Search Results

Search found 15218 results on 609 pages for 'scoped array'.

Page 455/609 | < Previous Page | 451 452 453 454 455 456 457 458 459 460 461 462  | Next Page >

  • Suggestion to reverse string in c#

    - by HasanGursoy
    Is this the right method to reverse a string? I'm planning to use it to reverse a string like: Products » X1 » X3 to X3 « X1 « Products I want it to be a global function which can be used elsewhere. public static string ReverseString(string input, string separator, string outSeparator) { string result = String.Empty; string[] temp = Regex.Split(input, separator, RegexOptions.IgnoreCase); Array.Reverse(temp); for (int i = 0; i < temp.Length; i++) { result += temp[i] + " " + outSeparator + " "; } return result; }

    Read the article

  • How can I use a variable as a module name in Perl?

    - by mjn12
    I know it is possible to use a variable as a variable name for package variables in Perl. I would like to use the contents of a variable as a module name. For instance: package Foo; our @names =("blah1", "blah2"); 1; And in another file I want to be able be able to set the contents of a scalar to "foo" and then access the names array in Foo through that scalar. my $packageName = "Foo"; Essentially I want to do something along the lines of: @{$packageName}::names; #This obviously doesn't work. I know I can use my $names = eval '$'. $packageName . "::names" But only if Foo::names is a scalar. Is there another way to do this without the eval statement?

    Read the article

  • Regular Expression - capturing contents of <select>

    - by joey mueller
    I'm trying to use a regular expression to capture the contents of all option values inside an HTML select element For example, in: <select name="test"> <option value="blah">one</option> <option value="mehh">two</option> <option value="rawr">three</option> </select> I'd like to capture one two and three into an array. My current code is var pages = responseDetails.responseText.match(/<select name="page" .+?>(?:\s*<option .+?>([^<]+)<\/option>)+\s*<\/select>/); for (var c = 0; c<pages.length; c++) { alert(pages[c]); } But it only captures the last value, in this case, "three". How can I modify this to capture all of them? Thanks!

    Read the article

  • Curl automatically display the result?

    - by Emily
    I'm using php 5.3.2 and when i execute a curl it display the result directly without adding a print or echo function. Here is my code: <?php $pvars = array('query' => 'ice age', 'orderby' => 'popularity'); $timeout = 30; $myurl = "http://www.website.com"; $curl = curl_init(); curl_setopt($curl, CURLOPT_URL, $myurl); curl_setopt($curl, CURLOPT_TIMEOUT, $timeout); curl_setopt($curl, CURLOPT_POST, 1); curl_setopt($curl, CURLOPT_POSTFIELDS, $pvars); $xml = curl_exec($curl); curl_close ($curl); ?> What's wrong with my code and why it displays the result?

    Read the article

  • Calling UITableViews delegate methods directly.

    - by RickiG
    Hi I was looking for a way to call the edit method directly. - (void)tableView:(UITableView *)theTableView commitEditingStyle:(UITableViewCellEditingStyle)editingStyle forRowAtIndexPath:(NSIndexPath *)indexPath I have all my logic for animating manipulated cells, removing from my model array etc. in this method. It is getting called when a user swipes, adds or rearranges, but I would like to call it manually/directly as a background thread changes my model. I have constructed an NSIndexPath like so: NSIndexPath *path = [NSIndexPath indexPathForRow:i inSection:1]; I just can't figure out how to call something like: [self.tableview commitEditingStyle:UITableViewCellEditingStyleDelete forRowAtIndexPath:path]; Do I need to gain access to the methods of this plain style UITableView in another way? Thanks:)

    Read the article

  • Pear MDB2 class and raiserror exceptions in SQL Server

    - by drholzmichl
    Hi, in SQL Server it's possible to raise an error with raiserror(). I want to use a severity, which doesn't interrupt the connection. This error is raised in a stored procedure. In SQL Management Studio all is fine and I get my error code when executing this SP. But when trying to execute this SP via MDB2 in PHP5 this doesn't work. All I get is an empty array. MDB2 object is created via (including needed options): $db =& MDB2::connect($dsn); $db->setFetchMode(MDB2_FETCHMODE_ASSOC); $db->setOption('portability',MDB2_PORTABILITY_ALL ^ MDB2_PORTABILITY_EMPTY_TO_NULL); The following works (I get a PEAR error): $db->query("RAISERROR('test',11,0);"); But when calling a stored procedure which raises this error via $db->query("EXEC sp_raise_error"); there is not output. What's wrong?

