; } if(ball.frame.origin.x + 15 > self.frame.size.width) { player1Score++; [self reset:(player1Score >= ScoreToWin)]; } } - (void)reset:(BOOL)newGame { gameState = GameStatePause; [ball setFrameOrigin:CGPointMake((self.frame.size.width + 7.5) / 2, (self.frame.size.height + 7.5)/2)]; if(newGame) { if(player1Score > player2Score) { NSLog(@"Player 1 Wins!"); } else { NSLog(@"Player 2 Wins!"); } player1Score = 0; player2Score = 0; } else { NSLog(@"Press key to serve"); } NSLog(@"Player 1: %d",player1Score); NSLog(@"Player 2: %d",player2Score); } - (void)moveRightPaddleUp { if(rightPaddle.frame.origin.y < 700 - rightPaddle.frame.size.height) { [rightPaddle setFrameOrigin:CGPointMake(rightPaddle.frame.origin.x, rightPaddle.frame.origin.y + 20)]; } } - (void)moveRightPaddleDown { if(rightPaddle.frame.origin.y > 0) { [rightPaddle setFrameOrigin:CGPointMake(rightPaddle.frame.origin.x, rightPaddle.frame.origin.y - 20)]; } } - (BOOL)acceptsFirstResponder { return YES; } - (void)keyDown:(NSEvent *)theEvent { if ([theEvent modifierFlags] & NSNumericPadKeyMask) { NSString *theArrow = [theEvent charactersIgnoringModifiers]; unichar keyChar = 0; if ( [theArrow length] == 0 ) { return; // reject dead keys } if ( [theArrow length] == 1 ) { keyChar = [theArrow characterAtIndex:0]; if ( keyChar == NSLeftArrowFunctionKey ) { gameState = GameStateRunning; } if ( keyChar == NSRightArrowFunctionKey ) { } if ( keyChar == NSUpArrowFunctionKey ) { [self moveRightPaddleUp]; } if ( keyChar == NSDownArrowFunctionKey ) { [self moveRightPaddleDown]; } [super keyDown:theEvent]; } } else { [super keyDown:theEvent]; } } - (void)drawRect:(NSRect)dirtyRect { } - (void)dealloc { [ball release]; [rightPaddle release]; [leftPaddle release]; [super dealloc]; } @end

    Read the article

  • Convert InputStream to String with encoding given in stream data

    - by Quentin
    Hi, My input is a InputStream which contains an XML document. Encoding used in XML is unknown and it is defined in the first line of XML document. From this InputStream, I want to have all document in a String. To do this, I use a BufferedInputStream to mark the beginning of the file and start reading first line. I read this first line to get encoding and then I use an InputStreamReader to generate a String with the correct encoding. It seems that it is not the best way to achieve this goal because it produces an OutOfMemory error. Any idea, how to do it ? public static String streamToString(final InputStream is) { String result = null; if (is != null) { BufferedInputStream bis = new BufferedInputStream(is); bis.mark(Integer.MAX_VALUE); final StringBuilder stringBuilder = new StringBuilder(); try { // stream reader that handle encoding final InputStreamReader readerForEncoding = new InputStreamReader(bis, "UTF-8"); final BufferedReader bufferedReaderForEncoding = new BufferedReader(readerForEncoding); String encoding = extractEncodingFromStream(bufferedReaderForEncoding); if (encoding == null) { encoding = DEFAULT_ENCODING; } // stream reader that handle encoding bis.reset(); final InputStreamReader readerForContent = new InputStreamReader(bis, encoding); final BufferedReader bufferedReaderForContent = new BufferedReader(readerForContent); String line = bufferedReaderForContent.readLine(); while (line != null) { stringBuilder.append(line); line = bufferedReaderForContent.readLine(); } bufferedReaderForContent.close(); bufferedReaderForEncoding.close(); } catch (IOException e) { // reset string builder stringBuilder.delete(0, stringBuilder.length()); } result = stringBuilder.toString(); }else { result = null; } return result; } Regards, Quentin

