Search Results

Search found 25049 results on 1002 pages for 'dev null'.

Page 521/1002 | < Previous Page | 517 518 519 520 521 522 523 524 525 526 527 528  | Next Page >

  • Animation issue caused by C# parameters passed by reference rather than value, but where?

    - by Jordan Roher
    I'm having trouble with sprite animation in XNA that appears to be caused by a struct passed as a reference value. But I'm not using the ref keyword anywhere. I am, admittedly, a C# noob, so there may be some shallow bonehead error in here, but I can't see it. I'm creating 10 ants or bees and animating them as they move across the screen. I have an array of animation structs, and each time I create an ant or bee, I send it the animation array value it requires (just [0] or [1] at this time). Deep inside the animation struct is a timer that is used to change frames. The ant/bee class stores the animation struct as a private variable. What I'm seeing is that each ant or bee uses the same animation struct, the one I thought I was passing in and copying by value. So during Update(), when I advance the animation timer for each ant/bee, the next ant/bee has its animation timer advanced by that small amount. If there's 1 ant on screen, it animates properly. 2 ants, it runs twice as fast, and so on. Obviously, not what I want. Here's an abridged version of the code. How is BerryPicking's ActorAnimationGroupData[] getting shared between the BerryCreatures? class BerryPicking { private ActorAnimationGroupData[] animations; private BerryCreature[] creatures; private Dictionary<string, Texture2D> creatureTextures; private const int maxCreatures = 5; public BerryPickingExample() { this.creatures = new BerryCreature[maxCreatures]; this.creatureTextures = new Dictionary<string, Texture2D>(); } public void LoadContent() { // Returns data from an XML file Reader reader = new Reader(); animations = reader.LoadAnimations(); CreateCreatures(); } // This is called from another function I'm not including because it's not relevant to the problem. // In it, I remove any creature that passes outside the viewport by setting its creatures[] spot to null. // Hence the if(creatures[i] == null) test is used to recreate "dead" creatures. Inelegant, I know. private void CreateCreatures() { for (int i = 0; i < creatures.Length; i++) { if (creatures[i] == null) { // In reality, the name selection is randomized creatures[i] = new BerryCreature("ant"); // Load content and texture (which I create elsewhere) creatures[i].LoadContent( FindAnimation(creatures[i].Name), creatureTextures[creatures[i].Name]); } } } private ActorAnimationGroupData FindAnimation(string animationName) { int yourAnimation = -1; for (int i = 0; i < animations.Length; i++) { if (animations[i].name == animationName) { yourAnimation = i; break; } } return animations[yourAnimation]; } public void Update(GameTime gameTime) { for (int i = 0; i < creatures.Length; i++) { creatures[i].Update(gameTime); } } } class Reader { public ActorAnimationGroupData[] LoadAnimations() { ActorAnimationGroupData[] animationGroup; XmlReader file = new XmlTextReader(filename); // Do loading... // Then later file.Close(); return animationGroup; } } class BerryCreature { private ActorAnimation animation; private string name; public BerryCreature(string name) { this.name = name; } public void LoadContent(ActorAnimationGroupData animationData, Texture2D sprite) { animation = new ActorAnimation(animationData); animation.LoadContent(sprite); } public void Update(GameTime gameTime) { animation.Update(gameTime); } } class ActorAnimation { private ActorAnimationGroupData animation; public ActorAnimation(ActorAnimationGroupData animation) { this.animation = animation; } public void LoadContent(Texture2D sprite) { this.sprite = sprite; } public void Update(GameTime gameTime) { animation.Update(gameTime); } } struct ActorAnimationGroupData { // There are lots of other members of this struct, but the timer is the only one I'm worried about. // TimerData is another struct private TimerData timer; public ActorAnimationGroupData() { timer = new TimerData(2); } public void Update(GameTime gameTime) { timer.Update(gameTime); } } struct TimerData { public float currentTime; public float maxTime; public TimerData(float maxTime) { this.currentTime = 0; this.maxTime = maxTime; } public void Update(GameTime gameTime) { currentTime += (float)gameTime.ElapsedGameTime.TotalSeconds; if (currentTime >= maxTime) { currentTime = maxTime; } } }

    Read the article

  • Connecting SceneBuilder edited FXML to Java code

    - by daniel
    Recently I had to answer several questions regarding how to connect an UI built with the JavaFX SceneBuilder 1.0 Developer Preview to Java Code. So I figured out that a short overview might be helpful. But first, let me state the obvious. What is FXML? To make it short, FXML is an XML based declaration format for JavaFX. JavaFX provides an FXML loader which will parse FXML files and from that construct a graph of Java object. It may sound complex when stated like that but it is actually quite simple. Here is an example of FXML file, which instantiate a StackPane and puts a Button inside it: -- <?xml version="1.0" encoding="UTF-8"?> <?import java.lang.*?> <?import java.util.*?> <?import javafx.scene.control.*?> <?import javafx.scene.layout.*?> <?import javafx.scene.paint.*?> <StackPane prefHeight="150.0" prefWidth="200.0" xmlns:fx="http://javafx.com/fxml"> <children> <Button mnemonicParsing="false" text="Button" /> </children> </StackPane> ... and here is the code I would have had to write if I had chosen to do the same thing programatically: import javafx.scene.control.*; import javafx.scene.layout.*; ... final Button button = new Button("Button"); button.setMnemonicParsing(false); final StackPane stackPane = new StackPane(); stackPane.setPrefWidth(200.0); stackPane.setPrefHeight(150.0); stacPane.getChildren().add(button); As you can see - FXML is rather simple to understand - as it is quite close to the JavaFX API. So OK FXML is simple, but why would I use it?Well, there are several answers to that - but my own favorite is: because you can make it with SceneBuilder. What is SceneBuilder? In short SceneBuilder is a layout tool that will let you graphically build JavaFX user interfaces by dragging and dropping JavaFX components from a library, and save it as an FXML file. SceneBuilder can also be used to load and modify JavaFX scenegraphs declared in FXML. Here is how I made the small FXML file above: Start the JavaFX SceneBuilder 1.0 Developer Preview In the Library on the left hand side, click on 'StackPane' and drag it on the content view (the white rectangle) In the Library, select a Button and drag it onto the StackPane on the content view. In the Hierarchy Panel on the left hand side - select the StackPane component, then invoke 'Edit > Trim To Selected' from the menubar That's it - you can now save, and you will obtain the small FXML file shown above. Of course this is only a trivial sample, made for the sake of the example - and SceneBuilder will let you create much more complex UIs. So, I have now an FXML file. But what do I do with it? How do I include it in my program? How do I write my main class? Loading an FXML file with JavaFX Well, that's the easy part - because the piece of code you need to write never changes. You can download and look at the SceneBuilder samples if you need to get convinced, but here is the short version: Create a Java class (let's call it 'Main.java') which extends javafx.application.Application In the same directory copy/save the FXML file you just created using SceneBuilder. Let's name it "simple.fxml" Now here is the Java code for the Main class, which simply loads the FXML file and puts it as root in a stage's scene. /* * Copyright (c) 2012, Oracle and/or its affiliates. All rights reserved. */ package simple; import java.util.logging.Level; import java.util.logging.Logger; import javafx.application.Application; import javafx.fxml.FXMLLoader; import javafx.scene.Scene; import javafx.scene.layout.StackPane; import javafx.stage.Stage; public class Main extends Application { /** * @param args the command line arguments */ public static void main(String[] args) { Application.launch(Main.class, (java.lang.String[])null); } @Override public void start(Stage primaryStage) { try { StackPane page = (StackPane) FXMLLoader.load(Main.class.getResource("simple.fxml")); Scene scene = new Scene(page); primaryStage.setScene(scene); primaryStage.setTitle("FXML is Simple"); primaryStage.show(); } catch (Exception ex) { Logger.getLogger(Main.class.getName()).log(Level.SEVERE, null, ex); } } } Great! Now I only have to use my favorite IDE to compile the class and run it. But... wait... what does it do? Well nothing. It just displays a button in the middle of a window. There's no logic attached to it. So how do we do that? How can I connect this button to my application logic? Here is how: Connection to code First let's define our application logic. Since this post is only intended to give a very brief overview - let's keep things simple. Let's say that the only thing I want to do is print a message on System.out when the user clicks on my button. To do that, I'll need to register an action handler with my button. And to do that, I'll need to somehow get a handle on my button. I'll need some kind of controller logic that will get my button and add my action handler to it. So how do I get a handle to my button and pass it to my controller? Once again - this is easy: I just need to write a controller class for my FXML. With each FXML file, it is possible to associate a controller class defined for that FXML. That controller class will make the link between the UI (the objects defined in the FXML) and the application logic. To each object defined in FXML we can associate an fx:id. The value of the id must be unique within the scope of the FXML, and is the name of an instance variable inside the controller class, in which the object will be injected. Since I want to have access to my button, I will need to add an fx:id to my button in FXML, and declare an @FXML variable in my controller class with the same name. In other words - I will need to add fx:id="myButton" to my button in FXML: -- <Button fx:id="myButton" mnemonicParsing="false" text="Button" /> and declare @FXML private Button myButton in my controller class @FXML private Button myButton; // value will be injected by the FXMLLoader Let's see how to do this. Add an fx:id to the Button object Load "simple.fxml" in SceneBuilder - if not already done In the hierarchy panel (bottom left), or directly on the content view, select the Button object. Open the Properties sections of the inspector (right panel) for the button object At the top of the section, you will see a text field labelled fx:id. Enter myButton in that field and validate. Associate a controller class with the FXML file Still in SceneBuilder, select the top root object (in our case, that's the StackPane), and open the Code section of the inspector (right hand side) At the top of the section you should see a text field labelled Controller Class. In the field, type simple.SimpleController. This is the name of the class we're going to create manually. If you save at this point, the FXML will look like this: -- <?xml version="1.0" encoding="UTF-8"?> <?import java.lang.*?> <?import java.util.*?> <?import javafx.scene.control.*?> <?import javafx.scene.layout.*?> <?import javafx.scene.paint.*?> <StackPane prefHeight="150.0" prefWidth="200.0" xmlns:fx="http://javafx.com/fxml" fx:controller="simple.SimpleController"> <children> <Button fx:id="myButton" mnemonicParsing="false" text="Button" /> </children> </StackPane> As you can see, the name of the controller class has been added to the root object: fx:controller="simple.SimpleController" Coding the controller class In your favorite IDE, create an empty SimpleController.java class. Now what does a controller class looks like? What should we put inside? Well - SceneBuilder will help you there: it will show you an example of controller skeleton tailored for your FXML. In the menu bar, invoke View > Show Sample Controller Skeleton. A popup appears, displaying a suggestion for the controller skeleton: copy the code displayed there, and paste it into your SimpleController.java: /** * Sample Skeleton for "simple.fxml" Controller Class * Use copy/paste to copy paste this code into your favorite IDE **/ package simple; import java.net.URL; import java.util.ResourceBundle; import javafx.fxml.FXML; import javafx.fxml.Initializable; import javafx.scene.control.Button; public class SimpleController implements Initializable { @FXML // fx:id="myButton" private Button myButton; // Value injected by FXMLLoader @Override // This method is called by the FXMLLoader when initialization is complete public void initialize(URL fxmlFileLocation, ResourceBundle resources) { assert myButton != null : "fx:id=\"myButton\" was not injected: check your FXML file 'simple.fxml'."; // initialize your logic here: all @FXML variables will have been injected } } Note that the code displayed by SceneBuilder is there only for educational purpose: SceneBuilder does not create and does not modify Java files. This is simply a hint of what you can use, given the fx:id present in your FXML file. You are free to copy all or part of the displayed code and paste it into your own Java class. Now at this point, there only remains to add our logic to the controller class. Quite easy: in the initialize method, I will register an action handler with my button: () { @Override public void handle(ActionEvent event) { System.out.println("That was easy, wasn't it?"); } }); ... -- ... // initialize your logic here: all @FXML variables will have been injected myButton.setOnAction(new EventHandler<ActionEvent>() { @Override public void handle(ActionEvent event) { System.out.println("That was easy, wasn't it?"); } }); ... That's it - if you now compile everything in your IDE, and run your application, clicking on the button should print a message on the console! Summary What happens is that in Main.java, the FXMLLoader will load simple.fxml from the jar/classpath, as specified by 'FXMLLoader.load(Main.class.getResource("simple.fxml"))'. When loading simple.fxml, the loader will find the name of the controller class, as specified by 'fx:controller="simple.SimpleController"' in the FXML. Upon finding the name of the controller class, the loader will create an instance of that class, in which it will try to inject all the objects that have an fx:id in the FXML. Thus, after having created '<Button fx:id="myButton" ... />', the FXMLLoader will inject the button instance into the '@FXML private Button myButton;' instance variable found on the controller instance. This is because The instance variable has an @FXML annotation, The name of the variable exactly matches the value of the fx:id Finally, when the whole FXML has been loaded, the FXMLLoader will call the controller's initialize method, and our code that registers an action handler with the button will be executed. For a complete example, take a look at the HelloWorld SceneBuilder sample. Also make sure to follow the SceneBuilder Get Started guide, which will guide you through a much more complete example. Of course, there are more elegant ways to set up an Event Handler using FXML and SceneBuilder. There are also many different ways to work with the FXMLLoader. But since it's starting to be very late here, I think it will have to wait for another post. I hope you have enjoyed the tour! --daniel

