Search Results

Search found 23474 results on 939 pages for 'xml import'.

Page 434/939 | < Previous Page | 430 431 432 433 434 435 436 437 438 439 440 441  | Next Page >

• pitchbend (varispeed) audio with iPhone SDK's AudioUnit

  - by fetzig

  hi, I'm trying to manipulate the speed (and pitch) of a sound while playing. so i played around with iphone sdk's AudioUnit. downloaded iPhoneMultichannelMixerTest and tried to add an AUComponent to the graph (in this case a formatconverter). but i get (pretty soon) following error when building: #import <AudioToolbox/AudioToolbox.h> #import <AudioUnit/AudioUnit.h> ... AUComponentDescription varispeed_desc(kAudioUnitType_FormatConverter, kAudioUnitSubType_Varispeed, kAudioUnitManufacturer_Apple); ^^ error: 'kAudioUnitSubType_Varispeed' was not declared in this scope. any ideas why? the documentation on this topic doesn't help me at all (just api doc isn't very helpful when having no clue about the concept behind). there are no examples on how to wire these effects together and manipulating there properties...so maybe i'm totally wrong, anyway any hint is great. thx for help.

  Read the article

• Importing a spreadsheet into an asp.net program and listing the worksheets

  - by Bob Avallone

  I have to import the contents of a spreadsheet in my asp.net project. The code behind is c#. I figured out how to locate the spreadsheet on the user's computer and how to import the data from a given worksheet into a datable. The problem is I may not know the name of the worksheet ahead of time. I want to present the user with a list of available worksheets and have them pick one. That is the piece I don't know how to do. Thanks in advance. Bob Avallone

  Read the article

• read subprocess stdout line by line

  - by Caspin

  My python script uses subprocess to call a linux utility that is very noisy. I want to store all of the output to a log file, but only show some of it to the user. I thought the following would work, but the output does show up in my application until the utility has produced a significant amount of output. #fake_utility.py, just generates lots of output over time import time i = 0 while True: print hex(i)*512 i += 1 time.sleep(0.5) #filters output import subprocess proc = subprocess.Popen(['python','fake_utility.py'],stdout.subprocess.PIPE) for line in proc.stdout: #the real code does filtering here print "test:", line.rstrip() The behavior I really want is for the filter script to print each line as it is received from the subprocess. Sorta like what tee does but with python code. What am I missing? Is this even possible?

  Read the article

• Write a program that allows the user to enter a string and then prints the letters of the String sep

  - by WM

  The output is always a String, for example H,E,L,L,O,. How could I limit the commas? I want the commas only between letters, for example H,E,L,L,O. import java.util.Scanner; import java.lang.String; public class forLoop { public static void main(String[] args) { Scanner Scan = new Scanner(System.in); System.out.print("Enter a string: "); String Str1 = Scan.next(); String newString=""; String Str2 =""; for (int i=0; i < Str1.length(); i++) { newString = Str1.charAt(i) + ","; Str2 = Str2 + newString; } System.out.print(Str2); } }

  Read the article

• pyplot: really slow creating heatmaps

  - by cvondrick

  I have a loop that executes the body about 200 times. In each loop iteration, it does a sophisticated calculation, and then as debugging, I wish to produce a heatmap of a NxM matrix. But, generating this heatmap is unbearably slow and significantly slow downs an already slow algorithm. My code is along the lines: import numpy import matplotlib.pyplot as plt for i in range(200): matrix = complex_calculation() plt.set_cmap("gray") plt.imshow(matrix) plt.savefig("frame{0}.png".format(i)) The matrix, from numpy, is not huge --- 300 x 600 of doubles. Even if I do not save the figure and instead update an on-screen plot, it's even slower. Surely I must be abusing pyplot. (Matlab can do this, no problem.) How do I speed this up?