    Read the article

  • Getting force close when i add view to other view when a thread is running

    - by Praveena
    Hi, I am getting the below error 12-30 05:40:40.484: ERROR/AndroidRuntime(413): Uncaught handler: thread Thread-10 exiting due to uncaught exception 12-30 05:40:40.494: ERROR/AndroidRuntime(413): android.view.ViewRoot$CalledFromWrongThreadException: Only the original thread that created a view hierarchy can touch its views. 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.ViewRoot.checkThread(ViewRoot.java:2629) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.ViewRoot.requestLayout(ViewRoot.java:545) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.View.requestLayout(View.java:7657) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.View.requestLayout(View.java:7657) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.View.requestLayout(View.java:7657) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.View.requestLayout(View.java:7657) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.View.requestLayout(View.java:7657) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.ViewGroup.addView(ViewGroup.java:1749) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.ViewGroup.addView(ViewGroup.java:1708) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at android.view.ViewGroup.addView(ViewGroup.java:1688) 12-30 05:40:40.494: ERROR/AndroidRuntime(413): at com.wwwww.shout.presentationLayer.Shout$1.run(Shout.java:137) and my code is myProgressDialog = ProgressDialog.show(Shout.this,"","Loading...",true); new Thread() { public void run() { String xml; xml="<spGetUserMessages><SearchLocation></SearchLocation></spGetUserMessages>"; messages =parse.GetGetUserMessages(dataparsing.ILGetUserMessages(xml)); myProgressDialog.dismiss(); ((LinearLayout)findViewById(R.id.LinearlayoutMessage)).addView(iiii); } }.start(); at the time of adding views to the layout i am getting the above error.what is the wrong in this.Please give me some suggestions.Thanks in advance

    Read the article

  • OptionParser python module - multiple entries of same variable?

    - by jduncan
    I'm writing a little python script to get stats from several servers or a single server, and I'm using OptionParser to parse the command line input. #!/usr/bin/python import sys from optparse import OptionParser ... parser.add_option("-s", "--server", dest="server", metavar="SERVER", type="string", help="server(s) to gather stats [default: localhost]") ... my GOAL is to be able to do something like #test.py -s server1 -s server2 and it would append both of those values within the options.server object in some way so that I could iterate through them, whether they have 1 value or 10. Any thoughts / help is appreciated. Thanks.

    Read the article

  • What's the right way to use idlestartup on python 2.6.5?

    - by user210481
    Idlestartup is analogous to pythonstartup variable, but for IDLE, instead of command line. But it seems not to work properly. I'm using python 2.6.5 on Windows. I have the following script assigned to it: from pprint import pprint import sys newPath = 'C:\\Python26\test') sys.path.append(newPath) print "initial config loaded" Both variables Idlestartup and pythonstartup are assigned to the same file (script above). When running IDLE, pprint and sys are NOT available, the final message is NOT printed, but newPath was added to sys.path. Running the command line, pprint and sys are available, the final message is printed and newPath was added to sys.path. Is it a bug? Am I doing something wrong? Thanks

    Read the article

  • Event handling for keyboard strokes

    - by david
    Hey, I'm trying to get familiar with the whole keyboard event detection thing. Here's my sample code. <fx:Script> <![CDATA[ import flash.events.KeyboardEvent; import mx.controls.Alert; private function init():void{ addEventListener(KeyboardEvent.KEY_DOWN,reportKeyDown); } private function reportKeyDown(event:KeyboardEvent):void { Alert.show("a key was pressed"); } ]]> </fx:Script> As you can see, I'm at stage 0 of playing around with it, but it won't work. Anyone has any idea what I should be doing instead? Thanks

