Search Results

Search found 3929 results on 158 pages for 'genome assembly'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 44/158 | < Previous Page | 40 41 42 43 44 45 46 47 48 49 50 51  | Next Page >

  • "are you missing a using directive or an assembly reference?" but the namespace and reference are correct

    - by Filip
    Hi, I've got the following error when builing my project. The type or namespace name 'OvuMenu' could not be found (are you missing a using directive or an assembly reference?) But I have put a using in my code and a reference to the dll. It is a WPF application that exists of 3 projects. I checked the references, even intellisense works when I put the using directive in the page. thanks, Filip

    Read the article

  • If i write in assembly or machine language, will the program work on any computer with a compatible processor?

    - by user663425
    Basically, i'm wanting to know if i can use either machine or assembly language to write a program that will work on any computer with an x86 processor, despite differences in operating systems. For example, you run a program and no matter what computer it's on, it'll display "Hello, World!" I know it's a little crazy to want to know either of these to languages, but i figure it's an incredible thing to learn, so why not?

    Read the article

  • XmlSerializer giving FileNotFoundException at constructor

    - by Irwin
    An application I've been working with is failing when i try to serialize types. A statement like this: XmlSerialzer lizer = new XmlSerializer(typeof(MyType)); Produces: System.IO.FileNotFoundException occurred Message="Could not load file or assembly '[Containing Assembly of MyType].XmlSerializers, Version=1.0.0.0, Culture=neutral, PublicKeyToken=null' or one of its dependencies. The system cannot find the file specified." Source="mscorlib" FileName="[Containing Assembly of MyType].XmlSerializers, Version=1.0.0.0, Culture=neutral, PublicKeyToken=null" FusionLog="" StackTrace: at System.Reflection.Assembly._nLoad(AssemblyName fileName, String codeBase, Evidence assemblySecurity, Assembly locationHint, StackCrawlMark& stackMark, Boolean throwOnFileNotFound, Boolean forIntrospection) at System.Reflection.Assembly.nLoad(AssemblyName fileName, String codeBase, Evidence assemblySecurity, Assembly locationHint, StackCrawlMark& stackMark, Boolean throwOnFileNotFound, Boolean forIntrospection) I don't define any special serializers for my class.

    Read the article

  • W2k8, Sybase Driver, Permissions

    - by Clustermagnet
    Trying to get a .net (32bit) app running on a Windows 2008 server. My experience in the Windows world is quite limited. Is this related to the Full/Medium trust settings? Have been Googling for quite some time. Appreciate your feedback! Seeing the following error: Required permissions cannot be acquired. Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Security.Policy.PolicyException: Required permissions cannot be acquired. Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [PolicyException: Required permissions cannot be acquired.] System.Security.SecurityManager.ResolvePolicy(Evidence evidence, PermissionSet reqdPset, PermissionSet optPset, PermissionSet denyPset, PermissionSet& denied, Boolean checkExecutionPermission) +7606467 System.Security.SecurityManager.ResolvePolicy(Evidence evidence, PermissionSet reqdPset, PermissionSet optPset, PermissionSet denyPset, PermissionSet& denied, Int32& securitySpecialFlags, Boolean checkExecutionPermission) +57 [FileLoadException: Could not load file or assembly 'Sybase.Data.AseClient, Version=1.155.1000.0, Culture=neutral, PublicKeyToken=26e0f1529304f4a7' or one of its dependencies. Failed to grant minimum permission requests. (Exception from HRESULT: 0x80131417)] System.Reflection.Assembly._nLoad(AssemblyName fileName, String codeBase, Evidence assemblySecurity, Assembly locationHint, StackCrawlMark& stackMark, Boolean throwOnFileNotFound, Boolean forIntrospection) +0 System.Reflection.Assembly.nLoad(AssemblyName fileName, String codeBase, Evidence assemblySecurity, Assembly locationHint, StackCrawlMark& stackMark, Boolean throwOnFileNotFound, Boolean forIntrospection) +43 System.Reflection.Assembly.InternalLoad(AssemblyName assemblyRef, Evidence assemblySecurity, StackCrawlMark& stackMark, Boolean forIntrospection) +127 System.Reflection.Assembly.InternalLoad(String assemblyString, Evidence assemblySecurity, StackCrawlMark& stackMark, Boolean forIntrospection) +142 System.Reflection.Assembly.Load(String assemblyString) +28 System.Web.Configuration.CompilationSection.LoadAssemblyHelper(String assemblyName, Boolean starDirective) +46 [ConfigurationErrorsException: Could not load file or assembly 'Sybase.Data.AseClient, Version=1.155.1000.0, Culture=neutral, PublicKeyToken=26e0f1529304f4a7' or one of its dependencies. Failed to grant minimum permission requests. (Exception from HRESULT: 0x80131417)] System.Web.Configuration.CompilationSection.LoadAssemblyHelper(String assemblyName, Boolean starDirective) +613 System.Web.Configuration.CompilationSection.LoadAllAssembliesFromAppDomainBinDirectory() +203 System.Web.Configuration.CompilationSection.LoadAssembly(AssemblyInfo ai) +105 System.Web.Compilation.BuildManager.GetReferencedAssemblies(CompilationSection compConfig) +178 System.Web.Compilation.WebDirectoryBatchCompiler..ctor(VirtualDirectory vdir) +163 System.Web.Compilation.BuildManager.BatchCompileWebDirectoryInternal(VirtualDirectory vdir, Boolean ignoreErrors) +53 System.Web.Compilation.BuildManager.BatchCompileWebDirectory(VirtualDirectory vdir, VirtualPath virtualDir, Boolean ignoreErrors) +175 System.Web.Compilation.BuildManager.CompileWebFile(VirtualPath virtualPath) +86 System.Web.Compilation.BuildManager.GetVPathBuildResultInternal(VirtualPath virtualPath, Boolean noBuild, Boolean allowCrossApp, Boolean allowBuildInPrecompile) +261 System.Web.Compilation.BuildManager.GetVPathBuildResultWithNoAssert(HttpContext context, VirtualPath virtualPath, Boolean noBuild, Boolean allowCrossApp, Boolean allowBuildInPrecompile) +101 System.Web.Compilation.BuildManager.GetVirtualPathObjectFactory(VirtualPath virtualPath, HttpContext context, Boolean allowCrossApp, Boolean noAssert) +126 System.Web.Compilation.BuildManager.CreateInstanceFromVirtualPath(VirtualPath virtualPath, Type requiredBaseType, HttpContext context, Boolean allowCrossApp, Boolean noAssert) +62 System.Web.UI.PageHandlerFactory.GetHandlerHelper(HttpContext context, String requestType, VirtualPath virtualPath, String physicalPath) +33 System.Web.UI.PageHandlerFactory.GetHandler(HttpContext context, String requestType, String virtualPath, String path) +37 System.Web.MaterializeHandlerExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() +307 System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) +155 Version Information: Microsoft .NET Framework Version:2.0.50727.4959; ASP.NET Version:2.0.50727.4955

