Search Results

Search found 25009 results on 1001 pages for 'content encoding'.

Page 489/1001 | < Previous Page | 485 486 487 488 489 490 491 492 493 494 495 496  | Next Page >

  • Is there any technical info about the youtube network?

    - by Allen
    I'm an IT graduate student trying to get my head around distributed content distribution systems, much like what I assume Youtube uses. I have read Google Research stuff like Bigtable and Google File System academic papers. Is there any such thing for Youtube? Can anyone point me at stuff to learn about the Youtube network and the underlying technology? thanks dbaman

    Read the article

  • In-Page RSS Reader (Flash? Javascript?)

    - by Jonathan Sampson
    Has anybody ever seen any (no-installs-necessary) solutions to listing any RSS feed on any page of a website? Ideally it would consist of HTML (javascript if necessary) and require no downloads or installs. I am thinking of twitter-style apps that you load up in an iframe or via Javascript and in turn they show your latest tweets on the page - same concept, different content. Just looking for a shiny gadget, not able to write my own solution for this particular project.

    Read the article

  • IIS7 doesn't monitor changes across symlinks

    - by Matt Hensley
    I've used the mklink utility to create a symlink to a directory of web content. IIS7 doesn't "see" changes any classic ASP files in this linked directory without issuing an iisreset. I've disabled caching and file changes are picked up on other static files (such as .html) but .asp files are ignored.

    Read the article

  • How to configure a hostname of sub-application?

    - by BrunoLM
    I have a structure like this: Website |- Controllers |- Models |- Views |- Content |- Static (APP) Website is an application using an ASP.NET 4.0 pool. Static is a sub-application using a not managed application pool. On Website bindings I've set local.domain.com to have access through port 80. I want to access the Static app using static.domain.com, but I don't find the option to configure the binding. How is it possible to configure like that?

    Read the article

  • Citrix Plug-in with TCP/IP access

    - by Mat Banik
    I have created for user file named serverDesktop.ica with following content: [ApplicationServers] XenApp= [XenApp] TransportDriver=TCP/IP Address=IP or DOMAIN NAME of the Server ProxyType=auto WinStationDriver=ICA 3.0 Username= Domain= Password= InitialProgram= WorkDirectory= ClientAudio=On ScreenPercent=100 DesiredHRES=1024 DesiredVRES=768 DesiredColor=8 [WFClient] Version=2 The above just gives the user remote desktop to the server. The question is how do I bring up all the Apps in farm via TCP/IP. The Citrix online plugin does not allow the same access as Program Neighborhood did to farms. Please help.

    Read the article

  • conditional mod_deflate based on headers

    - by Ben K.
    mod_deflate seems pretty sweet. I'd love to turn it on across the board for text/html--but for certain pages, I don't want to gzip since upstream proxies need to be able to inspect the content. I know there's an AddOutputFilterByType directive -- is there any way to combine that w/ a header inspect so that if I see X-NO-COMPRESS true I skip mod_deflate?

    Read the article

  • CMD: How do I delete all the contents of all directories (in the current directory) without deleting the directories themselves?

    - by merlin2011
    For example: I'm in the directory: F:\Data Inside this directory, I have four directories: F:\Datadir 22179 22915 23459 23460 These directories have various content, including directories and files. I'm trying to run something like: rmdir /s *\* where I delete all the contents of these numbered directories, while leaving the empty directories. Is there a one-liner that can do this, or do I have to loop through the sub-directories?

    Read the article

  • Make mod_wsgi use python2.7.2 instead of python2.6?