    Read the article

  • migrating from Prototype to jQuery in Rails, having trouble with duplicate get request

    - by aressidi
    I'm in the process of migrating from Prototype to jQuery and moving all JS outside of the view files. All is going fairly well with one exception. Here's what I'm trying to do, and the problem I'm having. I have a diary where users can update records in-line in the page like so: user clicks 'edit' link to edit an entry in the diary a get request is performed via jQuery and an edit form is displayed allowing the user to modify the record user updates the record, the form disappears and the updated record is shown in place of the form All of that works so far. The problem arises when: user updates a record user clicks 'edit' to update another record in this case, the edit form is shown twice! In firebug I get a status code 200 when the form shows, and then moments later, another edit form shows again with a status code of 304 I only want the form to show once, not twice. The form shows twice only after I update a record, otherwise everything works fine. Here's the code, any ideas? I think this might have to do with the fact that in food_item_update.js I call the editDiaryEntry() after a record is updated, but if I don't call that function and try and update the record after it's been modified, then it just spits up the .js.erb response on the screen. That's also why I have the editDiaryEntry() in the add_food.js.erb file. Any help would be greatly appreciated. diary.js jQuery(document).ready(function() { postFoodEntry(); editDiaryEntry(); initDatePicker(); }); function postFoodEntry() { jQuery('form#add_entry').submit(function(e) { e.preventDefault(); jQuery.post(this.action, jQuery(this).serialize(), null, "script"); // return this }); } function editDiaryEntry() { jQuery('.edit_link').click(function(e) { e.preventDefault(); // This should look to see if one version of this is open... if (jQuery('#edit_container_' + this.id).length == 0 ) { jQuery.get('/diary/entry/edit', {id: this.id}, null, "script"); } }); } function closeEdit () { jQuery('.close_edit').click(function(e) { e.preventDefault(); jQuery('.entry_edit_container').remove(); jQuery("#entry_" + this.id).show(); }); } function updateDiaryEntry() { jQuery('.edit_entry_form').submit(function(e) { e.preventDefault(); jQuery.post(this.action, $(this).serialize(), null, "script"); }); } function initDatePicker() { jQuery("#date, #edit_date").datepicker(); }; add_food.js.erb jQuery("#entry_alert").show(); jQuery('#add_entry')[ 0 ].reset(); jQuery('#diary_entries').html("<%= escape_javascript(render :partial => 'members/diary/diary_entries', :object => @diary, :locals => {:record_counter => 0, :date_header => 0, :edit_mode => @diary_edit}, :layout => false ) %>"); jQuery('#entry_alert').html("<%= escape_javascript(render :partial => 'members/diary/entry_alert', :locals => {:type => @type, :message => @alert_message}) %>"); jQuery('#entry_alert').show(); setTimeout(function() { jQuery('#entry_alert').fadeOut('slow'); }, 5000); editDiaryEntry(); food_item_edit.js.erb jQuery("#entry_<%= @entry.id %>").hide(); jQuery("#entry_<%= @entry.id %>").after("<%= escape_javascript(render :partial => 'members/diary/food_item_edit', :locals => {:user_food_profile => @entry}) %>"); closeEdit(); updateDiaryEntry(); initDatePicker(); food_item_update.js jQuery("#entry_<%= @entry.id %>").replaceWith("<%= escape_javascript(render :partial => 'members/diary/food_item', :locals => {:entry => @entry, :total_calories => 0}) %>"); jQuery('.entry_edit_container').remove(); editDiaryEntry();

    Read the article

  • Displaylink USB show "Logo / Loading" on monitor

    - by Ken Le
    I tried with this problem for 2 years already. LOL, today, I install Ubuntu for I have to resolve it or I will back to stupid Windows 7. First, I have 3 monitors. My graphic card is support dual ( ATI Radeon ), so I have no problem on extend those multi monitor on VGA and DVI. The 3rd monitor is Displaylink USB. After installed everything required, when I reboot, the displaylink monitor show "Ubuntu ...." like logo / loading screen. I go to System Display , Detect monitor, it only show my 1st and 2nd, NO 3RD Displaylink. I can move my mouse between those 1st & 2nd, but the 3rd is only show the Ubuntu Screen. I press Ctrl+Alt+1, then screen switch to Displaylink USB 3RD monitor, but its "Terminal" not a desktop. Then I press Ctrl+Alt+7 , the screen switch back to my 1st, 2nd, and the displaylink 3rd is witch back to Logo / Ubuntu again. This is my /etc/X11/xorg.conf : Section "ServerLayout" Identifier "X.org Configured" Screen 0 "aticonfig-Screen[0]-0" 0 0 Screen 1 "DisplayLinkScreen" Leftof "aticonfig-Screen[0]-0" InputDevice "Mouse0" "CorePointer" InputDevice "Keyboard0" "CoreKeyboard" EndSection Section "Files" ModulePath "/usr/lib/xorg/modules" FontPath "/usr/share/fonts/X11/misc" FontPath "/usr/share/fonts/X11/cyrillic" FontPath "/usr/share/fonts/X11/100dpi/:unscaled" FontPath "/usr/share/fonts/X11/75dpi/:unscaled" FontPath "/usr/share/fonts/X11/Type1" FontPath "/usr/share/fonts/X11/100dpi" FontPath "/usr/share/fonts/X11/75dpi" FontPath "/var/lib/defoma/x-ttcidfont-conf.d/dirs/TrueType" FontPath "built-ins" EndSection Section "Module" Load "glx" Load "dri2" Load "dbe" Load "dri" Load "record" Load "extmod" EndSection Section "InputDevice" Identifier "Keyboard0" Driver "kbd" EndSection Section "InputDevice" Identifier "Mouse0" Driver "mouse" Option "Protocol" "auto" Option "Device" "/dev/input/mice" Option "ZAxisMapping" "4 5 6 7" EndSection Section "Monitor" Identifier "aticonfig-Monitor[0]-0" Option "VendorName" "ATI Proprietary Driver" Option "ModelName" "Generic Autodetecting Monitor" Option "DPMS" "true" EndSection Section "Monitor" Identifier "DisplayLinkMonitor" EndSection Section "Monitor" Identifier "0-DFP1" Option "VendorName" "ATI Proprietary Driver" Option "ModelName" "Generic Autodetecting Monitor" Option "DPMS" "true" Option "PreferredMode" "1680x1050" Option "TargetRefresh" "60" Option "Position" "0 0" Option "Rotate" "normal" Option "Disable" "false" EndSection Section "Monitor" Identifier "0-CRT2" Option "VendorName" "ATI Proprietary Driver" Option "ModelName" "Generic Autodetecting Monitor" Option "DPMS" "true" Option "PreferredMode" "1920x1080" Option "TargetRefresh" "60" Option "Position" "1680 0" Option "Rotate" "normal" Option "Disable" "false" EndSection Section "Device" ### Available Driver options are:- ### Values: <i>: integer, <f>: float, <bool>: "True"/"False", ### <string>: "String", <freq>: "<f> Hz/kHz/MHz", ### <percent>: "<f>%" ### [arg]: arg optional #Option "NoAccel" # [<bool>] #Option "SWcursor" # [<bool>] #Option "Dac6Bit" # [<bool>] #Option "Dac8Bit" # [<bool>] #Option "BusType" # [<str>] #Option "CPPIOMode" # [<bool>] #Option "CPusecTimeout" # <i> #Option "AGPMode" # <i> #Option "AGPFastWrite" # [<bool>] #Option "AGPSize" # <i> #Option "GARTSize" # <i> #Option "RingSize" # <i> #Option "BufferSize" # <i> #Option "EnableDepthMoves" # [<bool>] #Option "EnablePageFlip" # [<bool>] #Option "NoBackBuffer" # [<bool>] #Option "DMAForXv" # [<bool>] #Option "FBTexPercent" # <i> #Option "DepthBits" # <i> #Option "PCIAPERSize" # <i> #Option "AccelDFS" # [<bool>] #Option "IgnoreEDID" # [<bool>] #Option "CustomEDID" # [<str>] #Option "DisplayPriority" # [<str>] #Option "PanelSize" # [<str>] #Option "ForceMinDotClock" # <freq> #Option "ColorTiling" # [<bool>] #Option "VideoKey" # <i> #Option "RageTheatreCrystal" # <i> #Option "RageTheatreTunerPort" # <i> #Option "RageTheatreCompositePort" # <i> #Option "RageTheatreSVideoPort" # <i> #Option "TunerType" # <i> #Option "RageTheatreMicrocPath" # <str> #Option "RageTheatreMicrocType" # <str> #Option "ScalerWidth" # <i> #Option "RenderAccel" # [<bool>] #Option "SubPixelOrder" # [<str>] #Option "ClockGating" # [<bool>] #Option "VGAAccess" # [<bool>] #Option "ReverseDDC" # [<bool>] #Option "LVDSProbePLL" # [<bool>] #Option "AccelMethod" # <str> #Option "DRI" # [<bool>] #Option "ConnectorTable" # <str> #Option "DefaultConnectorTable" # [<bool>] #Option "DefaultTMDSPLL" # [<bool>] #Option "TVDACLoadDetect" # [<bool>] #Option "ForceTVOut" # [<bool>] #Option "TVStandard" # <str> #Option "IgnoreLidStatus" # [<bool>] #Option "DefaultTVDACAdj" # [<bool>] #Option "Int10" # [<bool>] #Option "EXAVSync" # [<bool>] #Option "ATOMTVOut" # [<bool>] #Option "R4xxATOM" # [<bool>] #Option "ForceLowPowerMode" # [<bool>] #Option "DynamicPM" # [<bool>] #Option "NewPLL" # [<bool>] #Option "ZaphodHeads" # <str> Identifier "Card0" Driver "radeon" BusID "PCI:5:0:0" EndSection Section "Device" ### Available Driver options are:- ### Values: <i>: integer, <f>: float, <bool>: "True"/"False", ### <string>: "String", <freq>: "<f> Hz/kHz/MHz", ### <percent>: "<f>%" ### [arg]: arg optional #Option "ShadowFB" # [<bool>] #Option "Rotate" # <str> #Option "fbdev" # <str> #Option "debug" # [<bool>] Identifier "Card1" Driver "fbdev" BusID "PCI:5:0:0" EndSection Section "Device" ### Available Driver options are:- ### Values: <i>: integer, <f>: float, <bool>: "True"/"False", ### <string>: "String", <freq>: "<f> Hz/kHz/MHz", ### <percent>: "<f>%" ### [arg]: arg optional #Option "ShadowFB" # [<bool>] #Option "DefaultRefresh" # [<bool>] #Option "ModeSetClearScreen" # [<bool>] Identifier "Card2" Driver "vesa" BusID "PCI:5:0:0" EndSection Section "Device" Identifier "aticonfig-Device[0]-0" Driver "fglrx" Option "Monitor-DFP1" "0-DFP1" Option "Monitor-CRT2" "0-CRT2" BusID "PCI:5:0:0" EndSection Section "Device" Identifier "DisplayLinkDevice" Driver "displaylink" Option "fbdev" "/dev/fb1" Option "ShadowFB" "off" EndSection Section "Screen" Identifier "aticonfig-Screen[0]-0" Device "aticonfig-Device[0]-0" DefaultDepth 24 SubSection "Display" Viewport 0 0 Virtual 3600 1920 Depth 24 EndSubSection EndSection Section "Screen" Identifier "DisplayLinkScreen" Device "DisplayLinkDevice" Monitor "DisplayLinkMonitor" DefaultDepth 24 SubSection "Display" Depth 24 Modes "1920x1080" EndSubSection EndSection