  Read the article

• Is it possible to access variable of subclass using object of superclass in polymorphism

  - by fari

  how can i access state varibale of class keyboard with object of class kalaplayer /** * An abstract class representing a player in Kala. Extend this class * to make your own players (e.g. human players entering moves at the keyboard * or computer players with programmed strategies for making moves). */ public abstract class KalaPlayer { /** * Method by which a player selects a move. * @param gs The current game state * @return A side pit number in the range 1-6 * @throws NoMoveAvailableException if all side pits for the player are empty * (i.e. the game is over) */ public abstract int chooseMove(KalaGameState gs) throws NoMoveAvailableException; } public class KeyBoardPlayer extends KalaPlayer { /** * Method by which a player selects a move. * @param gs The current game state * @return A side pit number in the range 1-6 * @throws NoMoveAvailableException if all side pits for the player are empty * (i.e. the game is over) */ public KalaGameState state; public KeyBoardPlayer() { System.out.println("Enter the number of stones to play with: "); try { BufferedReader br = new BufferedReader(new InputStreamReader(System.in)); int key = Integer.parseInt(br.readLine()); state=new KalaGameState(key); //key=player1.state.turn; } catch(IOException e) { System.out.println(e); } } public int chooseMove(KalaGameState gs) throws NoMoveAvailableException{ return 0; } } import java.io.IOException; import java.io.BufferedReader; import java.io.InputStreamReader; public class KalaGame { KalaPlayer player1,player2; public KalaGame(KeyBoardPlayer Player1,KeyBoardPlayer Player2) { //super(0); player1=new KeyBoardPlayer(); player2 = new KeyBoardPlayer(); //player1=Player1; //player2=Player2; //player1.state ****how can i access the stae variable from Keyboard CLass using object from KalaPlayer key=player1.state.turn; } public void play() { System.out.println("Enter the number of stones to play with: "); try { BufferedReader br = new BufferedReader(new InputStreamReader(System.in)); int key = Integer.parseInt(br.readLine()); System.out.println(key); KalaGameState state=new KalaGameState(key); printGame(); } catch(IOException e) { System.out.println(e); } }

  Read the article

• problem configure JBoss to work with JNDI

  - by Spiderman

  I am trying to bind connection to the DB using JNDI in my application that runs on JBoss. I did the following: I created the datasource file oracle-ds.xml filled it with the relevant xml elements: <datasources> <local-tx-datasource> <jndi-name>bilby</jndi-name> ... </local-tx-datasource> </datasources> and put it in the folder \server\default\deploy Added the relevant oracle jar file than in my application I performed: JndiObjectFactoryBean factory = new JndiObjectFactoryBean(); factory.setJndiName("bilby"); try{ factory.afterPropertiesSet(); dataSource = factory.getObject(); } catch(NamingException ne) { ne.printStackTrace(); } and this cause the error: javax.naming.NameNotFoundException: bilby not bound then in the output after this error occured I saw the line: 18:37:56,560 INFO [ConnectionFactoryBindingService] Bound ConnectionManager 'jb oss.jca:service=DataSourceBinding,name=bilby' to JNDI name 'java:bilby' So what is my configuration problem? I think that it may be that JBoss first loads and runs the .war file of my application and only then it loads the oracle-ds.xml that contain my data-source definition. The problem is that they are both located in the same folder. Is there a way to define priority of loading them, or maybe this is not the problem at all. Any idea?

  Read the article

• Read attributes of MSBuild custom tasks via events in the Logger

  - by gt

  I am trying to write a MSBuild logger module which logs information when receiving TaskStarted events about the Task and its parameters. The build is run with the command: MSBuild.exe /logger:MyLogger.dll build.xml Within the build.xml is a sequence of tasks, most of which have been custom written to compile a (C++ or C#) solution, and are accessed with the following custom Task: <DoCompile Desc="Building MyProject 1" Param1="$(Param1Value)" /> <DoCompile Desc="Building MyProject 2" Param1="$(Param1Value)" /> <!-- etc --> The custom build task DoCompile is defined as: public class DoCompile : Microsoft.Build.Utilities.Task { [Required] public string Description { set { _description = value; } } // ... more code here ... } Whilst the build is running, as each task starts, the logger module receives IEventSource.TaskStarted events, subscribed to as follows: public class MyLogger : Microsoft.Build.Utilities.Logger { public override void Initialize(Microsoft.Build.Framework.IEventSource eventSource) { eventSource.TaskStarted += taskStarted; } private void taskStarted(object sender, Microsoft.Build.Framework.TaskStartedEventArgs e) { // write e.TaskName, attributes and e.Timestamp to log file } } The problem I have is that in the taskStarted() method above, I want to be able to access the attributes of the task for which the event was fired. I only have access to the logger code and cannot change either the build.xml or the custom build tasks. Can anyone suggest a way I can do this?