    Read the article

  • JSON Search and remove in php?

    - by moogeek
    Hello! I have a session variable $_SESSION["animals"] containing a deep json object with values: $_SESSION["animals"]='{ "0":{"kind":"mammal","name":"Pussy the Cat","weight":"12kg","age":"5"}, "1":{"kind":"mammal","name":"Roxy the Dog","weight":"25kg","age":"8"}, "2":{"kind":"fish","name":"Piranha the Fish","weight":"1kg","age":"1"}, "3":{"kind":"bird","name":"Einstein the Parrot","weight":"0.5kg","age":"4"}, }'; For example, I want to find the line with "Piranha the Fish" and then remove it (and json_encode it again as it was). How to do this? I guess i need to search in json_decode($_SESSION["animals"],true) resulting array and find the parent key to remove but i'm stucked anyways.

    Read the article

  • Regex gurus! here's a teaser: mixed thousands separators and csv's

    - by chichilatte
    I've got a string like... "labour 18909, liberals 12,365,conservatives 14,720" ...and i'd like a regex which can get rid of any thousands separators so i can pull out the numbers easily. Or even a regex which could give me a tidy array like: (labour => 18909, liberals => 12365, conservatives => 14720) Oh i wish i had the time to figure out regexes! Maybe i'll buy one as a toilet book, mmm.

    Read the article

  • [C++]Advantage of using a static member function instead of an equivalent non-static member function

    - by jonathanasdf
    I was wondering whether there's any advantages to using a static member function when there is a non-static equivalent. Will it result in faster execution (because of not having to care about all of the member variables), or maybe less use of memory (because of not being included in all instances)? Basically, the function I'm looking at is an utility function to rotate an integer array representing pixel colours an arbitrary number of degrees around an arbitrary centre point. It is placed in my abstract Bullet base class, since only the bullets will be using it and I didn't want the overhead of calling it in some utility class. It's a bit too long and used in every single derived bullet class, making it probably not a good idea to inline. How would you suggest I define this function? As a static member function of Bullet, of a non-static member function of Bullet, or maybe not as a member of Bullet but defined outside of the class in Bullet.h? What are the advantages and disadvantages of each?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Codeigniter Form validation problem

    - by ben robinson
    Please please please can someone help me $this-load-library('form_validation'); $this-load-helper('cookie'); $data = array(); if($_POST) { // Set validation rules including additional validation for uniqueness $this-form_validation-set_rules('yourname', 'Your Name', 'trim|required'); $this-form_validation-set_rules('youremail', 'Your Email', 'trim|required|valid_email'); $this-form_validation-set_rules('friendname', 'Friends Name', 'trim|required'); $this-form_validation-set_rules('friendemail', 'Friends Email', 'trim|required|valid_email'); // Run the validation and take action if($this-form_validation-run()) { echo 'valid; } } else{ echo 'problem'; } Form validation is coming back with no errors can cany one see why?

    Read the article

  • Routing zend request through a default controller when controller not found.

    - by Brett Pontarelli
    Below is a function defined in my Bootstrap class. I must be missing something fundamental in the way Zend does routing and dispatching. What I am trying to accomplish is simple: For any request /foo/bar/* that is not dispatchable for any reason try /index/foo/bar/. The problem I'm having is when the FooController exists I get Action "foo" does not exist. Basically, the isDispatchable is always false. public function run() { $front = Zend_Controller_Front::getInstance(); $request = $front->getRequest(); $dispatcher = $front->getDispatcher(); //$controller = $dispatcher->getControllerClass($request); if (!$dispatcher->isDispatchable($request)) { $route = new Zend_Controller_Router_Route( ':action/*', array('controller' => 'index') ); $router = $front->getRouter(); $router->addRoute('FallBack', $route); } $front->dispatch(); }

    Read the article

  • TypeError: 'NoneType' object does not support item assignment

    - by R S John
    I am trying to do some mathematical calculation according to the values at particular index of a NumPy array with the following code X = np.arange(9).reshape(3,3) temp = X.copy().fill(5.446361E-01) ind = np.where(X < 4.0) temp[ind] = 0.5*X[ind]**2 - 1.0 ind = np.where(X >= 4.0 and X < 9.0) temp[ind] = (5.699327E-1*(X[ind]-1)**4)/(X[ind]**4) print temp But I am getting the following error Traceback (most recent call last): File "test.py", line 7, in <module> temp[ind] = 0.5*X[ind]**2 - 1.0 TypeError: 'NoneType' object does not support item assignment Would you please help me in solving this? Thanks

    Read the article

  • Dynamic programming: Find largest diamond (rhombus)

    - by Darksody
    I have a small program to do in Java. I have a 2D array filled with 0 and 1, and I must find the largest rhombus (as in square rotated by 90 degrees) and their numbers. Example: 0 1 0 0 0 1 1 0 1 1 1 0 1 0 1 1 1 1 0 1 1 1 1 1 0 0 1 1 1 1 1 1 1 1 1 1 Result: 1 1 1 1 1 1 1 1 1 1 1 1 1 The problem is similar to this SO question. If you have any idea, post it here.