    Read the article

  • Access Violation

    - by Justin
    I've been learning how to NOP functions in C++ or even C but there are very few tutorials online about it. I've been googling for the past few hours now and I'm just stuck. Here is my code. #include <iostream> #include <windows.h> #include <tlhelp32.h> using namespace std; //#define NOP 0x90 byte NOP[] = {0x90}; void enableDebugPrivileges() { HANDLE hcurrent=GetCurrentProcess(); HANDLE hToken; BOOL bret=OpenProcessToken(hcurrent,40,&hToken); LUID luid; bret=LookupPrivilegeValue(NULL,"SeDebugPrivilege",&luid); TOKEN_PRIVILEGES NewState,PreviousState; DWORD ReturnLength; NewState.PrivilegeCount =1; NewState.Privileges[0].Luid =luid; NewState.Privileges[0].Attributes=2; AdjustTokenPrivileges(hToken,FALSE,&NewState,28,&PreviousState,&ReturnLength); } DWORD GetProcId(char* ProcName) { PROCESSENTRY32 pe32; HANDLE hSnapshot = NULL; pe32.dwSize = sizeof( PROCESSENTRY32 ); hSnapshot = CreateToolhelp32Snapshot( TH32CS_SNAPPROCESS, 0 ); if( Process32First( hSnapshot, &pe32 ) ) { do{ if( strcmp( pe32.szExeFile, ProcName ) == 0 ) break; }while( Process32Next( hSnapshot, &pe32 ) ); } if( hSnapshot != INVALID_HANDLE_VALUE ) CloseHandle( hSnapshot ); return pe32.th32ProcessID; } void WriteMem(DWORD Address, void* Value, size_t Size) { DWORD Protect = NULL; VirtualProtect((LPVOID)Address, 3, PAGE_READWRITE, &Protect); memcpy((void*)Address, Value, 3); VirtualProtect((LPVOID)Address, 3, Protect, &Protect); } void nop_(PVOID address, int bytes){ DWORD d, ds; VirtualProtect(address, bytes, PAGE_EXECUTE_READWRITE, &d); memset(address, 144, bytes); VirtualProtect(address,bytes,d,&ds); } void MemCopy(HANDLE pHandle, void* Dest, const void* Src, int Len) { DWORD OldProtect; DWORD OldProtect2; VirtualProtect(Dest, Len, PAGE_EXECUTE_READWRITE, &OldProtect); memcpy(Dest, Src, Len); VirtualProtect(Dest, Len, OldProtect, &OldProtect2); FlushInstructionCache(pHandle, Dest, Len); } int main() { enableDebugPrivileges(); DWORD pid; HANDLE phandle; // Obtain the process ID pid = GetProcId("gr.exe"); if(GetLastError()) { cout << "Error_PID_: " << GetLastError() << endl; system("pause"); return -1; } // Obtain the process handle phandle = OpenProcess(PROCESS_ALL_ACCESS,0,pid); if(GetLastError()) { cout << "Error_HANDLE_: " << GetLastError() << endl; system("pause"); return -1; } // Debug info, 0 = bad cout <<"pid : " << pid << endl; cout <<"HANDLE: " << phandle << endl << endl; system("pause"); // Change value to short iValue = -1; int choice = 0; BYTE * bGodMode = (BYTE *) (0x409A7E); // Lives Address bool hack = true; while(hack) { system("cls"); cout << "What hack?\n0. Exit\n1. Lives\n\n!> "; cin >> choice; switch(choice) { case 0: { hack=false; break; } case 1: // Modify Time cout << "God Mode On\n!> "; // cin >> iValue; // nop_((PVOID)(0x409A7E), 3); // MemCopy(phandle, (PVOID)0x409A7E, &NOP, 1); WriteMem((DWORD)(0x00409A7E), (void*)NOP, sizeof NOP); if(GetLastError()) { cout << "Error: " << GetLastError() << endl; system("pause"); } break; default: cout << "ERROR!\n"; break; } Sleep(100); } system("pause"); return 0; } This is suppose to NOP the DEC function that is 3 bytes long preventing me from losing lives. However each time I try it, it crashes the hack and says I had a access violation. I tried to look up the reasons and most of them dealt with with the size of the location I'm writing to and what I'm copying from. Otherwise, I have absolutely no idea. Any help would be nice. The game is GunRoar and the base address "0x409A7E" is where the DEC function is.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Fluent NHibernate/SQL Server 2008 insert query problem

    - by Mark
    Hi all, I'm new to Fluent NHibernate and I'm running into a problem. I have a mapping defined as follows: public PersonMapping() { Id(p => p.Id).GeneratedBy.HiLo("1000"); Map(p => p.FirstName).Not.Nullable().Length(50); Map(p => p.MiddleInitial).Nullable().Length(1); Map(p => p.LastName).Not.Nullable().Length(50); Map(p => p.Suffix).Nullable().Length(3); Map(p => p.SSN).Nullable().Length(11); Map(p => p.BirthDate).Nullable(); Map(p => p.CellPhone).Nullable().Length(12); Map(p => p.HomePhone).Nullable().Length(12); Map(p => p.WorkPhone).Nullable().Length(12); Map(p => p.OtherPhone).Nullable().Length(12); Map(p => p.EmailAddress).Nullable().Length(50); Map(p => p.DriversLicenseNumber).Nullable().Length(50); Component<Address>(p => p.CurrentAddress, m => { m.Map(p => p.Line1, "Line1").Length(50); m.Map(p => p.Line2, "Line2").Length(50); m.Map(p => p.City, "City").Length(50); m.Map(p => p.State, "State").Length(50); m.Map(p => p.Zip, "Zip").Length(2); }); Map(p => p.EyeColor).Nullable().Length(3); Map(p => p.HairColor).Nullable().Length(3); Map(p => p.Gender).Nullable().Length(1); Map(p => p.Height).Nullable(); Map(p => p.Weight).Nullable(); Map(p => p.Race).Nullable().Length(1); Map(p => p.SkinTone).Nullable().Length(3); HasMany(p => p.PriorAddresses).Cascade.All(); } public PreviousAddressMapping() { Table("PriorAddress"); Id(p => p.Id).GeneratedBy.HiLo("1000"); Map(p => p.EndEffectiveDate).Not.Nullable(); Component<Address>(p => p.Address, m => { m.Map(p => p.Line1, "Line1").Length(50); m.Map(p => p.Line2, "Line2").Length(50); m.Map(p => p.City, "City").Length(50); m.Map(p => p.State, "State").Length(50); m.Map(p => p.Zip, "Zip").Length(2); }); } My test is [Test] public void can_correctly_map_Person_with_Addresses() { var myPerson = new Person("Jane", "", "Doe"); var priorAddresses = new[] { new PreviousAddress(ObjectMother.GetAddress1(), DateTime.Parse("05/13/2010")), new PreviousAddress(ObjectMother.GetAddress2(), DateTime.Parse("05/20/2010")) }; new PersistenceSpecification<Person>(Session) .CheckProperty(c => c.FirstName, myPerson.FirstName) .CheckProperty(c => c.LastName, myPerson.LastName) .CheckProperty(c => c.MiddleInitial, myPerson.MiddleInitial) .CheckList(c => c.PriorAddresses, priorAddresses) .VerifyTheMappings(); } GetAddress1() (yeah, horrible name) has Line2 == null The tables seem to be created correctly in sql server 2008, but the test fails with a SQLException "String or binary data would be truncated." When I grab the sql statement in SQL Profiler, I get exec sp_executesql N'INSERT INTO PriorAddress (Line1, Line2, City, State, Zip, EndEffectiveDate, Id) VALUES (@p0, @p1, @p2, @p3, @p4, @p5, @p6)',N'@p0 nvarchar(18),@p1 nvarchar(4000),@p2 nvarchar(10),@p3 nvarchar(2),@p4 nvarchar(5),@p5 datetime,@p6 int',@p0=N'6789 Somewhere Rd.',@p1=NULL,@p2=N'Hot Coffee',@p3=N'MS',@p4=N'09876',@p5='2010-05-13 00:00:00',@p6=1001 Notice the @p1 parameter is being set to nvarchar(4000) and being passed a NULL value. Why is it setting the parameter to nvarchar(4000)? How can I fix it? Thanks!