  Read the article

• Java application design question

  - by ring bearer

  I have a hobby project, which is basically to maintain 'todo' tasks in the way I like. One task can be described as: public class TodoItem { private String subject; private Date dueBy; private Date startBy; private Priority priority; private String category; private Status status; private String notes; } As you can imagine I would have 1000s of todo items at a given time. What is the best strategy to store a todo item? (currently on an XML file) such that all the items are loaded quickly up on app start up(the application shows kind of a dashboard of all the items at start up)? What is the best way to design its back-end so that it can be ported to Android/or a J2ME based phone? Currently this is done using Java Swing. What should I concentrate on so that it works efficiently on a device where memory is limited? The application throws open a form to enter new todo task. For now, I would like to save the newly added task to my-todos.xml once the user presses "save" button. What are the common ways to append such a change to an existing XML file?(note that I don't want to read the whole file again and then persist)

  Read the article

• Looking for Reachability (2.0) Use Case Validation

  - by user350243

  There is so much info out there on using Apple's Reachability example, and so much is conflicting. I'm trying to find out of I'm using it (Reachability 2.0) correctly below. My App use case is this: If an internet connection is available through any means (wifi, LAN, Edge, 3G, etc.) a UIButton ("See More") is visible on various views. If no connection, the button is not visible. The "See More" part is NOT critical in any way to the app, it's just an add-on feature. "See More" could be visible or not anytime during the application lifecycle as connection is established or lost. Here's how I did it - Is this correct and/or is there a better way? Any help is Greatly Appreciated! lq // AppDelegate.h #import "RootViewController.h" @class Reachability; @interface AppDelegate : NSObject <UIApplicationDelegate> { UIWindow *window; UINavigationController *navigationController; RootViewController *rootViewController; Reachability* hostReach; // NOT USED: Reachability* internetReach; // NOT USED: Reachability* wifiReach; } @property (nonatomic, retain) IBOutlet UIWindow *window; @property (nonatomic, retain) IBOutlet UINavigationController *navigationController; @property (nonatomic, retain) IBOutlet RootViewController *rootViewController; @end // AppDelegate.m #import "AppDelegate.h" #import "Reachability.h" #define kHostName @"www.somewebsite.com" @implementation AppDelegate @synthesize window; @synthesize navigationController; @synthesize rootViewController; - (void) updateInterfaceWithReachability: (Reachability*) curReach { if(curReach == hostReach) { NetworkStatus netStatus = [curReach currentReachabilityStatus]; BOOL connectionRequired = [curReach connectionRequired]; // Set a Reachability BOOL value flag in rootViewController // to be referenced when opening various views if ((netStatus != ReachableViaWiFi) && (netStatus != ReachableViaWWAN)) { rootViewController.bConnection = (BOOL *)0; } else { rootViewController.bConnection = (BOOL *)1; } } } - (void) reachabilityChanged: (NSNotification* )note { Reachability* curReach = [note object]; NSParameterAssert([curReach isKindOfClass: [Reachability class]]); [self updateInterfaceWithReachability: curReach]; } - (void)applicationDidFinishLaunching:(UIApplication *)application { // NOTE: #DEFINE in Reachability.h: // #define kReachabilityChangedNotification @"kNetworkReachabilityChangedNotification" [[NSNotificationCenter defaultCenter] addObserver: self selector: @selector(reachabilityChanged:) name: kReachabilityChangedNotification object: nil]; hostReach = [[Reachability reachabilityWithHostName: kHostName] retain]; [hostReach startNotifer]; [self updateInterfaceWithReachability: hostReach]; [window addSubview:[navigationController view]]; [window makeKeyAndVisible]; } - (void)dealloc { [navigationController release]; [rootViewController release]; [window release]; [super dealloc]; } @end

  Read the article

• Python and Plone help

  - by Grenko

  Im using the plone cms and am having trouble with a python script. I get a name error "the global name 'open' is not defined". When i put the code in a seperate python script it works fine and the information is being passed to the python script becuase i can print the query. Code is below: #Import a standard function, and get the HTML request and response objects. from Products.PythonScripts.standard import html_quote request = container.REQUEST RESPONSE = request.RESPONSE # Insert data that was passed from the form query=request.query #print query f = open("blast_query.txt","w") for i in query: f.write(i) return printed I also have a second question, can i tell python to open a file in in a certain directory for example, If the script is in a certain loaction i.e. home folder, but i want the script to open a file at home/some_directory/some_directory can it be done?

  Read the article

• Ruby hpricot does not like dash in symbol, is there a workaround?