    Read the article

  • No route matches when trying to edit

    - by mmichael
    Here's the scoop: I've created a test app that allows users to create ideas and then add "bubbles" to these ideas. Currently, a bubble is just text. I've successfully linked bubbles to ideas. Furthermore, when a user goes to view an idea it lists all of the bubbles attached to that idea. The user can even delete the bubble for any given idea. My problem lies in editing bubbles. When a user views an idea, he sees the idea's content as well as any bubbles for that idea. As a result, I've set all my bubble controls (editing and deleting) inside the ideas "show" view. My code for editing a bubble for an idea is <%= link_to 'Edit Bubble', edit_idea_bubble_path %>. I ran rake routes to find the correct path for editing bubbles and that is what was listed. Here's my error: No route matches {:action=>"edit", :controller=>"bubbles"} In my bubbles controller I have: def edit @idea = Idea.find(params[:idea_id]) @bubble = @idea.bubbles.find(params[:id]) end def update @idea = Idea.find(params[:idea_id]) @bubble = @idea.bubbles.find(params[:id]) respond_to do |format| if @bubble.update_attributes(params[:bubble]) format.html { redirect_to(@bubble, :notice => 'Bubble was successfully updated.') } format.xml { head :ok } else format.html { render :action => "Edit" } format.xml { render :xml => @bubble.errors, :status => :unprocessable_entity } end end end To go a step further, I have the following in my routes.rb file resources :ideas do resources :bubbles end So far everything seems to function except when I try to edit a bubble. I'd love some guidance. Thanks!