    Read the article

  • login form whith java/sqlite

    - by tuxou
    hi I would like to create a login form for my application with the possibility to add or remove users for an sqlite database, i have created the table users(nam, pass) but i can't unclud it in my login form, it someone could help me this is my login code: import java.awt.*; import java.awt.event.*; import javax.swing.*; public class login extends JFrame { // Variables declaration private JLabel jLabel1; private JLabel jLabel2; private JTextField jTextField1; private JPasswordField jPasswordField1; private JButton jButton1; private JPanel contentPane; // End of variables declaration public login() { super(); create(); this.setVisible(true); } private void create() { jLabel1 = new JLabel(); jLabel2 = new JLabel(); jTextField1 = new JTextField(); jPasswordField1 = new JPasswordField(); jButton1 = new JButton(); contentPane = (JPanel)this.getContentPane(); // // jLabel1 // jLabel1.setHorizontalAlignment(SwingConstants.LEFT); jLabel1.setForeground(new Color(0, 0, 255)); jLabel1.setText("username:"); // // jLabel2 // jLabel2.setHorizontalAlignment(SwingConstants.LEFT); jLabel2.setForeground(new Color(0, 0, 255)); jLabel2.setText("password:"); // // jTextField1 // jTextField1.setForeground(new Color(0, 0, 255)); jTextField1.setSelectedTextColor(new Color(0, 0, 255)); jTextField1.setToolTipText("Enter your username"); jTextField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jTextField1_actionPerformed(e); } }); // // jPasswordField1 // jPasswordField1.setForeground(new Color(0, 0, 255)); jPasswordField1.setToolTipText("Enter your password"); jPasswordField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jPasswordField1_actionPerformed(e); } }); // // jButton1 // jButton1.setBackground(new Color(204, 204, 204)); jButton1.setForeground(new Color(0, 0, 255)); jButton1.setText("Login"); jButton1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jButton1_actionPerformed(e); } }); // // contentPane // contentPane.setLayout(null); contentPane.setBorder(BorderFactory.createEtchedBorder()); contentPane.setBackground(new Color(204, 204, 204)); addComponent(contentPane, jLabel1, 5,10,106,18); addComponent(contentPane, jLabel2, 5,47,97,18); addComponent(contentPane, jTextField1, 110,10,183,22); addComponent(contentPane, jPasswordField1, 110,45,183,22); addComponent(contentPane, jButton1, 150,75,83,28); // // login // this.setTitle("Login To Members Area"); this.setLocation(new Point(76, 182)); this.setSize(new Dimension(335, 141)); this.setDefaultCloseOperation(WindowConstants.EXIT_ON_CLOSE); this.setResizable(false); } /** Add Component Without a Layout Manager (Absolute Positioning) */ private void addComponent(Container container,Component c,int x,int y,int width,int height) { c.setBounds(x,y,width,height); container.add(c); } private void jTextField1_actionPerformed(ActionEvent e) { } private void jPasswordField1_actionPerformed(ActionEvent e) { } private void jButton1_actionPerformed(ActionEvent e) { System.out.println("\njButton1_actionPerformed(ActionEvent e) called."); String username = new String(jTextField1.getText()); String password = new String(jPasswordField1.getText()); if(username.equals("") || password.equals("")) // If password and username is empty Do this { jButton1.setEnabled(false); JLabel errorFields = new JLabel("You must enter a username and password to login."); JOptionPane.showMessageDialog(null,errorFields); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); this.setVisible(true); } else { JLabel optionLabel = new JLabel("You entered "+username+" as your username. Is this correct?"); int confirm =JOptionPane.showConfirmDialog(null,optionLabel); switch(confirm){ // Switch Case case JOptionPane.YES_OPTION: // Attempt to Login user jButton1.setEnabled(false); // Set button enable to false to prevent 2 login attempts break; case JOptionPane.NO_OPTION: // No Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; case JOptionPane.CANCEL_OPTION: // Cancel Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; } // End Switch Case } } public static void main(String[] args) { JFrame.setDefaultLookAndFeelDecorated(true); JDialog.setDefaultLookAndFeelDecorated(true); try { UIManager.setLookAndFeel("com.sun.java.swing.plaf.windows.WindowsLookAndFeel"); } catch (Exception ex) { System.out.println("Failed loading L&F: "); System.out.println(ex); } new login(); }; }