  - by eakkas

  I am trying to parse an xml file with hpricot. The xml element that I am trying to get has a dash though and hence the issue that I am facing xml <xliff xmlns="urn:oasis:names:tc:xliff:document:1.1" version="1.1"> <trans-unit> <source>"%0" can not be found. Please try again.</source> <target>"%0" can not be found. Please try again.</target> </trans-unit> </xliff> rb def read_in_xliff(xlf_file_name) stream = open(xlf_file_name) {|f| Hpricot(f)} (stream/:xliff/:'trans-unit').each do |transunit| .......... This does not work because of the dash. If I rename the tag to transunit and edit the symbol reference accordingly everything seems to be fine. I thought using the symbol between quotes should work but hpricot does not seem to like this. Can anyone think of a workaround? Thanks in advance

  Read the article

• python lxml problem

  - by David ???

  I'm trying to print/save a certain element's HTML from a web-page. I've retrieved the requested element's XPath from firebug. All I wish is to save this element to a file. I don't seem to succeed in doing so. (tried the XPath with and without a /text() at the end) I would appreciate any help, or past experience. 10x, David import urllib2,StringIO from lxml import etree url='http://www.tutiempo.net/en/Climate/Londres_Heathrow_Airport/12-2009/37720.htm' seite = urllib2.urlopen(url) html = seite.read() seite.close() parser = etree.HTMLParser() tree = etree.parse(StringIO.StringIO(html), parser) xpath = "/html/body/table/tbody/tr/td[2]/div/table/tbody/tr[6]/td/table/tbody/tr/td[3]/table/tbody/tr[3]/td/table/tbody/tr/td/table/tbody/tr/td/table/tbody/text()" elem = tree.xpath(xpath) print elem[0].strip().encode("utf-8")

  Read the article

• Python subprocess.Popen

  - by Albert

  I have that code: #!/usr/bin/python -u localport = 9876 import sys, re, os from subprocess import * tun = Popen(["./newtunnel", "22", str(localport)], stdout=PIPE, stderr=STDOUT) print "** Started tunnel, waiting to be ready ..." for l in tun.stdout: sys.stdout.write(l) if re.search("Waiting for connection", l): print "** Ready for SSH !" break The "./newtunnel" will not exit, it will constantly output more and more data to stdout. However, that code will not give any output and just keeps waiting in the tun.stdout. When I kill the newtunnel process externally, it flushes all the data to tun.stdout. So it seems that I can't get any data from the tun.stdout while it is still running. Why is that? How can I get the information? Note that the default bufsize for Popen is 0 (unbuffered). I can also specify bufsize=0 but that doesn't change anything.

  Read the article

• one variable and multiple controllers..

  - by Simon

  I'm working on a web application, using the CAKEPHP framework. Herefor i need to request one variable on multiple pages (all pages have different controllers). it is oubvious that i get a error on several pages, since the variable isn't declared in all the different controllers. Is there a workaround for this? i've already tried the app:: import to import a controller in another controller, but this doens't seem to work (still get a undefined variable error). Thnx for your cooperation! Regards, Simon

  Read the article

• How to draw the "trail" in a maze solving application

  - by snow-spur

  Hello i have designed a maze and i want to draw a path between the cells as the 'person' moves from one cell to the next. So each time i move the cell a line is drawn Also i am using the graphics module The graphics module is an object oriented library Im importing from graphics import* from maze import* my circle which is my cell center = Point(15, 15) c = Circle(center, 12) c.setFill('blue') c.setOutline('yellow') c.draw(win) p1 = Point(c.getCenter().getX(), c.getCenter().getY()) this is my loop if mazez.blockedCount(cloc)> 2: mazez.addDecoration(cloc, "grey") mazez[cloc].deadend = True c.move(-25, 0) p2 = Point(getX(), getY()) line = graphics.Line(p1, p2) cloc.col = cloc.col - 1 Now it says getX not defined every time i press a key is this because of p2???

  Read the article

• Importing an Excel WorkSheet into a Datatable

  - by Nick LaMarca

  I have been asked to create import functionality in my application. I am getting an excel worksheet as input. The worksheet has column headers followed by data. The users want to simply select an xls file from their system, click upload and the tool deletes the table in the database and adds this new data. I thought the best way would be too bring the data into a datatable object and do a foeach for every row in the datatable insert row by row into the db. My question is what can anyone give me code to open an excel file, know what line the data starts on in the file, and import the data into a datable object?