    Read the article

  • Gui problem after rewriting to MVC

    - by trevor_nise
    I'm practicing MVC style programming. I have a Mastermind game in a single file, working with no problems (maybe apart of the fact that "Check" button is invisible at start). http://paste.pocoo.org/show/226726/ But when I've rewritten it to model, view, controller files - when I click on empty Pin (that should be updated, and repainted with new color) - noting happens. Can anybody see any problems here ? I've tried placing repaint() in different places, but it simply does not work at all :/ Main : public class Main { public static void main(String[] args){ Model model = new Model(); View view = new View("Mastermind", 400, 590, model); Controller controller = new Controller(model, view); view.setVisible(true); } } Model : import java.util.Random; public class Model{ static final int LINE = 5, SCORE = 10, OPTIONS = 20; Pin pins[][] = new Pin[21][LINE]; int combination[] = new int[LINE]; int curPin = 0; int turn = 1; Random generator = new Random(); int repaintPin; boolean pinsRepaint=false; int pinsToRepaint; boolean isUpdate = true, isPlaying = true, isRowFull = false; static final int HIT_X[] = {270,290,310,290,310}, HIT_Y[] = {506,496,496,516,516}; public Model(){ for ( int i=0; i < SCORE; i++ ){ for ( int j = 0; j < LINE; j++ ){ pins[i][j] = new Pin(20,0); pins[i][j].setPosition(j*50+30,510-i*50); pins[i+SCORE][j] = new Pin(8,0); pins[i+SCORE][j].setPosition(HIT_X[j],HIT_Y[j]-i*50); } } for ( int i=0; i < LINE; i++ ){ pins[OPTIONS][i] = new Pin( 20, i+2 ); pins[OPTIONS][i].setPosition( 370,i * 50 + 56); } } void fillHole(int color) { pins[turn-1][curPin].setColor(color+1); pinsRepaint = true; pinsToRepaint = turn; curPin = (curPin+1) % LINE; if (curPin == 0){ isRowFull = true; } pinsRepaint = false; pinsToRepaint = 0; } void check() { int junkPins[] = new int[LINE], junkCode[] = new int[LINE]; int pinCount = 0, pico = 0; for ( int i = 0; i < LINE; i++ ) { junkPins[i] = pins[turn-1][i].getColor(); junkCode[i] = combination[i]; } for ( int i = 0; i < LINE; i++ ){ if (junkPins[i]==junkCode[i]) { pins[turn+SCORE][pinCount].setColor(1); pinCount++; pico++; junkPins[i] = 98; junkCode[i] = 99; } } for ( int i = 0; i < LINE; i++ ){ for ( int j = 0; j < LINE; j++ ) if (junkPins[i]==junkCode[j]) { pins[turn+SCORE][pinCount].setColor(2); pinCount++; junkPins[i] = 98; junkCode[j] = 99; j = LINE; } } pinsRepaint = true; pinsToRepaint = turn + SCORE; pinsRepaint = false; pinsToRepaint=0; if ( pico == LINE ){ isPlaying = false; } else if ( turn >= 10 ){ isPlaying = false; } else{ curPin = 0; isRowFull = false; turn++; } } void combination() { for ( int i = 0; i < LINE; i++ ){ combination[i] = generator.nextInt(6) + 1; } } } class Pin{ private int color, X, Y, radius; public Pin(){ X = 0; Y = 0; radius = 0; color = 0; } public Pin( int r,int c ){ X = 0; Y = 0; radius = r; color = c; } public int getX(){ return X; } public int getY(){ return Y; } public int getRadius(){ return radius; } public void setRadius(int r){ radius = r; } public void setPosition( int x,int y ){ this.X = x ; this.Y = y ; } public void setColor( int c ){ color = c; } public int getColor() { return color; } } View: import java.awt.*; import javax.swing.*; public class View extends Frame{ Model model; JButton checkAnswer; private JPanel button; private static final Color COLORS[] = {Color.black, Color.white, Color.red, Color.yellow, Color.green, Color.blue, new Color(7, 254, 250)}; public View(String name, int w, int h, Model m){ model = m; setTitle( name ); setSize( w,h ); setResizable( false ); this.setLayout(new BorderLayout()); button = new JPanel(); button.setSize( new Dimension(400, 100)); button.setVisible(true); checkAnswer = new JButton("Check"); checkAnswer.setSize( new Dimension(200, 30)); button.add( checkAnswer ); this.add( button, BorderLayout.SOUTH); button.setVisible(true); } @Override public void paint( Graphics g ) { g.setColor( new Color(238, 238, 238)); g.fillRect( 0,0,400,590); for ( int i=0; i < model.pins.length; i++ ) { paintPins(model.pins[i][0],g); paintPins(model.pins[i][1],g); paintPins(model.pins[i][2],g); paintPins(model.pins[i][3],g); paintPins(model.pins[i][4],g); } } @Override public void update( Graphics g ) { if ( model.isUpdate ) { paint(g); } else { model.isUpdate = true; paintPins(model.pins[model.repaintPin-1][0],g); paintPins(model.pins[model.repaintPin-1][1],g); paintPins(model.pins[model.repaintPin-1][2],g); paintPins(model.pins[model.repaintPin-1][3],g); paintPins(model.pins[model.repaintPin-1][4],g); } } void repaintPins( int pin ) { model.repaintPin = pin; model.isUpdate = false; repaint(); } public void paintPins(Pin p, Graphics g ){ int X = p.getX(); int Y = p.getY(); int color = p.getColor(); int radius = p.getRadius(); int x = X-radius; int y = Y-radius; if (color > 0){ g.setColor( COLORS[color]); g.fillOval( x,y,2*radius,2*radius ); } else{ g.setColor( new Color(238, 238, 238) ); g.drawOval( x,y,2*radius-1,2*radius-1 ); } g.setColor( Color.black ); g.drawOval( x,y,2*radius,2*radius ); } } Controller: import java.awt.*; import java.awt.event.*; public class Controller implements MouseListener, ActionListener { private Model model; private View view; public Controller(Model m, View v){ model = m; view = v; view.addWindowListener( new WindowAdapter(){ public void windowClosing(WindowEvent e){ System.exit(0); } }); view.addMouseListener(this); view.checkAnswer.addActionListener(this); model.combination(); } public void actionPerformed( ActionEvent e ) { if(e.getSource() == view.checkAnswer){ if(model.isRowFull){ model.check(); } } } public void mousePressed(MouseEvent e) { Point mouse = new Point(); mouse = e.getPoint(); if (model.isPlaying){ if (mouse.x > 350) { int button = 1 + (int)((mouse.y - 32) / 50); if ((button >= 1) && (button <= 5)){ model.fillHole(button); if(model.pinsRepaint){ view.repaintPins( model.pinsToRepaint ); } } } } } public void mouseClicked(MouseEvent e) {} public void mouseReleased(MouseEvent e){} public void mouseEntered(MouseEvent e) {} public void mouseExited(MouseEvent e) {} }

    Read the article

  • Problem evaluating NULL in an IIF statement (Access)