    Read the article

  • SetWindowHookEx and execution blocking

    - by Kalaz
    Hello, I just wonder... I mainly use .NET but now I started to investigate WINAPI calls. For example I am using this piece of code to hook to the API functions. It starts freezing, when I try to debug the application... using System; using System.Diagnostics; using System.Runtime.InteropServices; using System.Threading; using System.Windows.Forms; public class Keyboard { private const int WH_KEYBOARD_LL = 13; private const int WM_KEYDOWN = 0x0100; private static LowLevelKeyboardProc _proc = HookCallback; private static IntPtr _hookID = IntPtr.Zero; public static event Action<Keys,bool, bool> KeyDown; public static void Hook() { new Thread(new ThreadStart(()=> { _hookID = SetHook(_proc); Application.Run(); })).Start(); } public static void Unhook() { UnhookWindowsHookEx(_hookID); } private static IntPtr SetHook(LowLevelKeyboardProc proc) { using (Process curProcess = Process.GetCurrentProcess()) using (ProcessModule curModule = curProcess.MainModule) { return SetWindowsHookEx(WH_KEYBOARD_LL, proc, GetModuleHandle(curModule.ModuleName), 0); } } private delegate IntPtr LowLevelKeyboardProc( int nCode, IntPtr wParam, IntPtr lParam); private static IntPtr HookCallback( int nCode, IntPtr wParam, IntPtr lParam) { if (nCode >= 0 && wParam == (IntPtr)WM_KEYDOWN) { int vkCode = Marshal.ReadInt32(lParam); Keys k = (Keys) vkCode; if (KeyDown != null) { KeyDown.BeginInvoke(k, IsKeyPressed(VirtualKeyStates.VK_CONTROL), IsKeyPressed(VirtualKeyStates.VK_SHIFT),null,null); } } return CallNextHookEx(_hookID, nCode, wParam, lParam); } private static bool IsKeyPressed(VirtualKeyStates virtualKeyStates) { return (GetKeyState(virtualKeyStates) & (1 << 7))==128; } [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr SetWindowsHookEx(int idHook, LowLevelKeyboardProc lpfn, IntPtr hMod, uint dwThreadId); [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] [return: MarshalAs(UnmanagedType.Bool)] private static extern bool UnhookWindowsHookEx(IntPtr hhk); [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr CallNextHookEx(IntPtr hhk, int nCode, IntPtr wParam, IntPtr lParam); [DllImport("kernel32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr GetModuleHandle(string lpModuleName); [DllImport("user32.dll")] static extern short GetKeyState(VirtualKeyStates nVirtKey); } enum VirtualKeyStates : int { VK_LBUTTON = 0x01, VK_RBUTTON = 0x02, VK_CANCEL = 0x03, VK_MBUTTON = 0x04, // VK_XBUTTON1 = 0x05, VK_XBUTTON2 = 0x06, // VK_BACK = 0x08, VK_TAB = 0x09, // VK_CLEAR = 0x0C, VK_RETURN = 0x0D, // VK_SHIFT = 0x10, VK_CONTROL = 0x11, VK_MENU = 0x12, VK_PAUSE = 0x13, VK_CAPITAL = 0x14, // VK_KANA = 0x15, VK_HANGEUL = 0x15, /* old name - should be here for compatibility */ VK_HANGUL = 0x15, VK_JUNJA = 0x17, VK_FINAL = 0x18, VK_HANJA = 0x19, VK_KANJI = 0x19, // VK_ESCAPE = 0x1B, // VK_CONVERT = 0x1C, VK_NONCONVERT = 0x1D, VK_ACCEPT = 0x1E, VK_MODECHANGE = 0x1F, // VK_SPACE = 0x20, VK_PRIOR = 0x21, VK_NEXT = 0x22, VK_END = 0x23, VK_HOME = 0x24, VK_LEFT = 0x25, VK_UP = 0x26, VK_RIGHT = 0x27, VK_DOWN = 0x28, VK_SELECT = 0x29, VK_PRINT = 0x2A, VK_EXECUTE = 0x2B, VK_SNAPSHOT = 0x2C, VK_INSERT = 0x2D, VK_DELETE = 0x2E, VK_HELP = 0x2F, // VK_LWIN = 0x5B, VK_RWIN = 0x5C, VK_APPS = 0x5D, // VK_SLEEP = 0x5F, // VK_NUMPAD0 = 0x60, VK_NUMPAD1 = 0x61, VK_NUMPAD2 = 0x62, VK_NUMPAD3 = 0x63, VK_NUMPAD4 = 0x64, VK_NUMPAD5 = 0x65, VK_NUMPAD6 = 0x66, VK_NUMPAD7 = 0x67, VK_NUMPAD8 = 0x68, VK_NUMPAD9 = 0x69, VK_MULTIPLY = 0x6A, VK_ADD = 0x6B, VK_SEPARATOR = 0x6C, VK_SUBTRACT = 0x6D, VK_DECIMAL = 0x6E, VK_DIVIDE = 0x6F, VK_F1 = 0x70, VK_F2 = 0x71, VK_F3 = 0x72, VK_F4 = 0x73, VK_F5 = 0x74, VK_F6 = 0x75, VK_F7 = 0x76, VK_F8 = 0x77, VK_F9 = 0x78, VK_F10 = 0x79, VK_F11 = 0x7A, VK_F12 = 0x7B, VK_F13 = 0x7C, VK_F14 = 0x7D, VK_F15 = 0x7E, VK_F16 = 0x7F, VK_F17 = 0x80, VK_F18 = 0x81, VK_F19 = 0x82, VK_F20 = 0x83, VK_F21 = 0x84, VK_F22 = 0x85, VK_F23 = 0x86, VK_F24 = 0x87, // VK_NUMLOCK = 0x90, VK_SCROLL = 0x91, // VK_OEM_NEC_EQUAL = 0x92, // '=' key on numpad // VK_OEM_FJ_JISHO = 0x92, // 'Dictionary' key VK_OEM_FJ_MASSHOU = 0x93, // 'Unregister word' key VK_OEM_FJ_TOUROKU = 0x94, // 'Register word' key VK_OEM_FJ_LOYA = 0x95, // 'Left OYAYUBI' key VK_OEM_FJ_ROYA = 0x96, // 'Right OYAYUBI' key // VK_LSHIFT = 0xA0, VK_RSHIFT = 0xA1, VK_LCONTROL = 0xA2, VK_RCONTROL = 0xA3, VK_LMENU = 0xA4, VK_RMENU = 0xA5, // VK_BROWSER_BACK = 0xA6, VK_BROWSER_FORWARD = 0xA7, VK_BROWSER_REFRESH = 0xA8, VK_BROWSER_STOP = 0xA9, VK_BROWSER_SEARCH = 0xAA, VK_BROWSER_FAVORITES = 0xAB, VK_BROWSER_HOME = 0xAC, // VK_VOLUME_MUTE = 0xAD, VK_VOLUME_DOWN = 0xAE, VK_VOLUME_UP = 0xAF, VK_MEDIA_NEXT_TRACK = 0xB0, VK_MEDIA_PREV_TRACK = 0xB1, VK_MEDIA_STOP = 0xB2, VK_MEDIA_PLAY_PAUSE = 0xB3, VK_LAUNCH_MAIL = 0xB4, VK_LAUNCH_MEDIA_SELECT = 0xB5, VK_LAUNCH_APP1 = 0xB6, VK_LAUNCH_APP2 = 0xB7, // VK_OEM_1 = 0xBA, // ';:' for US VK_OEM_PLUS = 0xBB, // '+' any country VK_OEM_COMMA = 0xBC, // ',' any country VK_OEM_MINUS = 0xBD, // '-' any country VK_OEM_PERIOD = 0xBE, // '.' any country VK_OEM_2 = 0xBF, // '/?' for US VK_OEM_3 = 0xC0, // '`~' for US // VK_OEM_4 = 0xDB, // '[{' for US VK_OEM_5 = 0xDC, // '\|' for US VK_OEM_6 = 0xDD, // ']}' for US VK_OEM_7 = 0xDE, // ''"' for US VK_OEM_8 = 0xDF, // VK_OEM_AX = 0xE1, // 'AX' key on Japanese AX kbd VK_OEM_102 = 0xE2, // "<>" or "\|" on RT 102-key kbd. VK_ICO_HELP = 0xE3, // Help key on ICO VK_ICO_00 = 0xE4, // 00 key on ICO // VK_PROCESSKEY = 0xE5, // VK_ICO_CLEAR = 0xE6, // VK_PACKET = 0xE7, // VK_OEM_RESET = 0xE9, VK_OEM_JUMP = 0xEA, VK_OEM_PA1 = 0xEB, VK_OEM_PA2 = 0xEC, VK_OEM_PA3 = 0xED, VK_OEM_WSCTRL = 0xEE, VK_OEM_CUSEL = 0xEF, VK_OEM_ATTN = 0xF0, VK_OEM_FINISH = 0xF1, VK_OEM_COPY = 0xF2, VK_OEM_AUTO = 0xF3, VK_OEM_ENLW = 0xF4, VK_OEM_BACKTAB = 0xF5, // VK_ATTN = 0xF6, VK_CRSEL = 0xF7, VK_EXSEL = 0xF8, VK_EREOF = 0xF9, VK_PLAY = 0xFA, VK_ZOOM = 0xFB, VK_NONAME = 0xFC, VK_PA1 = 0xFD, VK_OEM_CLEAR = 0xFE } It works well even if you put messagebox into the event or something that blocks execution. But it gets bad if you try to put breakpoint into the event. Why? I mean event is not run in the same thread that the windows hook is. That means that It shouldn't block HookCallback. It does however... I would really like to know why is this happening. My theory is that Visual Studio when breaking execution temporarily stops all threads and that means that HookCallback is blocked... Is there any book or valuable resource that would explain concepts behind all of this threading?

    Read the article

  • Application is crash..

    - by user338322
    Below is my crash Report. 0 0x326712f8 in prepareForMethodLookup () 1 0x3266cf5c in lookUpMethod () 2 0x32668f28 in objc_msgSend_uncached () 3 0x33f70996 in NSPopAutoreleasePool () 4 0x33f82a6c in -[NSAutoreleasePool drain] () 5 0x00003d3e in -[CameraViewcontroller save:] (self=0x811400, _cmd=0x319c00d4, number=0x11e210) at /Users/hardikrathore/Desktop/LiveVideoRecording/Classes/CameraViewcontroller.m:266 6 0x33f36f8a in __NSFireDelayedPerform () 7 0x32da44c2 in CFRunLoopRunSpecific () 8 0x32da3c1e in CFRunLoopRunInMode () 9 0x31bb9374 in GSEventRunModal () 10 0x30bf3c30 in -[UIApplication _run] () 11 0x30bf2230 in UIApplicationMain () 12 0x00002650 in main (argc=1, argv=0x2ffff474) at /Users/hardikrathore/Desktop/LiveVideoRecording/main.m:14 And this is the code. lines, where I am getting the error. -(void)save:(id)number { NSAutoreleasePool *pool = [[NSAutoreleasePool alloc] init]; j =[number intValue]; while(screens[j] != NULL){ NSLog(@" image made : %d",j); UIImage * image = [UIImage imageWithCGImage:screens[j]]; image=[self imageByCropping:image toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata = UIImageJPEGRepresentation(image,0.3); [image release]; CGImageRelease(screens[j]); screens[j] = NULL; UIImage * image1 = [UIImage imageWithCGImage:screens[j+1]]; image1=[self imageByCropping:image1 toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata1 = UIImageJPEGRepresentation(image1,0.3); [image1 release]; CGImageRelease(screens[j+1]); screens[j+1] = NULL; NSString *urlString=@"http://www.test.itmate4.com/iPhoneToServerTwice.php"; // setting up the request object now NSMutableURLRequest *request = [[NSMutableURLRequest alloc]init]; [request setURL:[NSURL URLWithString:urlString]]; [request setHTTPMethod:@"POST"]; NSString *fileName=[VideoID stringByAppendingString:@"_"]; fileName=[fileName stringByAppendingString:[NSString stringWithFormat:@"%d",k]]; NSString *fileName2=[VideoID stringByAppendingString:@"_"]; fileName2=[fileName2 stringByAppendingString:[NSString stringWithFormat:@"%d",k+1]]; /* add some header info now we always need a boundary when we post a file also we need to set the content type You might want to generate a random boundary.. this is just the same as my output from wireshark on a valid html post */ NSString *boundary = [NSString stringWithString:@"---------------------------14737809831466499882746641449"]; NSString *contentType = [NSString stringWithFormat:@"multipart/form-data; boundary=%@",boundary]; [request addValue:contentType forHTTPHeaderField: @"Content-Type"]; /* now lets create the body of the post */ //NSString *count=[NSString stringWithFormat:@"%d",front];; NSMutableData *body = [NSMutableData data]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; count=\"@\"";filename=\"%@.jpg\"\r\n",count,fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; filename=\"%@.jpg\"\r\n",fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata]]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //second boundary NSString *string1 = [[NSString alloc] initWithFormat:@"\r\n--%@\r\n",boundary]; NSString *string2 =[[NSString alloc] initWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2]; NSString *string3 =[[NSString alloc] initWithFormat:@"\r\n--%@--\r\n",boundary]; [body appendData:[string1 dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string2 dataUsingEncoding:NSUTF8StringEncoding]]; //experiment //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata1]]; //[body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string3 dataUsingEncoding:NSUTF8StringEncoding]]; // setting the body of the post to the reqeust [request setHTTPBody:body]; // now lets make the connection to the web NSData *returnData = [NSURLConnection sendSynchronousRequest:request returningResponse:nil error:nil]; NSString *returnString = [[NSString alloc] initWithData:returnData encoding:NSUTF8StringEncoding]; if([returnString isEqualToString:@"SUCCESS"]) { NSLog(returnString); k=k+2; j=j+2; [self performSelectorInBackground:@selector(save:) withObject:(id)[NSNumber numberWithInt:j]]; } //k=k+2; [imgdata release]; [imgdata1 release]; [NSThread sleepForTimeInterval:.01]; } [pool drain]; <-------------Line 266 } As you can see in log report. I am getting the error, Line 266. Some autorelease problem Any help !!!? coz I am not getting why its happening.

    Read the article

  • Javascript: Can't control parent of descendant nodes.