  Read the article

• 'Stack level too deep' error in engine-like plugin with globalize

  - by nutsmuggler

  Hello folks. I have built an engine-like plugin thanks to the new features of Rails 2.3. It's a 'Product' module for a CMS, extrapolated from a previously existing (and working) model/controller. The plugin relies on easy_fckeditor and on globalize (description and title field are localised), and I suspect that globalized could be the culprit here... Everything works fine, except for the update action. I get the following error message: (posting just the first lines, all the message is about attribute_methods) stack level too deep /Library/Ruby/Gems/1.8/gems/activerecord-2.3.2/lib/active_record/attribute_methods.rb:64:in `generated_methods?' /Library/Ruby/Gems/1.8/gems/activerecord-2.3.2/lib/active_record/attribute_methods.rb:241:in `method_missing' /Library/Ruby/Gems/1.8/gems/activerecord-2.3.2/lib/active_record/attribute_methods.rb:249:in `method_missing' For referenze, the full error stack is here: http://pastie.org/596546 I've tried to debug eliminating all the input fields, one by one, but I keep getting the error. fckeditor doesn't seem the culprit (error even without fckeditor) This is the action: def update params[:product][:term_ids] ||= [] @product = Product.find(params[:id]) respond_to do |format| if @product.update_attributes(params[:product]) flash[:notice] = t(:Product_was_successfully_updated) format.html { redirect_to products_path } format.xml { head :ok } else format.html { render :action => "edit" } format.xml { render :xml => @product.errors, :status => :unprocessable_entity } end end end As you see it's quite straightforward. Of course I am not hoping someone to solve this question straightaway, I'd just like to have a head up, a suggestion about where to look to solve this issue. Thanks in advance, Davide

  Read the article

• Getting Feedburner Subscriber With CURL

  - by Eray Alakese

  I'm using FeedBurner Awareness API. XML data like this : <rsp stat="ok"> - <!-- This information is part of the FeedBurner Awareness API. If you want to hide this information, you may do so via your FeedBurner Account. --> - <feed id="9n66llmt1frfir51p0oa367ru4" uri="teknoblogo"> <entry date="2011-01-15" circulation="11" hits="18" reach="0"/> </feed> </rsp> I want to get circulation data (11) . I'm using this code: $whaturl="https://feedburner.google.com/api/awareness/1.0/GetFeedData?uri=teknoblogo"; //Initialize the Curl session $ch = curl_init(); //Set curl to return the data instead of printing it to the browser. curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1); //Set the URL curl_setopt($ch, CURLOPT_URL, $whaturl); //Execute the fetch $data = curl_exec($ch); //Close the connection curl_close($ch); $xml = new SimpleXMLElement($data); $fb = $xml->feed->entry['circulation']; echo $fb; echo "OK"; But, returned data is blank. There isn't any error. Only return OK . How can i solve this ? EDIT : echo $data; returning blank, too.

  Read the article

• VB.NET switching from ADO.NET to LINQ

  - by Cj Anderson

  I'm VERY new to Linq. I have an application I wrote that is in VB.NET 2.0. Works great, but I'd like to switch this application to Linq. I use ADO.NET to load XML into a datatable. The XML file has about 90,000 records in it. I then use the Datatable.Select to perform searches against that Datatable. The search control is a free form textbox. So if the user types in terms it searches instantly. Any further terms that are typed in continue to restrict the results. So you can type in Bob, or type in Bob Barker. Or type in Bob Barker Price is Right. The more criteria typed in the more narrowed your result. I bind the results to a gridview. Moving forward what all do I need to do? From a high level, I assume I need to: 1) Go to Project Properties -- Advanced Compiler Settings and change the Target framework to 3.5 from 2.0. 2) Add the reference to System.XML.Linq, Add the Imports statement to the classes. So I'm not sure what the best approach is going forward after that. I assume I use XDocument.Load, then my search subroutine runs against the XDocument. Do I just do the standard Linq query for this sort of repeated search? Like so: var people = from phonebook in doc.Root.Elements("phonebook") where phonebook.Element("userid") = "whatever" select phonebook; Any tips on how to best implement?

  Read the article

• Why is the destructor called when the CPython garbage collector is disabled?