    - by Mohgeroth
    Item in the recordset rstImportData("Flat Size") is = Null With that, given the following statement: IIF(IsNull(rstImportData("Flat Size")), Null, cstr(rstImportData("Flat Size"))) Result: Throws error 94: Invalid use of Null If I change the statement by removing the type conversion upon a false comparison: IIF(IsNull(rstImportData("Flat Size")), Null, 0) Result: Null It returns Null as it should have the first time. It appears that I cannot do a type conversion in an IIF if the value passed in should ever be null even if it passes an IIF test, it still attempts to evaluate it at both the true and false answer. The only reason I'm using IIF like this is because I have a 25 line comparison to compare data from an Import against a matching record in a database to see if I need to append the prior to history. Any thoughts? The way data is imported there will be null dates and where the spreadsheet import is in a string format I must convert either side to the other to compare the values properly but if either side is null this exception occurs :(

    Read the article

  • Deploy GWT Application to Google App Engine using NetBeans

    - by Yan Cheng CHEOK
    Hello, I try to deploy a GWT application, to Google App Engine using NetBeans. I had successful run GWT sample http://code.google.com/webtoolkit/doc/latest/tutorial/create.html using Personal GlassFish v3 Prelude Domain, by 1) Copy generated source code from StockWatcher to C:\Projects\StockWatcherNetbeans\src\java\com\google\ 2) Modify C:\Projects\StockWatcherNetbeans\nbproject\gwt.properties gwt.module=com.google.gwt.stockwatcher.StockWatcher 3) Select Personal GlassFish v3 Prelude Domain, and run. All works fine! Now, I try to select Google App Engine server, and run. However, I get the error "There is no appengine web project opened!" I check... There is file called C:\Projects\StockWatcherNetbeans\war\WEB-INF\appengine-web.xml with content <?xml version="1.0" encoding="UTF-8"?> <appengine-web-app xmlns="http://appengine.google.com/ns/1.0" xmlns:xsi='http://www.w3.org/2001/XMLSchema-instance' xsi:schemaLocation='http://kenai.com/projects/nbappengine/downloads/download/schema/appengine-web.xsd appengine-web.xsd'> <application>StockWatcherNetbeans</application> <version>1</version> </appengine-web-app> I am using NetBeans 6.7.1 GWT4NB (GWT Plugin for NetBeans) 2.6.12 Google App Engine plugin for NetBeans from http://kenai.com/downloads/nbappengine/1.0_NetBeans671/updates.xml Anything I had missed out? Even when I right click to the project, the Deploy to Google App Engine options is disabled. And yes, please do not ask me why not use Eclipse.