    Read the article

  • iPhone: How to create dynamic image dragging ala iphone icon rearranging

    - by Jim Coffman
    On the iPhone, if you touch and hold your finger on an icon, it starts vibrating, then you can drag them around while the other icons move aside and rearrange dynamically. I'm trying to figure out how to do this inside an application with a grid of images or buttons. I don't need them to vibrate, but I do want the UI to allow the user to drag them with real-time dynamic reordering and then return the new position (ie, an int for accessing a mutable array). Any ideas how to do this? Any sample code out there? Thanks!

    Read the article

  • Craft a JSONpath expression so that it retrieves only a specific value?

    - by Alex
    Hello, I have some JSON of which the following is a small sample: results": { "div": [ { "class": "sylEntry", "id": "sylOne", "div": [ { "class": "sT", "id": "sOT", "p": "Mon 11/17, Computer work time" }, { "class": "des", "id": "dOne", "p": "All classes Siebel 0218" } ] }, I would like to only retrieve the "p" content for the div element with class "sT". I would like to use a loop and doing something like this: var arrayOfResults = $.results..div.p does not work because I only want to retrieve the p value for the div element with class "sT". So how do I construct my JSONpath so that it will retrive the array of p elements that are contained within the divs class "sT". Thanks!!

    Read the article

  • What if I have an API method and a contoller/view method with the same name in RoR?

    - by Chad Johnson
    Suppose I want to be able to view a list of products on my site by going to /product/list. Great. So this uses my 'list' view and outputs some HTML which my web browser will render. But now suppose I want to provide a REST API to my client where they can get a list of their products. So I suppose I'd have them authenticate with oAuth and then they'd call /product/list which would return a JSON array of their products. But like I said earlier, /product/list displays an HTML web page. So, I have a conflict. What is normal practice as far as providing APIs in Rails? Should I have a subdirectory, 'api', in /app/controller, and another 'product' controller? So my client would go to /api/product/list to get a list of their products? I'm a bit new to RoR, so I don't have the best grasp of the REST functionality yet, but hopefully my question makes sense.

    Read the article

  • Refreshing an XML file through HTTPService in Flex

    - by pfunc
    I'm having a problem refreshing an xml file. I am bringing it in through an HTTP service component and putting it into a bindable array _cattArr, that I am using as the dataprovider for a grid. When someone adds an item to the datagrid, it saves to the same xml file. Then I close the window, reopen it and don't see the item that has been added. It is writing to the xml file, because when I restart the flex app, the item has been added, it's just not refreshing it. I have tried to resend the httpservice, but still no luck. What is the correct process for doing this?

    Read the article

  • php simplexmlelement get first element in one line

    - by Senica Gonzalez
    Just trying to figure a shorter way to do this: I'm using simpleXMLElement to parse an xml file and it's aggravating to have to call two lines to process an array when I know what node I want. Current code: $xml = new SimpleXMLElement($data); $r = $xml->xpath('///givexNumber'); $result["cardNum"] = $r[0]; What I would like to do would be something like I can do with DomX $result["cardNum"] = $xml->xpath('///givexNumber')->item(0)->nodeValue; Any ideas? I didn't really see that simplexmlelement can do this, but thought someone might know a trick or two.

    Read the article

  • GA written in Java

    - by EnderMB
    I am attempting to write a Genetic Algorithm based on techniques I had picked up from the book "AI Techniques for Game Programmers" that uses a binary encoding and fitness proportionate selection (also known as roulette wheel selection) on the genes of the population that are randomly generated within the program in a two-dimensional array. I recently came across a piece of pseudocode and have tried to implement it, but have come across some problems with the specifics of what I need to be doing. I've checked a number of books and some open-source code and am still struggling to progress. I understand that I have to get the sum of the total fitness of the population, pick a random number between the sum and zero, then if the number is greater than the parents to overwrite it, but I am struggling with the implementation of these ideas. Any help in the implementation of these ideas would be very much appreciated as my Java is rusty.