    - by .phjasper
    I'm creating elements (level 1) dynamically which in turn create elements (level 2) themselves. However, the children of level 2 elements have "body" as their parent. In the HTML code below, the content if spotAd2 is created by my function createNode(). It's a Google Ad Sense tag. However, the Google Ad Sense tag create elements that went directly under "body". I need them to by under spotAd2. function createNode( t, // type. tn, // if type is element, tag name. a, // if type is element, attributes. v, // node value or text content p, // parent f ) // whether to make dist the first child or not. { n = null; switch( t ) { case "element": n = document.createElement( tn ); if( a ) { for( k in a ) { n.setAttribute( k, a[ k ] ); } } break; case "text": case "cdata_section": case "comment": n = document.createTextNode(v); break; } if ( p ) { if( f ) { p.insertBefore( n, p.firstChild ); } else { p.appendChild( n ); } } return n; } spotAd2 = document.getElementById("spotAd2"); n1 = createNode("element", "div", {"id":"tnDiv1"}, "\n" , null, true); n2 = createNode("element", "script", {"type":"text\/javascript"}, "\n" , n1, false); n3 = createNode("comment", "", null, "\n" + "google_ad_client = \"pub-0321943928525350\";\n" + "/* 728x90 (main top) */\n" + "google_ad_slot = \"2783893649\";\n" + "google_ad_width = 728;\n" + "google_ad_height = 90;\n" + "//\n" , n2, false); n4 = createNode("element", "script", {"type":"text\/javascript","src":"http:\/\/pagead2.googlesyndication.com\/pagead\/show_ads.js"}, "\n" , n1, false); --- Result: <body> <table cellspacing="2" cellpadding="2" border="1"> <tbody><tr> <td>Oel ngati kemeie</td> <td>Kamakto niwin</td> </tr> <tr> <td>The ad:</td> <td> <div id="spotAd2"> <!-- Created by createNode() --> <div id="tnDiv1"> <script type="text/javascript"> google_ad_client = "pub-0321943928525350"; /* 728x90 (main top) */ google_ad_slot = "2783893649"; google_ad_width = 728; google_ad_height = 90; </script> <script type="text/javascript" src="http://pagead2.googlesyndication.com/pagead/show_ads.js"></script> </div> <!-- Created by createNode() --> </div> </td> </tr> <tr> <td>txopu ra'a tsi, tsamsiyu</td> <td>teyrakup skxawng</td> </tr> </tbody></table> <!-- Created by adsense tag, need these to be under tnDiv1 --> <script src="http://pagead2.googlesyndication.com/pagead/expansion_embed.js"></script> <script src="http://googleads.g.doubleclick.net/pagead/test_domain.js"></script> <script>google_protectAndRun("ads_core.google_render_ad", google_handleError, google_render_ad);</script> <ins style="border: medium none ; margin: 0pt; padding: 0pt; display: inline-table; height: 90px; position: relative; visibility: visible; width: 728px;"> <ins style="border: medium none ; margin: 0pt; padding: 0pt; display: block; height: 90px; position: relative; visibility: visible; width: 728px;"> <iframe width="728" scrolling="no" height="90" frameborder="0" vspace="0" style="left: 0pt; position: absolute; top: 0pt;" src="http://googleads.g.doubleclick.net/pagead/ads?client=ca-pub-0321943928525350&amp;output=html&amp;h=90&amp;slotname=2783893649&amp;w=728&amp;lmt=1273708979&amp;flash=10.0.45&amp;url=http%3A%2F%2Fkenshin.katanatechworks.com%2Ftest%2FadsBrowserSide.php&amp;dt=1273708980294&amp;shv=r20100422&amp;correlator=1273708980298&amp;frm=0&amp;ga_vid=695691836.1273708981&amp;ga_sid=1273708981&amp;ga_hid=1961182006&amp;ga_fc=0&amp;u_tz=480&amp;u_his=2&amp;u_java=1&amp;u_h=1080&amp;u_w=1920&amp;u_ah=1052&amp;u_aw=1920&amp;u_cd=24&amp;u_nplug=5&amp;u_nmime=38&amp;biw=1394&amp;bih=324&amp;fu=0&amp;ifi=1&amp;dtd=955&amp;xpc=Jl67G4xiq6&amp;p=http%3A//kenshin.katanatechworks.com" name="google_ads_frame" marginwidth="0" marginheight="0" id="google_ads_frame1" hspace="0" allowtransparency="true"> </iframe> </ins> </ins> <!-- Created by adsense tag, need these to be under tnDiv1 --> </body>

    Read the article

  • 12c - Silly little trick with invisibility...

    - by noreply(at)blogger.com (Thomas Kyte)
    This is interesting, if you hide and then unhide a column - it will end up at the "end" of the table.  Consider:ops$tkyte%ORA12CR1> create table t ( a int, b int, c int );Table created.ops$tkyte%ORA12CR1>ops$tkyte%ORA12CR1> desc t; Name                                                  Null?    Type ----------------------------------------------------- -------- ------------------------------------ A                                                              NUMBER(38) B                                                              NUMBER(38) C                                                              NUMBER(38)ops$tkyte%ORA12CR1> alter table t modify (a invisible);Table altered.ops$tkyte%ORA12CR1> alter table t modify (a visible);Table altered.ops$tkyte%ORA12CR1> desc t; Name                                                  Null?    Type ----------------------------------------------------- -------- ------------------------------------ B                                                              NUMBER(38) C                                                              NUMBER(38) A                                                              NUMBER(38)Now, that means you can add a column or shuffle them around.  What if we had just added A to the table and really really wanted A to be first.  My first approach would be "that is what editioning views are great at".  If I couldn't use an editioning view for whatever reason - we could shuffle the columns:ops$tkyte%ORA12CR1> alter table t modify (b invisible);Table altered.ops$tkyte%ORA12CR1> alter table t modify (c invisible);Table altered.ops$tkyte%ORA12CR1> alter table t modify (b visible);Table altered.ops$tkyte%ORA12CR1> alter table t modify (c visible);Table altered.ops$tkyte%ORA12CR1>ops$tkyte%ORA12CR1> desc t; Name                                                  Null?    Type ----------------------------------------------------- -------- ------------------------------------ A                                                              NUMBER(38) B                                                              NUMBER(38) C                                                              NUMBER(38)Note: that could cause some serious invalidations in your database - so make sure you are a) aware of that b) willing to pay that penalty and c) really really really want A to be first in the table!

    Read the article

  • Panel is not displaying in JFrame

    - by mallikarjun
    I created a chat panel and added to Jframe but the panel is not displaying. But my sop in the chat panel are displaying in the console. Any one please let me know what could be the problem My Frame public class MyFrame extends JFrame { MyPanel chatClient; String input; public MyFrame() { input = (String)JOptionPane.showInputDialog(null, "Name:", "Connect to chat server", JOptionPane.QUESTION_MESSAGE, null,null, "Test"); input=input.trim(); chatClient = new MyPanel("localhost",input); setVisible(true); setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); add(chatClient); } public static void main(String...args){ new MyFrame(); } } MyPanel: public class MyPanel extends JPanel{ ChatClient chatClient; public MyPanel(String host, String uid) { chatClient= new ChatClient(host,uid); add(chatClient.getChatPanel()); this.setVisible(true); } } chat panel: public class ChatClient { Client client; String name; ChatPanel chatPanel; String hostid; public ChatClient(String host,String uid){ client = new Client(); client.start(); System.out.println("in constructor"); Network.register(client); client.addListener(new Listener(){ public void connected(Connection connection){ System.out.println("in client connected method"); Network.RegisterName registerName = new Network.RegisterName(); registerName.name=name; client.sendTCP(registerName); } public void received(Connection connection,Object object){ System.out.println("in client received method"); if (object instanceof Network.UpdateNames) { Network.UpdateNames updateNames = (Network.UpdateNames)object; //chatFrame.setNames(updateNames.names); System.out.println("got it message"); return; } if (object instanceof Network.ChatMessage) { Network.ChatMessage chatMessage = (Network.ChatMessage)object; //chatFrame.addMessage(chatMessage.text); System.out.println("send it message"); return; } } }); // end of listner name=uid.trim(); hostid=host.trim(); chatPanel = new ChatPanel(hostid,name); chatPanel.setSendListener(new Runnable(){ public void run(){ Network.ChatMessage chatMessage = new Network.ChatMessage(); chatMessage.chatMessage=chatPanel.getSendText(); client.sendTCP(chatMessage); } }); new Thread("connect"){ public void run(){ try{ client.connect(5000, hostid,Network.port); }catch(IOException e){ e.printStackTrace(); } } }.start(); }//end of constructor static public class ChatPanel extends JPanel{ CardLayout cardLayout; JList messageList,nameList; JTextField sendText; JButton sendButton; JPanel topPanel,bottomPanel,panel; public ChatPanel(String host,String user){ setSize(600, 200); this.setVisible(true); System.out.println("Chat panel "+host+"user: "+user); { panel = new JPanel(new BorderLayout()); { topPanel = new JPanel(new GridLayout(1,2)); panel.add(topPanel); { topPanel.add(new JScrollPane(messageList=new JList())); messageList.setModel(new DefaultListModel()); } { topPanel.add(new JScrollPane(nameList=new JList())); nameList.setModel(new DefaultListModel()); } DefaultListSelectionModel disableSelections = new DefaultListSelectionModel() { public void setSelectionInterval (int index0, int index1) { } }; messageList.setSelectionModel(disableSelections); nameList.setSelectionMode(ListSelectionModel.SINGLE_SELECTION); } { bottomPanel = new JPanel(new GridBagLayout()); panel.add(bottomPanel,BorderLayout.SOUTH); bottomPanel.add(sendText=new JTextField(),new GridBagConstraints(0,0,1,1,1,0,GridBagConstraints.CENTER,GridBagConstraints.BOTH,new Insets(0,0,0,0),0,0)); bottomPanel.add(sendButton=new JButton(),new GridBagConstraints(1,0,1,1,0,0,GridBagConstraints.CENTER,0,new Insets(0,0,0,0),0,0)); } } sendText.addActionListener(new ActionListener(){ public void actionPerformed(ActionEvent e){ sendButton.doClick(); } }); } public void setSendListener (final Runnable listener) { sendButton.addActionListener(new ActionListener() { public void actionPerformed (ActionEvent evt) { if (getSendText().length() == 0) return; listener.run(); sendText.setText(""); sendText.requestFocus(); } }); } public String getSendText () { return sendText.getText().trim(); } public void setNames (final String[] names) { EventQueue.invokeLater(new Runnable(){ public void run(){ DefaultListModel model = (DefaultListModel)nameList.getModel(); model.removeAllElements(); for(String name:names) model.addElement(name); } }); } public void addMessage (final String message) { EventQueue.invokeLater(new Runnable() { public void run () { DefaultListModel model = (DefaultListModel)messageList.getModel(); model.addElement(message); messageList.ensureIndexIsVisible(model.size() - 1); } }); } } public JPanel getChatPanel(){ return chatPanel; } }