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Creating a Sandboxed Instance

    - by Ricardo Peres
    In .NET 4.0 the policy APIs have changed a bit. Here's how you can create a sandboxed instance of a type, which must inherit from MarshalByRefObject: static T CreateRestrictedType<T>(SecurityZone zone, params Assembly [] fullTrustAssemblies) where T : MarshalByRefObject, new() { return(CreateRestrictedType<T>(zone, fullTrustAssemblies, new IPermission [0]); } static T CreateRestrictedType<T>(SecurityZone zone, params IPermission [] additionalPermissions) where T : MarshalByRefObject, new() { return(CreateRestrictedType<T>(zone, new Assembly [0], additionalPermissions); } static T CreateRestrictedType<T>(SecurityZone zone, Assembly [] fullTrustAssemblies, IPermission [] additionalPermissions) where T : MarshalByRefObject, new() { Evidence evidence = new Evidence(); evidence.AddHostEvidence(new Zone(zone)); PermissionSet evidencePermissionSet = SecurityManager.GetStandardSandbox(evidence); foreach (IPermission permission in additionalPermissions ?? new IPermission[ 0 ]) { evidencePermissionSet.AddPermission(permission); } StrongName [] strongNames = (fullTrustAssemblies ?? new Assembly[0]).Select(a = a.Evidence.GetHostEvidence<StrongName>()).ToArray(); AppDomainSetup adSetup = new AppDomainSetup(); adSetup.ApplicationBase = Path.GetDirectoryName(typeof(T).Assembly.Location); AppDomain newDomain = AppDomain.CreateDomain("Sandbox", evidence, adSetup, evidencePermissionSet, strongNames); ObjectHandle handle = Activator.CreateInstanceFrom(newDomain, typeof(T).Assembly.ManifestModule.FullyQualifiedName, typeof(T).FullName); return (handle.Unwrap() as T); } SyntaxHighlighter.config.clipboardSwf = 'http://alexgorbatchev.com/pub/sh/2.0.320/scripts/clipboard.swf'; SyntaxHighlighter.brushes.CSharp.aliases = ['c#', 'c-sharp', 'csharp']; SyntaxHighlighter.all();

    Read the article

  • Share code between projects in a solution in Visual Studio 2008, when building a common assembly is

    - by Binary255
    Hi, I create an add-on for the product Foo. There are different versions of Foo, namely version 1, 2, 3 and 4. These versions have a mostly compatible API, but not fully. I currently have 5 projects: DotNetCommon - here are the common methods which could be used if I create an add-on or something other than the Foo product. FooOne FooTwo FooThree FooFour The Foo*-projects contains the add-in for version 1-4 of Foo. There are a lot of duplicated files in the Foo*-projects, as there are a lot of things in the API which are identical for all versions of Foo. It would be nice to separate out everything which is common for all Foo-versions. Why not just create a common assembly for all versions of Foo called FooCommon? If I would put all classes which are common for all versions of Foo into a new library project, I would still have to choose which version of Foo the new FooCommon should reference. As said, they are not identical.