    Read the article

  • Checking for Magento login on external page

    - by LinuxGnut
    I'm hitting a wall here while trying to access items from Magento on an external page (same server, same domain, etc, etc). I want to see if the user is logged into Magento before showing them certain parts on the site. Keep in mind that this code exists outside of Magento. Mage::app("default"); Mage::getSingleton("core/session", array("name" = "frontend")); if (empty($session)) { $session = Mage::getSingleton("customer/session"); } if($session-isLoggedIn()) echo "hi"; $cart = Mage::helper('checkout/cart')-getCart()-getItemsCount(); echo $cart; $cart returns 0, where I definitely have products in my cart. isLoggedIn() also returns false. What am I doing wrong here? Is there an option in Magento that I need to turn on or off to be able to access this information outside of Magento?

    Read the article

  • NSBitmapImageRep data Format as application icon image??

    - by Joe
    i have a char* array of data that was in RGBA and then moved to ARGB Bottom line is the set application image looks totally messed up and i cant put my finger on why? //create a bitmap representation of the image data. //The data is expected to be unsigned char** NSBitmapImageRep *bitmap = [[NSBitmapImageRep alloc] initWithBitmapDataPlanes : (unsigned char**) &dest pixelsWide:width pixelsHigh:height bitsPerSample:8 samplesPerPixel:4 hasAlpha:YES isPlanar:NO colorSpaceName:NSDeviceRGBColorSpace bitmapFormat:NSAlphaFirstBitmapFormat bytesPerRow: 0 bitsPerPixel:0 ]; NSImage *image = [[NSImage alloc] initWithSize:NSMakeSize(width, height)]; [image addRepresentation:bitmap]; if( image == NULL) { printf("image is null\n"); fflush(stdout); } [NSApp setApplicationIconImage :image]; What in these values is off? the image looks very multicolored and pixelated, with transparent parts/lines as well.

    Read the article

  • Most efficient way to save tile data of an isometric game

    - by Harmen
    Hello, I'm working on an isometric game for fast browsers that support <canvas>, which is great fun. To save information of each tile, I use a two-dimensional array which contains numbers representing a tile ID, like: var level = [[1, 1, 1, 2, 1, 0], [0, 1, 1, 2, 0, 1], [0, 1, 1, 2, 1, 1]]; var tiles = [ {name: 'grass', color: 'green'}, {name: 'water', color: 'blue'}, {name: 'forest', color: 'ForestGreen'} ]; So far it works great, but now I want to work with heights and slopes like in this picture: For each tile I need to save it's tile ID, height and information about which corners are turned upward. I came up with a simple idea about a bitwise representation of all four corners, like this: 1011 // top, bottom and left corner turned up My question is: what is the most efficient way to save these three values for each cell? Is it possible to save these three values as one integer?

    Read the article

  • PHP pathinfo gets fooled by url in quert string. Any workaround?

    - by Majid
    I am working on a small function to take in a url and return a relative path based on where it resides itself. If the url contains a path in the query string, pathinfo returns incorrect results. This is demonstrated by the code below: $p = 'http://localhost/demos/image_editor/dir_adjuster.php?u=http://localhost/demos/some/dir/afile.txt'; $my_path_info = pathinfo($p); echo $p . '<br/><pre>'; print_r($my_path_info); echo '</pre>'; That code outputs: http://localhost/demos/image_editor/dir_adjuster.php?u=http://localhost/demos/some/dir/afile.txt Array ( [dirname] => http://localhost/demos/image_editor/dir_adjuster.php?u=http://localhost/demos/some/dir [basename] => afile.txt [extension] => txt [filename] => afile ) Which obviously is wrong. Any workaround?

    Read the article

  • How to do a range query

    - by Walter H
    I have a bunch of numbers timestamps that I want to check against a range to see if they match a particular range of dates. Basically like a BETWEEN .. AND .. match in SQL. The obvious data structure would be a B-tree, but while there are a number of B-tree implementations on CPAN, they only seem to implement exact matching. Berkeley DB has the same problem; there are B-tree indices, but no range matching. What would be the simplest way to do this? I don't want to use an SQL database unless I have to. Clarification: I have a lot of these, so I'm looking for an efficient method, not just grep over an array.

    Read the article

< Previous Page | 451 452 453 454 455 456 457 458 459 460 461 462  | Next Page >