Search Results

Search found 8886 results on 356 pages for 'parse tree'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 49/356 | < Previous Page | 45 46 47 48 49 50 51 52 53 54 55 56  | Next Page >

  • Finding the actual runtime call tree of a Java Program

    - by Chathuranga Chandrasekara
    Suppose I have a big program that consists of hundreds of methods in it. And according to the nature of input the program flow is getting changed. Think I want to make a change to the original flow. And it is big hassle to find call hierarchy/ references and understand the flow. Do I have any solution for this within Eclipse? Or a plugin? As an example, I just need a Log of method names that is in order of time. Then I don't need to worry about the methods that are not relevant with my "given input" Update : Using debug mode in eclipse or adding print messages are not feasible. The program is sooooo big. :)

    Read the article

  • .hgignore whole directory tree excepting one specific file

    - by John Mee
    Can anyone tell me the .hgignore pattern to track one specific file in a directory and to ignore everything else? I have a "media" directory which contains a "default.png", for obvious purposes, and the rest of the directory will hold user media. We want hg to ignore everything in the media directory excepting the default file.

    Read the article

  • Parse Nested XML tags with the same name

    - by footose
    Let's take a simple XML document: <x> <e> <e> <e>Whatever 1</e> </e> </e> <e> <e> <e>Whatever 2</e> </e> </e> <e> <e> <e>Whatever 3</e> </e> </e> </x> Using the standard org.w3c.dom, I can get the nodes in X by doing.. NodeList fullnodelist = doc.getElementsByTagName("x"); But if I want to return the next set of "e" I try to use something like .. Element element = (Element) fullnodelist.item(0); NodeList nodes = pelement.getElementsByTagName("e"); Expecting it to return "3" nodes (because there are 3 sets of "e"), but instead, it returns "9" - becuase it gets all entries with "e" apperently. This would be fine in the above case, because I could probably iterate through and find what I'm looking for. The problem I'm having is that when the XML file looks like the following: <x> <e> <pattern>whatever</pattern> <blanks> <e>Something Else</e> </blanks> </e> <e> <pattern>whatever</pattern> <blanks> <e>Something Else</e> </blanks> </e> </x> When I request the "e" value, it returns 4, instead of (what i expect) 2. Am I just not understanding how the DOM parsing works? Typically in the past I have used my own XML documents so I would never name the items like this, but unfortunately this is not my XML file and I have no choice to work like this. What I thought I would do is write a loop that "drills down" nodes so that I could group each node together... public static NodeList getNodeList(Element pelement, String find) { String[] nodesfind = Utilities.Split(find, "/"); NodeList nodeList = null; for (int i = 0 ; i <= nodesfind.length - 1; i++ ) { nodeList = pelement.getElementsByTagName( nodesfind[i] ); pelement = (Element)nodeList.item(i); } // value of the nod we are looking for return nodeList; } .. So that if you passed "s/e" into the function, it would return the 2 nodes that I'm looking for (or elements, maybe I'm using the terminology incorrect?). instead it returns all of the "e" nodes within that node. I'm using J2SE for this, so options are rather limited. I can't use any third party XML Parsers. Anyway, if anyone is still with me and has a suggestion, it would be appreciated.

    Read the article

  • How to intercept, parse and compile?

    - by epitka
    This is a problem I've been struggling to solve for a while. I need a way to either replace code in the method with a parsed code from the template at compile time (PostSharp comes to mind) or to create a dynamic proxy (Linfu or Castle). So given a source code like this [Template] private string GetSomething() { var template = [%=Customer.Name%] } I need it to be compiled into this private string GetSomething() { MemoryStream mStream = new MemoryStream(); StreamWriter writer = new StreamWriter(mStream,System.Text.Encoding.UTF8); writer.Write(@"" ); writer.Write(Customer.Name); StreamReader sr = new StreamReader(mStream); writer.Flush(); mStream.Position = 0; return sr.ReadToEnd(); } It is not important what technology is used. I tried with PostSharp's ImplementMethodAspect but got nowhere (due to lack of experience with it). I also looked into Linfu framework. Can somebody suggest some other approach or way to do this, I would really appreciate. My whole project depends on this.