    Read the article

  • Custom Memory Allocator for STL map

    - by Prasoon Tiwari
    This question is about construction of instances of custom allocator during insertion into a std::map. Here is a custom allocator for std::map<int,int> along with a small program that uses it: #include <stddef.h> #include <stdio.h> #include <map> #include <typeinfo> class MyPool { public: void * GetNext() { return malloc(24); } void Free(void *ptr) { free(ptr); } }; template<typename T> class MyPoolAlloc { public: static MyPool *pMyPool; typedef size_t size_type; typedef ptrdiff_t difference_type; typedef T* pointer; typedef const T* const_pointer; typedef T& reference; typedef const T& const_reference; typedef T value_type; template<typename X> struct rebind { typedef MyPoolAlloc<X> other; }; MyPoolAlloc() throw() { printf("-------Alloc--CONSTRUCTOR--------%08x %32s\n", this, typeid(T).name()); } MyPoolAlloc(const MyPoolAlloc&) throw() { printf(" Copy Constructor ---------------%08x %32s\n", this, typeid(T).name()); } template<typename X> MyPoolAlloc(const MyPoolAlloc<X>&) throw() { printf(" Construct T Alloc from X Alloc--%08x %32s %32s\n", this, typeid(T).name(), typeid(X).name()); } ~MyPoolAlloc() throw() { printf(" Destructor ---------------------%08x %32s\n", this, typeid(T).name()); }; pointer address(reference __x) const { return &__x; } const_pointer address(const_reference __x) const { return &__x; } pointer allocate(size_type __n, const void * hint = 0) { if (__n != 1) perror("MyPoolAlloc::allocate: __n is not 1.\n"); if (NULL == pMyPool) { pMyPool = new MyPool(); printf("======>Creating a new pool object.\n"); } return reinterpret_cast<T*>(pMyPool->GetNext()); } //__p is not permitted to be a null pointer void deallocate(pointer __p, size_type __n) { pMyPool->Free(reinterpret_cast<void *>(__p)); } size_type max_size() const throw() { return size_t(-1) / sizeof(T); } void construct(pointer __p, const T& __val) { printf("+++++++ %08x %s.\n", __p, typeid(T).name()); ::new(__p) T(__val); } void destroy(pointer __p) { printf("-+-+-+- %08x.\n", __p); __p->~T(); } }; template<typename T> inline bool operator==(const MyPoolAlloc<T>&, const MyPoolAlloc<T>&) { return true; } template<typename T> inline bool operator!=(const MyPoolAlloc<T>&, const MyPoolAlloc<T>&) { return false; } template<typename T> MyPool* MyPoolAlloc<T>::pMyPool = NULL; int main(int argc, char *argv[]) { std::map<int, int, std::less<int>, MyPoolAlloc<std::pair<const int,int> > > m; //random insertions in the map m.insert(std::pair<int,int>(1,2)); m[5] = 7; m[8] = 11; printf("======>End of map insertions.\n"); return 0; } Here is the output of this program: -------Alloc--CONSTRUCTOR--------bffcdaa6 St4pairIKiiE Construct T Alloc from X Alloc--bffcda77 St13_Rb_tree_nodeISt4pairIKiiEE St4pairIKiiE Copy Constructor ---------------bffcdad8 St13_Rb_tree_nodeISt4pairIKiiEE Destructor ---------------------bffcda77 St13_Rb_tree_nodeISt4pairIKiiEE Destructor ---------------------bffcdaa6 St4pairIKiiE ======Creating a new pool object. Construct T Alloc from X Alloc--bffcd9df St4pairIKiiE St13_Rb_tree_nodeISt4pairIKiiEE +++++++ 0985d028 St4pairIKiiE. Destructor ---------------------bffcd9df St4pairIKiiE Construct T Alloc from X Alloc--bffcd95f St4pairIKiiE St13_Rb_tree_nodeISt4pairIKiiEE +++++++ 0985d048 St4pairIKiiE. Destructor ---------------------bffcd95f St4pairIKiiE Construct T Alloc from X Alloc--bffcd95f St4pairIKiiE St13_Rb_tree_nodeISt4pairIKiiEE +++++++ 0985d068 St4pairIKiiE. Destructor ---------------------bffcd95f St4pairIKiiE ======End of map insertions. Construct T Alloc from X Alloc--bffcda23 St4pairIKiiE St13_Rb_tree_nodeISt4pairIKiiEE -+-+-+- 0985d068. Destructor ---------------------bffcda23 St4pairIKiiE Construct T Alloc from X Alloc--bffcda43 St4pairIKiiE St13_Rb_tree_nodeISt4pairIKiiEE -+-+-+- 0985d048. Destructor ---------------------bffcda43 St4pairIKiiE Construct T Alloc from X Alloc--bffcda43 St4pairIKiiE St13_Rb_tree_nodeISt4pairIKiiEE -+-+-+- 0985d028. Destructor ---------------------bffcda43 St4pairIKiiE Destructor ---------------------bffcdad8 St13_Rb_tree_nodeISt4pairIKiiEE Last two columns of the output show that an allocator for std::pair<const int, int> is constructed everytime there is a insertion into the map. Why is this necessary? Is there a way to suppress this? Thanks! Edit: This code tested on x86 machine with g++ version 4.1.2. If you wish to run it on a 64-bit machine, you'll have to change at least the line return malloc(24). Changing to return malloc(48) should work.

    Read the article

  • How to programatically read native DLL imports in C#?

    - by Eric
    The large hunk of C# code below is intended to print the imports of a native DLL. I copied it from from this link and modified it very slightly, just to use LoadLibraryEx as Mike Woodring does here. I find that when I call the Foo.Test method with the original example's target, MSCOREE.DLL, it prints all the imports fine. But when I use other dlls like GDI32.DLL or WSOCK32.DLL the imports do not get printed. What's missing from this code that would let it print all the imports as, for example, DUMPBIN.EXE does? (Is there a hint I'm not grokking in the original comment that says, "using mscoree.dll as an example as it doesnt export any thing"?) Here's the extract that just shows how it's being invoked: public static void Test() { // WORKS: var path = @"c:\windows\system32\mscoree.dll"; // NO ERRORS, BUT NO IMPORTS PRINTED EITHER: //var path = @"c:\windows\system32\gdi32.dll"; //var path = @"c:\windows\system32\wsock32.dll"; var hLib = LoadLibraryEx(path, 0, DONT_RESOLVE_DLL_REFERENCES | LOAD_IGNORE_CODE_AUTHZ_LEVEL); TestImports(hLib, true); } And here is the whole code example: namespace PETest2 { [StructLayout(LayoutKind.Explicit)] public unsafe struct IMAGE_IMPORT_BY_NAME { [FieldOffset(0)] public ushort Hint; [FieldOffset(2)] public fixed char Name[1]; } [StructLayout(LayoutKind.Explicit)] public struct IMAGE_IMPORT_DESCRIPTOR { #region union /// <summary> /// CSharp doesnt really support unions, but they can be emulated by a field offset 0 /// </summary> [FieldOffset(0)] public uint Characteristics; // 0 for terminating null import descriptor [FieldOffset(0)] public uint OriginalFirstThunk; // RVA to original unbound IAT (PIMAGE_THUNK_DATA) #endregion [FieldOffset(4)] public uint TimeDateStamp; [FieldOffset(8)] public uint ForwarderChain; [FieldOffset(12)] public uint Name; [FieldOffset(16)] public uint FirstThunk; } [StructLayout(LayoutKind.Explicit)] public struct THUNK_DATA { [FieldOffset(0)] public uint ForwarderString; // PBYTE [FieldOffset(4)] public uint Function; // PDWORD [FieldOffset(8)] public uint Ordinal; [FieldOffset(12)] public uint AddressOfData; // PIMAGE_IMPORT_BY_NAME } public unsafe class Interop { #region Public Constants public static readonly ushort IMAGE_DIRECTORY_ENTRY_IMPORT = 1; #endregion #region Private Constants #region CallingConvention CALLING_CONVENTION /// <summary> /// Specifies the calling convention. /// </summary> /// <remarks> /// Specifies <see cref="CallingConvention.Winapi" /> for Windows to /// indicate that the default should be used. /// </remarks> private const CallingConvention CALLING_CONVENTION = CallingConvention.Winapi; #endregion CallingConvention CALLING_CONVENTION #region IMPORT DLL FUNCTIONS private const string KERNEL_DLL = "kernel32"; private const string DBGHELP_DLL = "Dbghelp"; #endregion #endregion Private Constants [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "GetModuleHandleA"), SuppressUnmanagedCodeSecurity] public static extern void* GetModuleHandleA(/*IN*/ char* lpModuleName); [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "GetModuleHandleW"), SuppressUnmanagedCodeSecurity] public static extern void* GetModuleHandleW(/*IN*/ char* lpModuleName); [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "IsBadReadPtr"), SuppressUnmanagedCodeSecurity] public static extern bool IsBadReadPtr(void* lpBase, uint ucb); [DllImport(DBGHELP_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "ImageDirectoryEntryToData"), SuppressUnmanagedCodeSecurity] public static extern void* ImageDirectoryEntryToData(void* Base, bool MappedAsImage, ushort DirectoryEntry, out uint Size); } static class Foo { // From winbase.h in the Win32 platform SDK. // const uint DONT_RESOLVE_DLL_REFERENCES = 0x00000001; const uint LOAD_IGNORE_CODE_AUTHZ_LEVEL = 0x00000010; [DllImport("kernel32.dll"), SuppressUnmanagedCodeSecurity] static extern uint LoadLibraryEx(string fileName, uint notUsedMustBeZero, uint flags); public static void Test() { //var path = @"c:\windows\system32\mscoree.dll"; //var path = @"c:\windows\system32\gdi32.dll"; var path = @"c:\windows\system32\wsock32.dll"; var hLib = LoadLibraryEx(path, 0, DONT_RESOLVE_DLL_REFERENCES | LOAD_IGNORE_CODE_AUTHZ_LEVEL); TestImports(hLib, true); } // using mscoree.dll as an example as it doesnt export any thing // so nothing shows up if you use your own module. // and the only none delayload in mscoree.dll is the Kernel32.dll private static void TestImports( uint hLib, bool mappedAsImage ) { unsafe { //fixed (char* pszModule = "mscoree.dll") { //void* hMod = Interop.GetModuleHandleW(pszModule); void* hMod = (void*)hLib; uint size = 0; uint BaseAddress = (uint)hMod; if (hMod != null) { Console.WriteLine("Got handle"); IMAGE_IMPORT_DESCRIPTOR* pIID = (IMAGE_IMPORT_DESCRIPTOR*)Interop.ImageDirectoryEntryToData((void*)hMod, mappedAsImage, Interop.IMAGE_DIRECTORY_ENTRY_IMPORT, out size); if (pIID != null) { Console.WriteLine("Got Image Import Descriptor"); while (!Interop.IsBadReadPtr((void*)pIID->OriginalFirstThunk, (uint)size)) { try { char* szName = (char*)(BaseAddress + pIID->Name); string name = Marshal.PtrToStringAnsi((IntPtr)szName); Console.WriteLine("pIID->Name = {0} BaseAddress - {1}", name, (uint)BaseAddress); THUNK_DATA* pThunkOrg = (THUNK_DATA*)(BaseAddress + pIID->OriginalFirstThunk); while (!Interop.IsBadReadPtr((void*)pThunkOrg->AddressOfData, 4U)) { char* szImportName; uint Ord; if ((pThunkOrg->Ordinal & 0x80000000) > 0) { Ord = pThunkOrg->Ordinal & 0xffff; Console.WriteLine("imports ({0}).Ordinal{1} - Address: {2}", name, Ord, pThunkOrg->Function); } else { IMAGE_IMPORT_BY_NAME* pIBN = (IMAGE_IMPORT_BY_NAME*)(BaseAddress + pThunkOrg->AddressOfData); if (!Interop.IsBadReadPtr((void*)pIBN, (uint)sizeof(IMAGE_IMPORT_BY_NAME))) { Ord = pIBN->Hint; szImportName = (char*)pIBN->Name; string sImportName = Marshal.PtrToStringAnsi((IntPtr)szImportName); // yes i know i am a lazy ass Console.WriteLine("imports ({0}).{1}@{2} - Address: {3}", name, sImportName, Ord, pThunkOrg->Function); } else { Console.WriteLine("Bad ReadPtr Detected or EOF on Imports"); break; } } pThunkOrg++; } } catch (AccessViolationException e) { Console.WriteLine("An Access violation occured\n" + "this seems to suggest the end of the imports section\n"); Console.WriteLine(e); } pIID++; } } } } } Console.WriteLine("Press Any Key To Continue......"); Console.ReadKey(); } }