    Read the article

  • Generate a list of file names based on month and year arithmetic

    - by MacUsers
    How can I list the numbers 01 to 12 (one for each of the 12 months) in such a way so that the current month always comes last where the oldest one is first. In other words, if the number is grater than the current month, it's from the previous year. e.g. 02 is Feb, 2011 (the current month right now), 03 is March, 2010 and 09 is Sep, 2010 but 01 is Jan, 2011. In this case, I'd like to have [09, 03, 01, 02]. This is what I'm doing to determine the year: for inFile in os.listdir('.'): if inFile.isdigit(): month = months[int(inFile)] if int(inFile) <= int(strftime("%m")): year = strftime("%Y") else: year = int(strftime("%Y"))-1 mnYear = month + ", " + str(year) I don't have a clue what to do next. What should I do here? Update: I think, I better upload the entire script for better understanding. #!/usr/bin/env python import os, sys from time import strftime from calendar import month_abbr vGroup = {} vo = "group_lhcb" SI00_fig = float(2.478) months = tuple(month_abbr) print "\n%-12s\t%10s\t%8s\t%10s" % ('VOs','CPU-time','CPU-time','kSI2K-hrs') print "%-12s\t%10s\t%8s\t%10s" % ('','(in Sec)','(in Hrs)','(*2.478)') print "=" * 58 for inFile in os.listdir('.'): if inFile.isdigit(): readFile = open(inFile, 'r') lines = readFile.readlines() readFile.close() month = months[int(inFile)] if int(inFile) <= int(strftime("%m")): year = strftime("%Y") else: year = int(strftime("%Y"))-1 mnYear = month + ", " + str(year) for line in lines[2:]: if line.find(vo)==0: g, i = line.split() s = vGroup.get(g, 0) vGroup[g] = s + int(i) sumHrs = ((vGroup[g]/60)/60) sumSi2k = sumHrs*SI00_fig print "%-12s\t%10s\t%8s\t%10.2f" % (mnYear,vGroup[g],sumHrs,sumSi2k) del vGroup[g] When I run the script, I get this: [root@serv07 usage]# ./test.py VOs CPU-time CPU-time kSI2K-hrs (in Sec) (in Hrs) (*2.478) ================================================== Jan, 2011 211201372 58667 145376.83 Dec, 2010 5064337 1406 3484.07 Feb, 2011 17506049 4862 12048.04 Sep, 2010 210874275 58576 145151.33 As I said in the original post, I like the result to be in this order instead: Sep, 2010 210874275 58576 145151.33 Dec, 2010 5064337 1406 3484.07 Jan, 2011 211201372 58667 145376.83 Feb, 2011 17506049 4862 12048.04 The files in the source directory reads like this: [root@serv07 usage]# ls -l total 3632 -rw-r--r-- 1 root root 1144972 Feb 9 19:23 01 -rw-r--r-- 1 root root 556630 Feb 13 09:11 02 -rw-r--r-- 1 root root 443782 Feb 11 17:23 02.bak -rw-r--r-- 1 root root 1144556 Feb 14 09:30 09 -rw-r--r-- 1 root root 370822 Feb 9 19:24 12 Did I give a better picture now? Sorry for not being very clear in the first place. Cheers!! Update @Mark Ransom This is the result from Mark's suggestion: [root@serv07 usage]# ./test.py VOs CPU-time CPU-time kSI2K-hrs (in Sec) (in Hrs) (*2.478) ========================================================== Dec, 2010 5064337 1406 3484.07 Sep, 2010 210874275 58576 145151.33 Feb, 2011 17506049 4862 12048.04 Jan, 2011 211201372 58667 145376.83 As I said before, I'm looking for the result to b printed in this order: Sep, 2010 - Dec, 2010 - Jan, 2011 - Feb, 2011 Cheers!!

    Read the article

  • How to setup Xcode 3.1.4 with Perforce ?

    - by Azeworai
    Hi everyone, I've been trying to setup Xcode with Perforce for about 7 hours now and managed to get the Perforce Repository Authenticated within Xcode. The problem I have is, within the repositories window, I don't see any directories for me to check out. I can see the p4root login and client are ok with the tick on the repository log. When I try to Import an xcode project directory within the Perforce root directory- the import fails with '/Users/jackson/p4root/alpha/MessageTapper' is not under the Perforce root. I have p4d running on the local machine, and have created a user and workspace. The workspace has the directories in view. I'm hoping for someone to give me some direction or maybe point me to a good reference to how to set perforce up with xcode. Thanks!

    Read the article

  • Dynamically creating page definitions in Cherrypy

    - by Hugh
    Hi, I've been looking around the CherryPy documentation, but can't quite get my head around what I want to do. I suspect it might be more of a Python thing than a CherryPy thing... My current class looks something like this: import managerUtils class WebManager: def A(self, **kwds): return managerUtils.runAction("A", kwds) A.enabled = True def B(self, **kwds): return managerUtils.runAction("B", kwds) B.enabled = True def C(self, **kwds): return managerUtils.runAction("C", kwds) C.enabled = True Obviously there's a lot of repetition in here. in managerUtils.py, I have a dict that's something like: actions = {'A': functionToRunForA, 'B': functionToRunForB, 'C': functionToRunForC} Okay, so that's a slightly simplistic view of it, but I'm sure you get the idea. I want to be able to do something like: import managerUtils class WebManager: def __init__(self): for action in managerUtils.actions: f = registerFunction(action) f.enabled = True Any ideas of how to do this?

    Read the article

< Previous Page | 431 432 433 434 435 436 437 438 439 440 441 442  | Next Page >