    Read the article

  • Log 2 N generic comparison tree

    - by Morano88
    Hey! I'm working on an algorithm for Redundant Binary Representation (RBR) where every two bits represent a digit. I designed the comparator that takes 4 bits and gives out 2 bits. I want to make the comparison in log 2 n so If I have X and Y .. I compare every 2 bits of X with every 2 bits of Y. This is smooth if the number of bits of X or Y equals n where (n = 2^X) i.e n = 2,4,8,16,32,... etc. Like this : However, If my input let us say is 6 or 10 .. then it becomes not smooth and I have to take into account some odd situations like this : I have a shallow experience in algorithms .. is there a generic way to do it .. so at the end I get only 2 bits no matter what the input is ? I just need hints or pseudo-code. If my question is not appropriate here .. so feel free to flag it or tell me to remove it. I'm using VHDL by the way!

    Read the article

  • Drawing tree diagram in ASP.Net MVC

    - by Ivan Crojach Karacic
    I am creating an web application for my tae kwon do club. People are able to register online for a tournament. After the registration deadline the web application generates a dendrogram. Something like this: I am wondering now how to draw it. Because of the fact that there are my weight and age categories i have to draw them dynamicly for each group. What is the easiest way to draw this inside a MVC view?

    Read the article

  • Ruby GraphViz Binary Tree Record

    - by Jason M
    I'm using the ruby-graphviz gem and I'm trying to draw binary trees. I'd like to use the record shape so that each node can have a left, middle, and right field and, thus, if there are two edges leaving a node, the left and right edges can be distinguished. I tried specifying the field by concatenating the field name like this: @node1.name + ":left" But that did not work. What is the correct way of specifying the field? require 'rubygems' require 'graphviz' @graph = GraphViz.new( :G, :type => :digraph ) @node1 = @graph.add_node("1", "shape" => "record", "label" => "<left>|<f1> 1|<right>" ) @node2 = @graph.add_node("2", "shape" => "record", "label" => "<left>|<f1> 2|<right>" ) @graph.add_edge(@node1.name + ":left", @node2) # generate a random filename filename = "/tmp/#{(0...8).map{65.+(rand(25)).chr}.join}.png" @graph.output( :png => filename ) exec "open #{filename}"

    Read the article

  • Using NSXMLParser to parse Vimeo XML on iPhone.

    - by Sonny Fazio
    Hello, I'm working on an iPhone app that will use Vimeo Simple API to give me a listing our videos by a certain user, in a convenient TableView format. I'm new to Parsing XML and have tried TouchXML, TinyXML, and now NSXMLParser with no luck. Most tutorials on parsing XML are for a blog, and not for an API XML sheet. I've tried modifying the blog parsers to search for the specific tags, but it doesn't seem to work. Right now I'm working with NSXMLParser and it seems to correctly find the value of an XML tag, but when it goes to append it to a NSMutableString, it writes a whole bunch of nulls in between it. I'm using a tutorial from theappleblog and modifying it to work with Vimeo API - (void)parser:(NSXMLParser *)parser foundCharacters:(NSString *)string{ if ([currentElement isEqualToString:@"video_title"]) { NSLog(@"String: %@",string); [currentTitle appendString:string]; } else if ([currentElement isEqualToString:@"video_url"]) { [currentLink appendString:string]; } else if ([currentElement isEqualToString:@"video_description"]) { [currentSummary appendString:string]; } else if ([currentElement isEqualToString:@"date"]) { [currentDate appendString:string]; } Here is the nulls it writes: http://grab.by/grabs/92d9cfc2df4fac3fe6579493b1a8e89f.png Then when it finishes, it has to add the NSMutableStrings into a NSMutableDictionary - (void)parser:(NSXMLParser *)parser didStartElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName attributes:(NSDictionary *)attributeDict{ //NSLog(@"found this element: %@", elementName); currentElement = [elementName copy]; if ([elementName isEqualToString:@"item"]) { // clear out our story item caches... item = [[NSMutableDictionary alloc] init]; currentTitle = [[NSMutableString alloc] init]; currentDate = [[NSMutableString alloc] init]; currentSummary = [[NSMutableString alloc] init]; currentLink = [[NSMutableString alloc] init]; } } - (void)parser:(NSXMLParser *)parser didEndElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName{ NSLog(@"Title: %@",currentTitle); if ([elementName isEqualToString:@"item"]) {// save values to an item, then store that item into the array... [item setObject:currentTitle forKey:@"video_title"]; NSLog(@"Current Title%@", currentTitle); [item setObject:currentLink forKey:@"video_url"]; [item setObject:currentSummary forKey:@"video_description"]; [item setObject:currentDate forKey:@"date"]; [stories addObject:[item copy]]; NSLog(@"adding story: %@", currentTitle); } } I would really appreciate it if someone has any advance