    Read the article

  • Failed to create feature receiver object from assembly/FileNotFound...

    - by harshvardhan
    During solution deployments & Feature activation, I am facing an on/off issue where the system is unable to find & load the FeatureReceiver class. Mostly it is file not found exception (even though the assembly is there in the GAC). I checked over the net and this seems it a common issue with solutions (wsp) packaging DLL to be GACed. (But, no one has any clue or solution!) What is the recommendation and guideline to fix this issue? We are setting the flag to reset IIS in my solution definition - but that does not seem to help. The issue is more prevalent in multi-M farms. Thanks

    Read the article

  • How to change the security level of a local assembly to internet or customized permission set?

    - by Jamebo
    I built a assembly which is a class library, for example lib.dll . And I also have a application to access this lib, for example test.exe. I changed the security permission for the test.exe to "intranet". At the same time, I want to change lib.dll to "Internet" like this: (Because I want to do some testing for security.) CasPol.exe -m -ag 1.2 -strong -file lib.dll lib 1.0.0.0 Internent But it seems the lib.dll can not get the security permission as I wanted. What is wrong with the command? Or maybe there are some other better solutions? Thanks -Jamebo

    Read the article

  • Why does calling IEnumerable<string>.Count() create an additional assembly dependency ?

    - by Gishu
    Assume this chain of dll references Tests.dll >> Automation.dll >> White.Core.dll with the following line of code in Tests.dll, where everything builds result.MissingPaths Now when I change this to result.MissingPaths.Count() I get the following build error for Tests.dll "White.UIItem is not defined in an assembly that is not referenced. You must add a reference to White.Core.dll." And I don't want to do that because it breaks my layering. Here is the type definition for result, which is in Automation.dll public class HasResult { public HasResult(IEnumerable<string> missingPaths ) { MissingPaths = missingPaths; } public IEnumerable<string> MissingPaths { get; set; } public bool AllExist { get { return !MissingPaths.Any(); } } } Down the call chain the input param to this ctor is created via (The TreeNode class is in White.Core.dll) assetPaths.Where(assetPath => !FindTreeNodeUsingCache(treeHandle, assetPath)); Why does this dependency leak when calling Count() on IEnumerable ? I then suspected that lazy evaluation was causing this (for some reason) - so I slotted in an ToArray() in the above line but didn't work. Update 2011 01 07: Curiouser and Curiouser! it won't build until I add a White.Core reference. So I add a reference and build it (in order to find the elusive dependency source). Open it up in Reflector and the only references listed are Automation, mscorlib, System.core and NUnit. So the compiler threw away the White reference as it was not needed. ILDASM also confirms that there is no White AssemblyRef entry. Any ideas on how to get to the bottom of this thing (primarily for 'now I wanna know why' reasons)? What are the chances that this is an VS2010/MSBuild bug? Update 2011 01 07 #2 As per Shimmy's suggestion, tried calling the method explcitly as an extension method Enumerable.Count(result.MissingPaths) and it stops cribbing (not sure why). However I moved some code around after that and now I'm getting the same issue at a different location using IEnumerable - this time reading and filtering lines out of a file on disk (totally unrelated to White). Seems like it's a 'symptom-fix'. var lines = File.ReadLines(aFilePath).ToArray(); once again, if I remove the ToArray() it compiles again - it seems that any method that causes the enumerable to be evaluated (ToArray, Count, ToList, etc.) causes this. Let me try and get a working tiny-app to demo this issue... Update 2011 01 07 #3 Phew! More information.. It turns out the problem is just in one source file - this file is LINQ-phobic. Any call to an Enumerable extension method has to be explicitly called out. The refactorings that I did caused a new method to be moved into this source file, which had some LINQ :) Still no clue as to why this class dislikes LINQ. using System; using System.Collections.Generic; using System.IO; using System.Linq; using G.S.OurAutomation.Constants; using G.S.OurAutomation.Framework; using NUnit.Framework; namespace G.S.AcceptanceTests { public abstract class ConfigureThingBase : OurTestFixture { .... private static IEnumerable<string> GetExpectedThingsFor(string param) { // even this won't compile - although it compiles fine in an adjoining source file in the same assembly //IEnumerable<string> s = new string[0]; //Console.WriteLine(s.Count()); // this is the line that is now causing a build failure // var expectedInfo = File.ReadLines(someCsvFilePath)) // .Where(line => !line.StartsWith("REM", StringComparison.InvariantCultureIgnoreCase)) // .Select(line => line.Replace("%PLACEHOLDER%", param)) // .ToArray(); // Unrolling the LINQ above removes the build error var expectedInfo = Enumerable.ToArray( Enumerable.Select( Enumerable.Where( File.ReadLines(someCsvFilePath)), line => !line.StartsWith("REM", StringComparison.InvariantCultureIgnoreCase)), line => line.Replace("%PLACEHOLDER%", param)));

    Read the article

  • What does Visual Studio 2008 do when I add an assembly reference?