    - by guron
    i am running Ubuntu 10.04.1 LTS and it came pre-packed with python2.6 but i need to replace it with python2.7.2. (The reason is simple, 2.7 has a lot of features backported from 3 ) i had installed python2.7.2 using ./configure make make altinstall the altinstall option installed it, without touching the system default version, to /usr/local/lib/python2.7 and placed the interpreter in /usr/local/bin/python2.7 Then to help mod_wsgi find python2.7 i added the following to /etc/apache2/sites-available/wsgisite WSGIPythonHome /usr/local i start apache and run a test wsgi app BUT i am greeted by python 2.6.5 and not Python2.7 Later i replaced the default python simlink to point to python 2.7 ln -f /usr/local/bin/python2.7 /usr/bin/python Now typing 'python' on the console opens python2.7 but somehow mod_wsgi still picks up python2.6 Next i tried, PATH=/usr/local/bin:$PATH export PATH then do a quick restart apache, but yet again its python2.6 !! Here is my $PATH /usr/local/bin:/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games contents of /etc/apache2/sites-available/wsgisite WSGIPythonHome /usr/local <VirtualHost *:80> ServerName wsgitest.local DocumentRoot /home/wwwhost/pydocs/wsgi <Directory /home/wwwhost/pydocs/wsgi> Order allow,deny Allow from all </Directory> WSGIScriptAlias / /home/wwwhost/pydocs/wsgi/app.wsgi </VirtualHost> app.wsgi import sys def application(environ, start_response): status = '200 OK' output = sys.version response_headers = [('Content-type', 'text/plain'), ('Content-Length', str(len(output)))] start_response(status, response_headers) return [output] Apache error.log 'import site' failed; use -v for traceback [Sun Jun 19 00:27:21 2011] [info] mod_wsgi (pid=23235): Initializing Python. [Sun Jun 19 00:27:21 2011] [notice] Apache/2.2.14 (Ubuntu) mod_wsgi/2.8 Python/2.6.5 configured -- resuming normal operations [Sun Jun 19 00:27:21 2011] [info] Server built: Nov 18 2010 21:20:56 [Sun Jun 19 00:27:21 2011] [info] mod_wsgi (pid=23238): Attach interpreter ''. [Sun Jun 19 00:27:21 2011] [info] mod_wsgi (pid=23239): Attach interpreter ''. [Sun Jun 19 00:27:31 2011] [info] mod_wsgi (pid=23238): Create interpreter 'wsgitest.local|'. [Sun Jun 19 00:27:31 2011] [info] [client 192.168.1.205] mod_wsgi (pid=23238, process='', application='wsgitest.local|'): Loading WSGI script '/home/wwwhost/pydocs/$ [Sun Jun 19 00:27:50 2011] [info] mod_wsgi (pid=23239): Create interpreter 'wsgitest.local|'. Has anybody ever managed to make mod_wsgi run on a non-system default version of python ?

    Read the article

  • Burn 30GB zip file to DVD

    - by Joel Coehoorn
    I have a zip 30GB zip file containing an archive a digital materials available in the school library that I want to burn to dvd. Of course, 30Gb is far too large for a single dvd and the content is already zipped. I'm open to ideas, but leaning towards suggestions that will help me automatically spread the file over multiple dvds, including a simple program to stitch it back together again later.

    Read the article

  • UNIX tool to dump a selection of HTML?

    - by jldugger
    I'm looking to monitor changes on websites and my current approach is being defeated by a rotating top banner. Is there a UNIX tool that takes a selection parameter (id attribute or XPath), reads HTML from stdin and prints to stdout the subtree based on the selection? For example, given an html document I want to filter out everything but the subtree of the element with id="content". Basically, I'm looking for the simplest HTML/XML equivalent to grep.

    Read the article

  • How do I use different audio devices for different apps in Windows 8?

    - by Eclipse
    Besides switching the default audio device, how can I send the audio from one app (say x-box music) to one audio device, and another (say the video app) to another audio device? Edit: Looking further, I found this: http://channel9.msdn.com/Events/BUILD/BUILD2011/APP-408T At 16:16, he demonstrates exactly what I'm wanting to do, but when I go to the devices charm, I get a message: "You don't have any devices that can receive content from Music".

    Read the article

  • How to setup IIS subdomain pointing to folder on remote machine?

    - by zsharp
    Im trying to serve static content through a subdomain. The physical folder is shared on a second machine in the same local domain. How do I safely setup permissions on the shared folder so that when i do something like: src="subdomain.domain.com/Image1.png" I wont get access denied? IN IIS I have subdomain.domain.com as a separate website.