    Read the article

  • How to select all parents of a node in a hierarchical mysql table?

    - by Ehsan Khodarahmi
    I have a MySQL table that represents data for a tree GUI component, here's the structure of my table: treeTable ( id INT NOT NULL PRIMARY KEY, parentId INT, name VARCHAR(255) ); parentId is a self-referencing foreign key. Now I want to write a stored procedure which gets a node id and returns a result set that contains that node and all of its parents. For example, suppose that my table has filled with this data: 1, null, 'root' 2, 1 , 'level_1' 3, 2 , 'level_2' Now I want to get all parent nodes of node 3 (nodes 1 and 2) and return a result set that contains all tree records. Can anybody help me please?

    Read the article

  • Scala parser combinators: how to parse "if(x)" if x can contain a ")"

    - by Germán
    I'm trying to get this to work: def emptyCond: Parser[Cond] = ("if" ~ "(") ~> regularStr <~ ")" ^^ { case s => Cond("",Nil,Nil) } where regularStr is defined to accept a number of things, including ")". Of course, I want this to be an acceptable input: if(foo()). But for any if(x) it is taking the ")" as part of the regularStr and so this parser never succeeds. What am I missing?

    Read the article

  • Find/parse server-side <?abc?>-like tags in html document

    - by Iggyhopper
    I guess I need some regex help. I want to find all tags like <?abc?> so that I can replace it with whatever the results are for the code ran inside. I just need help regexing the tag/code string, not parsing the code inside :p. <b><?abc print 'test' ?></b> would result in <b>test</b> Edit: Not specifically but in general, matching (<?[chars] (code group) ?>)

    Read the article

  • using compareTo in Binary Search Tree program

    - by Scott Rogener
    I've been working on this program for a few days now and I've implemented a few of the primary methods in my BinarySearchTree class such as insert and delete. Insert seemed to be working fine, but once I try to delete I kept getting errors. So after playing around with the code I wanted to test my compareTo methods. I created two new nodes and tried to compare them and I get this error: Exception in thread "main" java.lang.ClassCastException: TreeNode cannot be cast to java.lang.Integer at java.lang.Integer.compareTo(Unknown Source) at TreeNode.compareTo(TreeNode.java:16) at BinarySearchTree.myComparision(BinarySearchTree.java:177) at main.main(main.java:14) Here is my class for creating the nodes: public class TreeNode<T> implements Comparable { protected TreeNode<T> left, right; protected Object element; public TreeNode(Object obj) { element=obj; left=null; right=null; } public int compareTo(Object node) { return ((Comparable) this.element).compareTo(node); } } Am I doing the compareTo method all wrong? I would like to create trees that can handle integers and strings (seperatly of course)