  - by Frederik

  I'm trying to understand the internals of the CPython garbage collector, specifically when the destructor is called. So far, the behavior is intuitive, but the following case trips me up: Disable the GC. Create an object, then remove a reference to it. The object is destroyed and the __del__ method is called. I thought this would only happen if the garbage collector was enabled. Can someone explain why this happens? Is there a way to defer calling the destructor? import gc import unittest _destroyed = False class MyClass(object): def __del__(self): global _destroyed _destroyed = True class GarbageCollectionTest(unittest.TestCase): def testExplicitGarbageCollection(self): gc.disable() ref = MyClass() ref = None # The next test fails. # The object is automatically destroyed even with the collector turned off. self.assertFalse(_destroyed) gc.collect() self.assertTrue(_destroyed) if __name__=='__main__': unittest.main() Disclaimer: this code is not meant for production -- I've already noted that this is very implementation-specific and does not work on Jython.

  Read the article

• Python Imaging: YCbCr problems

  - by daver

  Hi, I'm doing some image processing in Python using PIL, I need to extract the luminance layer from a series of images, and do some processing on that using numpy, then put the edited luminance layer back into the image and save it. The problem is, I can't seem to get any meaningful representation of my Image in a YCbCr format, or at least I don't understand what PIL is giving me in YCbCr. PIL documentation claims YCbCr format gives three channels, but when I grab the data out of the image using np.asarray, I get 4 channels. Ok, so I figure one must be alpha. Here is some code I'm using to test this process: import Image as im import numpy as np pengIm = im.open("Data\\Test\\Penguins.bmp") yIm = pengIm.convert("YCbCr") testIm = np.asarray(yIm) grey = testIm[:,:,0] grey = grey.astype('uint8') greyIm = im.fromarray(grey, "L") greyIm.save("Data\\Test\\grey.bmp") I'm expecting a greyscale version of my image, but what I get is this jumbled up mess: http://i.imgur.com/zlhIh.png Can anybody explain to me where I'm going wrong? The same code in matlab works exactly as I expect.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• SQLAlchemy automatically converts str to unicode on commit

  - by Victor Stanciu

  Hello, When inserting an object into a database with SQLAlchemy, all it's properties that correspond to String() columns are automatically transformed from <type 'str'> to <type 'unicode'>. Is there a way to prevent this behavior? Here is the code: from sqlalchemy import create_engine, Table, Column, Integer, String, MetaData from sqlalchemy.orm import mapper, sessionmaker engine = create_engine('sqlite:///:memory:', echo=False) metadata = MetaData() table = Table('projects', metadata, Column('id', Integer, primary_key=True), Column('name', String(50)) ) class Project(object): def __init__(self, name): self.name = name mapper(Project, table) metadata.create_all(engine) session = sessionmaker(bind=engine)() project = Project("Lorem ipsum") print(type(project.name)) session.add(project) session.commit() print(type(project.name)) And here is the output: <type 'str'> <type 'unicode'> I know I should probably just work with unicode, but this would involve digging through some third-party code and I don't have the Python skills for that yet :)

  Read the article

• How do I use timezones with a datetime object in python?

  - by jidar

  How do I properly represent a different timezone in my timezone? The below example only works because I know that EDT is one hour ahead of me, so I can uncomment the subtraction of myTimeZone() import datetime, re from datetime import tzinfo class myTimeZone(tzinfo): """docstring for myTimeZone""" def utfoffset(self, dt): return timedelta(hours=1) def myDateHandler(aDateString): """u'Sat, 6 Sep 2008 21:16:33 EDT'""" _my_date_pattern = re.compile(r'\w+\,\s+(\d+)\s+(\w+)\s+(\d+)\s+(\d+)\:(\d+)\:(\d+)') day, month, year, hour, minute, second = _my_date_pattern.search(aDateString).groups() month = [ 'JAN', 'FEB', 'MAR', 'APR', 'MAY', 'JUN', 'JUL', 'AUG', 'SEP', 'OCT', 'NOV', 'DEC' ].index(month.upper()) + 1 dt = datetime.datetime( int(year), int(month), int(day), int(hour), int(minute), int(second) ) # dt = dt - datetime.timedelta(hours=1) # dt = dt - dt.tzinfo.utfoffset(myTimeZone()) return (dt.year, dt.month, dt.day, dt.hour, dt.minute, dt.second, 0, 0, 0) def main(): print myDateHandler("Sat, 6 Sep 2008 21:16:33 EDT") if __name__ == '__main__': main()

  Read the article

< Previous Page | 430 431 432 433 434 435 436 437 438 439 440 441  | Next Page >