    Read the article

  • mysqldump trigger crashed tables

    - by m4rc
    We had a database crash this morning starting at 1 minute past midnight (when the database backup runs). The exception emails I was getting said "Table './core/content' is marked as crashed and should be repaired". My question is basically, can mysqldump cause tables to crash, if so how and why? And are there any tools which can detect a crashed table and run a repair on it? Thanks in advance.

    Read the article

  • How to auto advance a PowerPoint slide after an exit animation is over?

    - by joooc
    PowerPoint entrance animation set up with "Start: With Previous" starts right when a new slide is advanced. However, if you set up an exit animation in the same way, it doesn't start with a slide ending sequence. Instead, the "Start: On Click" trigger needs to be used and after your exit animation is over you still need one extra click just to advance to the next slide. Workarounds to this are obvious: create a duplicate slide, make your ending animations from the original slide being your starting animations on the duplicate slide and let them be followed with whatever you want or create a transition slide with those ending animations only and set up "Change Advance slide - Automatically after - [the time it takes your animations to finish]". These workarounds will make it work for your audience, visually. However, it has an impact on slide numbers you might need to adjust accordingly and/or duplicate content changes. If you are the only one creating and using your presentation, this might be just fine. But if you are creating a presentation in collaborative mode with three other people and don't even know who will be the presenter at the end, you can mess things up. Let's be specific: most of my slides have 0.2s fly in entrance animation applied to blocks of content coming from right, bottom or left. Advancing to the next slide I want them to fly out in another 0.2s exit animation being followed by new slide 0.2s fly in entrance animation of the new blocks. The swapping of the blocks should be triggered while advancing to the next slide, as usually. As mentioned, I'm not able to achieve this without one extra click between the slides. I wrote a VBA script that should start together with an exit animation and will auto advance a slide after 0.3s when the exit animation is over. That way I should get rid of those extra clicks which are needed right now. Sub nextslide() iTime = 0.3 Start = Timer While Timer < Start + iTime DoEvents Wend With SlideShowWindows(1).View .GotoSlide (ActivePresentation.SlideShowWindow.View.Slide.SlideIndex + 1) End With End Sub It works well when binded on a box, button or another object. But I can't make it run on a single click (anywhere on the slide) so that it could start together with the exit animation onclick trigger. Creating a big transparent rectangular shape over the whole slide and binding the macro on it doesn't help either. By clicking it you only get the macro running, exit animation is not triggered. Anyway, I don't want to bind the macro to any other workaround object but the slide itself. Anyone knows how to trigger a PowerPoint VBA script on slide onclick event? Anyone knows a secret setting that will make the exit animation work as expected i.e. animating right before exiting a slide while transitioning to the next one? Anyone knows how to beat this dragon? Thank you!

    Read the article

  • How to use rsync when filenames contain double quotes?

    - by wfoolhill
    I am trying to synchronize the content of the directory my_dir/ from /home to /backup. This directory contains a file which name has a double quote in it, such as to"to. Here is my rsync command: rsync -Cazh /home/my_dir/ /backup/my_dir/ And I get the following message: rsync: mkstemp "/backup/my_dir/.to"to.d93PZr" failed: Invalid argument (22) For info, rsync works well when the synchronized filenames contain single quote, parenthesis and space. Thus, why is it bugging with a double quote? Thanks for any help.

    Read the article

  • How can I read out internal pdf creation/modified date with Windows PowerShell?

    - by Martin
    PDF files seem to have a separate set of file properties which contain (among others) a creation date and a modified date (see screenshot here: http://ventajamarketing.com/writingblog/wp-content/uploads/2012/02/Acrobat-Document-Properties1-300x297.png). Those date obviously can differ from the creation and modified date shown in the file system (Windows Explorer). How can I access the date information in the PDF file and read it out in Windows 7 with Windows PowerShell (or maybe another method)?

    Read the article

  • How to ensure precedence of files over directories with Apache?