    Read the article

  • Parse JSON into a ListView friendly output

    - by Thomas McDonald
    So I have this JSON, which then my activity retrieves to a string: {"popular": {"authors_last_month": [ { "url":"http://activeden.net/user/OXYLUS", "item":"OXYLUS", "sales":"1148", "image":"http://s3.envato.com/files/15599.jpg" }, { "url":"http://activeden.net/user/digitalscience", "item":"digitalscience", "sales":"681", "image":"http://s3.envato.com/files/232005.jpg" } { ... } ], "items_last_week": [ { "cost":"4.00", "thumbnail":"http://s3.envato.com/files/227943.jpg", "url":"http://activeden.net/item/christmas-decoration-balls/75682", "sales":"43", "item":"Christmas Decoration Balls", "rating":"3", "id":"75682" }, { "cost":"30.00", "thumbnail":"http://s3.envato.com/files/226221.jpg", "url":"http://activeden.net/item/xml-flip-book-as3/63869", "sales":"27", "item":"XML Flip Book / AS3", "rating":"5", "id":"63869" }, { ... }], "items_last_three_months": [ { "cost":"5.00", "thumbnail":"http://s3.envato.com/files/195638.jpg", "url":"http://activeden.net/item/image-logo-shiner-effect/55085", "sales":"641", "item":"image logo shiner effect", "rating":"5", "id":"55085" }, { "cost":"15.00", "thumbnail":"http://s3.envato.com/files/180749.png", "url":"http://activeden.net/item/banner-rotator-with-auto-delay-time/22243", "sales":"533", "item":"BANNER ROTATOR with Auto Delay Time", "rating":"5", "id":"22243"}, { ... }] } } It can be accessed here as well, although it because it's quite a long string, I've trimmed the above down to display what is needed. Basically, I want to be able to access the items from "items_last_week" and create a list of them - originally my plan was to have the 'thumbnail' on the left with the 'item' next to it, but from playing around with the SDK today it appears too difficult or impossible to achieve this, so I would be more than happy with just having the 'item' data from 'items_last_week' in the list. Coming from php I'm struggling to use any of the JSON libraries which are available to Java, as it appears to be much more than a line of code which I will need to deserialize (I think that's the right word) the JSON, and they all appear to require some form of additional class, apart from the JSONArray/JSONObject script I have which doesn't like the fact that items_last_week is nested (again, I think that's the JSON terminology) and takes an awful long time to run on the Android emulator. So, in effect, I need a (preferably simple) way to pass the items_last_week data to a ListView. I understand I will need a custom adapter which I can probably get my head around but I cannot understand, no matter how much of the day I've just spent trying to figure it out, how to access certain parts of a JSON string..

    Read the article

  • How to parse json data from https client in android

    - by Madhan Shanmugam
    I try to fetch data from https client. Same code i used to fetch from http client. but its working fine. when i try to use Https client its not working. i am getting the following error. java.net.UnknownHostException: Host is unresolved: https client address:443 Error Log: 10-27 10:01:08.280: W/System.err(21826): java.net.UnknownHostException: Host is unresolved: https client address.com 443 10-27 10:01:08.290: W/System.err(21826): at java.net.Socket.connect(Socket.java:1037) 10-27 10:01:08.290: W/System.err(21826): at org.apache.http.conn.ssl.SSLSocketFactory.connectSocket(SSLSocketFactory.java:317) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.DefaultClientConnectionOperator.openConnection(DefaultClientConnectionOperator.java:129) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPoolEntry.open(AbstractPoolEntry.java:164) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPooledConnAdapter.open(AbstractPooledConnAdapter.java:119) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.DefaultRequestDirector.execute(DefaultRequestDirector.java:348) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:555) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:487) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:465) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.JSONParser.getJSONFromUrl(JSONParser.java:38) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.myfile.processThread(myfile.java:159) 10-27 10:01:08.330: W/System.err(21826): at com.peripay.PERIPay$1$1.run(myfile.java:65) 10-27 10:01:08.330: E/Buffer Error(21826): Error converting result java.lang.NullPointerException 10-27 10:01:08.330: E/JSON Parser(21826): Error parsing data org.json.JSONException: A JSONObject text must begin with '{' at character 0 of

    Read the article

  • How to parse a url string using mvc2 routes

    - by Lavinski
    If I have a url http://www.site.com/controllerA/actionB/idC how can i extract the RouteValueDictionary where the item with the key controller would have the value of controllerA. Note this isn't for testing so I don't want to use mocking and the solution here does not seem to be working.

    Read the article

  • Dynamic expression tree how to

    - by Savvas Sopiadis
    Hello everybody! Implemented a generic repository with several Methods. One of those is this: public IEnumerable<T> Find(Expression<Func<T, bool>> where) { return _objectSet.Where(where); } Given to be it is easy to call this like this: Expression<Func<Culture, bool>> whereClause = c => c.CultureId > 4 ; return cultureRepository.Find(whereClause).AsQueryable(); But now i see (realize) that this kind of quering is "limiting only to one criteria". What i would like to do is this: in the above example c is of type Culture. Culture has several properties like CultureId, Name, Displayname,... How would i express the following: CultureId 4 and Name.contains('de') and in another execution Name.contains('us') and Displayname.contains('ca') and .... Those queries should be created dynamically. I had a look in Expression trees (as i thought this to be a solution to my problem - btw i never used them before) but i cannot find anything which points to my requirement. How can this be costructed? Thanks in advance

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to parse text as JavaScript?