    - by tk-421
    When I add a reference to an assembly (living in the GAC) to web.config in an ASP.NET project, what does Visual Studio do? [This is related to an earlier question pertaining to BusinessObjects: http://stackoverflow.com/questions/2379615/ ] When I add "CrystalDecisions.Enterprise" and "CrystalDecisions.Enterprise.Framework" to the assemblies element in web.config, VS thinks long and hard about it, locking me out for a couple of minutes while it scrutinizes the newcomers. What is it doing during this time? I Googled this but came up empty. I can make some educated guesses (IntelliSense integration, perhaps?) but would ideally like to find some documentation describing exactly what's going on. Ultimately I'm hoping to learn why these BO references are making VS take several minutes to open my projects (I struck out on the SAP forums).

    Read the article

  • Assembly wide multicast attributes. Are they evil?

    - by HeavyWave
    I am working on a project where we have several attributes in AssemblyInfo.cs, that are being multicast to a methods of a particular class. [assembly: Repeatable( AspectPriority = 2, AttributeTargetAssemblies = "MyNamespace", AttributeTargetTypes = "MyNamespace.MyClass", AttributeTargetMemberAttributes = MulticastAttributes.Public, AttributeTargetMembers = "*Impl", Prefix = "Cls")] What I don't like about this, is that it puts a piece of login into AssemblyInfo (Info, mind you!), which for starters should not contain any logic at all. The worst part of it, is that the actual MyClass.cs does not have the attribute anywhere in the file, and it is completely unclear that methods of this class might have them. From my perspective it greatly hurts readability of the code (not to mention that overuse of PostSharp can make debugging a nightmare). Especially when you have multiple multicast attributes. What is the best practice here? Is anyone out there is using PostSharp attributes like this?

    Read the article

  • How to use a different assembly name for different configurations?

    - by Mark Ingram
    In Visual Studio 2008 (and others) when creating a .NET or silverlight application if you look at your project properties, it seems like you can only have one assembly name - across all configurations. I would like to compile my application as: MyAppDebug - in debug mode and just MyApp - in release mode Does anyone know if this is possible? Edit: It seems some people are questioning the reasoning behind the question, so I'll explain a little further: I'm working on a Silverlight application which gets automatically uploaded to our test site when I to a "build solution". The trouble is, the test team are now testing the online version, whilst I work on a new one. So, I want to have a url like .\MyApp.html for the regular version that the QA team will test and then .\MyApp.html?version=debug for the current version that I'm working on.

    Read the article

  • How can I pass a Visual Studio project's assembly version to another project for use in a post-build

    - by Coder7862396
    I have a solution with 2 projects: My Application 1.2.54 (C# WinForms) My Application Setup 1.0.0.0 (WiX Setup) I would like to add a post-build event to the WiX Setup project to run a batch file and pass it a command line parameter of My Application's assembly version number. The code may look something like this: CALL MyBatchFile.bat "$(fileVersion.ProductVersion($(var.My Application.TargetPath)))" But this results in the following error: Unhandled Exception:The expression """.My Application" cannot be evaluated. Method 'System.String.My Application' not found. C:\My Application\My Application Setup\My Application Setup.wixproj Error: The expression """.My Application" cannot be evaluated. Method 'System.String.My Application' not found. C:\My Application\My Application Setup\My Application Setup.wixproj I would like to be able to pass "1.2.54" to MyBatchFile.bat somehow.

    Read the article

  • Monodevelop: "Are you missing an assembly reference?" despite reference being added

    - by Nicolas Raoul
    I have a solution with 3 projects. Two of the projects compile fine: SparkleLib and SparkleLib.Cmis The third project (SparkleShare) depends on the two above, so I added them as references, but I get: The type or namespace name 'Cmis' does not exist in the namespace 'SparkleLib'. Are you missing an assembly reference? The error indicates that I should add SparkleLib.Cmis as a reference, but I already added it... I tried deleteting, re-adding, restarting, but no success. It is not a problem with my environment, as my fellow developers are having the same problem.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 40 41 42 43 44 45 46 47 48 49 50 51  | Next Page >