    - by janeden
    My httpd.conf uses the MultiViews option to serve HTML files for URLs like http://server/blog. This works fine, unless there are directories with the same name – Apache will then try to serve the directory. Is there any way to ensure precedence of blog.html over blog/, or rather: can I make Apache process content negotiation according to MultiView although a matching entity (the directory) is present? In nginx, I can do this explicitly: try_files $uri $uri.html $uri/ =404;

    Read the article

  • Rule of thumb in RAM estimate for static pages? [closed]

    - by IMB
    Possible Duplicate: How do you do Load Testing and Capacity Planning for Web Sites I've seen tutorials saying they can run decent websites on 64MB RAM (Debian/Lighttpd/PHP/MySQL) however it's not clearly defined how much hits/traffic a "decent" site gets. Is there a rule of thumb on how much RAM a web server needs? To keep things simple, let's say you're running a site with static content and it's averaging at 100,000 hits per hour (HTML + images combined, no MySQL). How much RAM is the minimum requirement for that?

    Read the article

  • Safe to disable compile options for Nginx (when used only as reverse proxy/cache)

    - by Alex
    I have read that I can do this to make a smaller footprint Nginx when used as static content cache/reverse proxy: --without-mail_pop3_module --without-mail_imap_module --without-mail_smtp_module What other options are safe to disable? SSI, FastCGI? Others? The only requirements for the reverse proxy is to be able to do https and gzip compression. Will disabling all the module really help with footprint and/or performance?

    Read the article

  • Does hosting multiple sites on one server hurt your SEO?

    - by MarathonStudios
    I have a handful of (content unrelated) sites with decent PRs and I'm considering hosting them all on the same server. I've heard that if you do this, internal linking between two seperate domains on that server may be seen as less "valid" by Google in PageRank terms (since you obviously own both of the sites as they share an IP address). Anyone have any experience in this? I'd love to save some hosting cash by consolidating, but not at the expense of losing the ability to link my sites together powerfully.

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Beginner server local installation

    - by joanjgm
    Here's the thing I own a small business and currently my emails are being managed by some regular hosting using cpanel and that I bought a small server and installed windows server and exchange Can you tell what I did wrong here Installed and configured my current existing domain Configured all email address Installed noip in case my public address change In the cpanel of the domain I've added an MX record to the noip domain of the server with priority 0 so now emails are being received by my own server Now whenever I send an email to anyone gmail hotmail etc I get a response that cannot be delivered since may be junk This didn't happen when I sent emails from the hosting What's missing what did I do wrong heres the code mx.google.com rejected your message to the following e-mail addresses: Joan J. Guerra Makaren ([email protected]) mx.google.com gave this error: [186.88.202.13 12] Our system has detected that this message is likely unsolicited mail. To reduce the amount of spam sent to Gmail, this message has been blocked. Please visit http://support.google.com/mail/bin/answer.py?hl=en&answer=188131 for more information. cn9si815432vcb.71 - gsmtp Your message wasn't delivered due to a permission or security issue. It may have been rejected by a moderator, the address may only accept e-mail from certain senders, or another restriction may be preventing delivery. Diagnostic information for administrators: Generating server: SERVERMEGA.megaconstrucciones.com.ve [email protected] mx.google.com #550-5.7.1 [186.88.202.13 12] Our system has detected that this message is 550-5.7.1 likely unsolicited mail. To reduce the amount of spam sent to Gmail, 550-5.7.1 this message has been blocked. Please visit 550-5.7.1 http://support.google.com/mail/bin/answer.py?hl=en&answer=188131 for 550 5.7.1 more information. cn9si815432vcb.71 - gsmtp ## Original message headers: Received: from SERVERMEGA.megaconstrucciones.com.ve ([fe80::9096:e9c2:405b:6112]) by SERVERMEGA.megaconstrucciones.com.ve ([fe80::9096:e9c2:405b:6112%10]) with mapi; Thu, 29 May 2014 11:32:19 -0430 From: prueba <[email protected]> To: "Joan J. Guerra Makaren" <[email protected]> Subject: Probando correos Thread-Topic: Probando correos Thread-Index: Ac97V1eW4OBFmoqJTRGoD7IPTC2azg== Date: Thu, 29 May 2014 16:04:35 +0000 Message-ID: <[email protected]> Accept-Language: en-US, es-VE Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: Content-Type: multipart/alternative; boundary="_000_000f42494487966276f7b241megaconstruccionescomve_" MIME-Version: 1.0

    Read the article

< Previous Page | 485 486 487 488 489 490 491 492 493 494 495 496  | Next Page >