    - by Danjah
    This question of mine (currently unanswered), drove me toward finding a better solution to what I'm attempting. My requirements: chunks of code which can be arbitrarily added into a document, without an identifier: [div class="thing"] [elements... /] [/div] the objects are scanned for and found by an external script: var things = yd.getElementsBy(function(el){ return yd.hasClass('thing'); },null,document ); the objects must be individually configurable, what I have currently is identifier-based: [div class="thing" id="thing0"] [elements... /] [script type="text/javascript"] new Thing().init({ id:'thing0'; }); [/script] [/div] So I need to ditch the identifier (id="thing0") so there are no duplicates when more than one chunk of the same code is added to a page I still need to be able to config these objects individually, without an identifier SO! All of that said, I wondered about creating a dynamic global variable within the script block of each added chunk of code, within its script tag. As each 'thing' is found, I figure it would be legit to grab the innerHTML of the script tag and somehow convert that text into a useable JS object. Discuss. Ok, don't discuss if you like, but if you get the drift then feel free to correct my wayward thinking or provide a better solution - please! d

    Read the article

  • [Android] Force close when trying to parse JSON with AsyncTask in the background

    - by robs
    Hello everyone, i'm new to android development and i'm playing around with json data. I managed to get the parsing to work. I want to show a ProgressDialog and i read that i need to use AsyncTask that. But for some reason i get a force close as soon as i put the same working code inside doInBackground() eventhough eclipse says everything is fine. Here is the source code: public class HomeActivity extends Activity { public class BackgroundAsyncTask extends AsyncTask<Void, Integer, Void> { ProgressDialog dialog = new ProgressDialog (HomeActivity.this); @Override protected void onPreExecute() { dialog.setMessage("Loading...please wait"); dialog.setIndeterminate(true); dialog.setCancelable(false); dialog.show(); } protected void onPostExecute() { dialog.dismiss(); } @Override protected Void doInBackground(Void... params) { try { URL json = new URL("http://www.corps-marchia.de/jsontest.php"); URLConnection tc = json.openConnection(); BufferedReader in = new BufferedReader(new InputStreamReader(tc.getInputStream())); String line; while ((line = in.readLine()) != null) { JSONArray ja = new JSONArray(line); JSONObject jo = (JSONObject) ja.get(0); TextView txtView = (TextView)findViewById(R.id.TextView01); txtView.setText(jo.getString("text")); } } catch (MalformedURLException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (JSONException e) { e.printStackTrace(); } return null; } } @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); new BackgroundAsyncTask().execute(); } } Here is the error log: 01-08 12:33:48.225: ERROR/AndroidRuntime(815): FATAL EXCEPTION: AsyncTask #1 01-08 12:33:48.225: ERROR/AndroidRuntime(815): java.lang.RuntimeException: An error occured while executing doInBackground() 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.os.AsyncTask$3.done(AsyncTask.java:200) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerSetException(FutureTask.java:274) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask.setException(FutureTask.java:125) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:308) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask.run(FutureTask.java:138) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1088) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:581) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.lang.Thread.run(Thread.java:1019) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): Caused by: android.view.ViewRoot$CalledFromWrongThreadException: Only the original thread that created a view hierarchy can touch its views. 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.ViewRoot.checkThread(ViewRoot.java:2932) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.ViewRoot.requestLayout(ViewRoot.java:629) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.checkForRelayout(TextView.java:5521) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2724) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2592) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2567) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.doInBackground(HomeActivity.java:52) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.doInBackground(HomeActivity.java:1) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.os.AsyncTask$2.call(AsyncTask.java:185) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:306) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): ... 4 more 01-08 12:33:51.605: ERROR/WindowManager(815): Activity net.ajzele.demo.andy1.HomeActivity has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@4051d0c0 that was originally added here 01-08 12:33:51.605: ERROR/WindowManager(815): android.view.WindowLeaked: Activity net.ajzele.demo.andy1.HomeActivity has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@4051d0c0 that was originally added here 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.ViewRoot.<init>(ViewRoot.java:258) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:148) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:91) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.Window$LocalWindowManager.addView(Window.java:424) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.Dialog.show(Dialog.java:241) 01-08 12:33:51.605: ERROR/WindowManager(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.onPreExecute(HomeActivity.java:33) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.AsyncTask.execute(AsyncTask.java:391) 01-08 12:33:51.605: ERROR/WindowManager(815): at net.ajzele.demo.andy1.HomeActivity.onCreate(HomeActivity.java:72) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1047) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1586) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1638) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.access$1500(ActivityThread.java:117) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:928) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.Handler.dispatchMessage(Handler.java:99) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.Looper.loop(Looper.java:123) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.main(ActivityThread.java:3647) 01-08 12:33:51.605: ERROR/WindowManager(815): at java.lang.reflect.Method.invokeNative(Native Method) 01-08 12:33:51.605: ERROR/WindowManager(815): at java.lang.reflect.Method.invoke(Method.java:507) 01-08 12:33:51.605: ERROR/WindowManager(815): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:839) 01-08 12:33:51.605: ERROR/WindowManager(815): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:597) 01-08 12:33:51.605: ERROR/WindowManager(815): at dalvik.system.NativeStart.main(Native Method) Any hints? I hope you can help me out ive searched the net and didnt find any working solution...Thanks in advance

    Read the article

  • QT clicked signal dosnt work on QStandardItemModel with tree view

    - by user63898
    Hello i have this code in QT and all i want to to catch the clicked event when some one clicking in one of the treeview rows without success here is my code: (parant is the qMmainwindow) m_model = new QStandardItemModel(0, 5, parent); // then later in the code i have proxyModel = new QSortFilterProxyModel; proxyModel->setDynamicSortFilter(true); setSourceModel(createMailModel(parent)); ui.treeView->setModel(proxyModel); ui.treeView->setSortingEnabled(true); ui.treeView->sortByColumn(4, Qt::DescendingOrder); // and my signal/slot looks like this but its not working //and im not getting eny clicked event fired connect(ui.treeView,SIGNAL(Clicked(const QModelIndex& ) ), this,SLOT( treeViewSelectedRow(const QModelIndex& ) ) ); also how can i debug QT signal/slots so i can see some debug massages printing when something is wrong ?

    Read the article

  • Output of ZipArchive() in tree format

    - by moustafa
    i have this list of files i get it by new ZipArchive(); i mean its in zip file now ths files docs/ docs/INSTALL.html docs/auth_api.html docs/corners_right.gif docs/corners_right.png docs/COPYING docs/corners_left.png docs/bg_header.gif docs/CHANGELOG.html docs/coding-guidelines.html docs/hook_system.html docs/FAQ.html docs/site_logo.gif docs/AUTHORS docs/README.html docs/corners_left.gif docs/stylesheet.css docs/New Folder/ docs/New Folder/New Text Document.txt docs/New Folder/New Folder/ i want code cut dir name from file and make it sub catgory i want it this docs/ INSTALL.html auth_api.html corners_right.gif corners_right.png COPYING New Folder/ New Text Document.txt New Folder/ New Folder/ I hope it's not impossible

    Read the article

  • jQuery Autocomplete fetch and parse data source with custom function, except not

    - by Ben Dauphinee
    So, I am working with the jQuery Autocomplete function, and am trying to write a custom data parser. Not sure what I am doing incorrectly, but it throws an error on trying to call the autocompleteSourceParse function, saying that req is not set. setURL("ajax/clients/ac"); function autocompleteSourceParse(req, add){ var suggestions = []; $.getJSON(getURL()+"/"+req, function(data){ $.each(data, function(i, val){ suggestions.push(val.name); }); add(suggestions); }); return(suggestions); } $("#company").autocomplete({ source: autocompleteSourceParse(req, add), minLength: 2 });

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 45 46 47 48 49 50 51 52 53 54 55 56  | Next Page >