    Read the article

  • JSF2 - use view scope managed bean to pass value between navigation

    - by Fekete Kamosh
    Hi all, I am solving how to pass values from one page to another without making use of session scope managed bean. For most managed beans I would like to have only Request scope. I created a very, very simple calculator example which passes Result object resulting from actions on request bean (CalculatorRequestBean) from 5th phase as initializing value for new instance of request bean initialized in next phase lifecycle. In fact - in production environment we need to pass much more complicated data object which is not as primitive as Result defined below. What is your opinion on this solution which considers both possibilities - we stay on the same view or we navigate to the new one. But in both cases I can get to previous value stored passed using view scoped managed bean. Calculator page: <?xml version='1.0' encoding='UTF-8' ?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:h="http://java.sun.com/jsf/html"> <h:head> <title>Calculator</title> </h:head> <h:body> <h:form> <h:panelGrid columns="2"> <h:outputText value="Value to use:"/> <h:inputText value="#{calculatorBeanRequest.valueToAdd}"/> <h:outputText value="Navigate to new view:"/> <h:selectBooleanCheckbox value="#{calculatorBeanRequest.navigateToNewView}"/> <h:commandButton value="Add" action="#{calculatorBeanRequest.add}"/> <h:commandButton value="Subtract" action="#{calculatorBeanRequest.subtract}"/> <h:outputText value="Result:"/> <h:outputText value="#{calculatorBeanRequest.result.value}"/> <h:outputText value="DUMMY" rendered="#{resultBeanView.dummy}"/> </h:panelGrid> </h:form> </h:body> Object to be passed through lifecycle: package cz.test.calculator; import java.io.Serializable; /** * Data object passed among pages. * Lets imagine it holds something much more complicated than primitive int */ public class Result implements Serializable { private int value; public void setValue(int value) { this.value = value; } public int getValue() { return value; } } Request scoped managed bean used on view "calculator.xhtml" package cz.test.calculator; import javax.annotation.PostConstruct; import javax.faces.bean.ManagedBean; import javax.faces.bean.ManagedProperty; import javax.faces.bean.RequestScoped; @ManagedBean @RequestScoped public class CalculatorBeanRequest { @ManagedProperty(value="#{resultBeanView}") ResultBeanView resultBeanView; private Result result; private int valueToAdd; /** * Should perform navigation to */ private boolean navigateToNewView; /** Creates a new instance of CalculatorBeanRequest */ public CalculatorBeanRequest() { } @PostConstruct public void init() { // Remember already saved result from view scoped bean result = resultBeanView.getResult(); } // Dependency injections public void setResultBeanView(ResultBeanView resultBeanView) { this.resultBeanView = resultBeanView; } public ResultBeanView getResultBeanView() { return resultBeanView; } // Getters, setter public void setValueToAdd(int valueToAdd) { this.valueToAdd = valueToAdd; } public int getValueToAdd() { return valueToAdd; } public boolean isNavigateToNewView() { return navigateToNewView; } public void setNavigateToNewView(boolean navigateToNewView) { this.navigateToNewView = navigateToNewView; } public Result getResult() { return result; } // Actions public String add() { result.setValue(result.getValue() + valueToAdd); return isNavigateToNewView() ? "calculator" : null; } public String subtract() { result.setValue(result.getValue() - valueToAdd); return isNavigateToNewView() ? "calculator" : null; } } and finally view scoped managed bean to pass Result variable to new page: package cz.test.calculator; import java.io.Serializable; import javax.annotation.PostConstruct; import javax.faces.bean.ManagedBean; import javax.faces.bean.ViewScoped; import javax.faces.context.FacesContext; @ManagedBean @ViewScoped public class ResultBeanView implements Serializable { private Result result = new Result(); /** Creates a new instance of ResultBeanView */ public ResultBeanView() { } @PostConstruct public void init() { // Try to find request bean ManagedBeanRequest and reset result value CalculatorBeanRequest calculatorBeanRequest = (CalculatorBeanRequest)FacesContext.getCurrentInstance().getExternalContext().getRequestMap().get("calculatorBeanRequest"); if(calculatorBeanRequest != null) { setResult(calculatorBeanRequest.getResult()); } } /** No need to have public modifier as not used on view * but only in managed bean within the same package */ void setResult(Result result) { this.result = result; } /** No need to have public modifier as not used on view * but only in managed bean within the same package */ Result getResult() { return result; } /** * To be called on page to instantiate ResultBeanView in Render view phase */ public boolean isDummy() { return false; } }

    Read the article

  • Java Box Class: Unsolvable: aligning components to the left or right

    - by user323186
    I have been trying to left align buttons contained in a Box to the left, with no success. They align left alright, but for some reason dont shift all the way left as one would imagine. I attach the code below. Please try compiling it and see for yourself. Seems bizarre to me. Thanks, Eric import java.awt.Dimension; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.io.BufferedReader; import java.io.File; import java.io.FileNotFoundException; import java.io.FileReader; import java.io.IOException; import javax.swing.Box; import javax.swing.BoxLayout; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.JMenu; import javax.swing.JMenuBar; import javax.swing.JMenuItem; import javax.swing.JScrollPane; import javax.swing.JTextArea; public class MainGUI extends Box implements ActionListener{ //Create GUI Components Box centerGUI=new Box(BoxLayout.X_AXIS); Box bottomGUI=new Box(BoxLayout.X_AXIS); //centerGUI subcomponents JTextArea left=new JTextArea(), right=new JTextArea(); JScrollPane leftScrollPane = new JScrollPane(left), rightScrollPane = new JScrollPane(right); //bottomGUI subcomponents JButton encrypt=new JButton("Encrypt"), decrypt=new JButton("Decrypt"), close=new JButton("Close"), info=new JButton("Info"); //Create Menubar components JMenuBar menubar=new JMenuBar(); JMenu fileMenu=new JMenu("File"); JMenuItem open=new JMenuItem("Open"), save=new JMenuItem("Save"), exit=new JMenuItem("Exit"); int returnVal =0; public MainGUI(){ super(BoxLayout.Y_AXIS); initCenterGUI(); initBottomGUI(); initFileMenu(); add(centerGUI); add(bottomGUI); addActionListeners(); } private void addActionListeners() { open.addActionListener(this); save.addActionListener(this); exit.addActionListener(this); encrypt.addActionListener(this); decrypt.addActionListener(this); close.addActionListener(this); info.addActionListener(this); } private void initFileMenu() { fileMenu.add(open); fileMenu.add(save); fileMenu.add(exit); menubar.add(fileMenu); } public void initCenterGUI(){ centerGUI.add(leftScrollPane); centerGUI.add(rightScrollPane); } public void initBottomGUI(){ bottomGUI.setAlignmentX(LEFT_ALIGNMENT); //setBorder(BorderFactory.createLineBorder(Color.BLACK)); bottomGUI.add(encrypt); bottomGUI.add(decrypt); bottomGUI.add(close); bottomGUI.add(info); } @Override public void actionPerformed(ActionEvent arg0) { // find source of the action Object source=arg0.getSource(); //if action is of such a type do the corresponding action if(source==close){ kill(); } else if(source==open){ //CHOOSE FILE File file1 =chooseFile(); String input1=readToString(file1); System.out.println(input1); left.setText(input1); } else if(source==decrypt){ //decrypt everything in Right Panel and output in left panel decrypt(); } else if(source==encrypt){ //encrypt everything in left panel and output in right panel encrypt(); } else if(source==info){ //show contents of info file in right panel doInfo(); } else { System.out.println("Error"); //throw new UnimplementedActionException(); } } private void doInfo() { // TODO Auto-generated method stub } private void encrypt() { // TODO Auto-generated method stub } private void decrypt() { // TODO Auto-generated method stub } private String readToString(File file) { FileReader fr = null; try { fr = new FileReader(file); } catch (FileNotFoundException e1) { e1.printStackTrace(); } BufferedReader br=new BufferedReader(fr); String line = null; try { line = br.readLine(); } catch (IOException e) { e.printStackTrace(); } String input=""; while(line!=null){ input=input+"\n"+line; try { line=br.readLine(); } catch (IOException e) { e.printStackTrace(); } } return input; } private File chooseFile() { //Create a file chooser final JFileChooser fc = new JFileChooser(); returnVal = fc.showOpenDialog(fc); return fc.getSelectedFile(); } private void kill() { System.exit(0); } public static void main(String[] args) { // TODO Auto-generated method stub MainGUI test=new MainGUI(); JFrame f=new JFrame("Tester"); f.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); f.setJMenuBar(test.menubar); f.setPreferredSize(new Dimension(600,400)); //f.setUndecorated(true); f.add(test); f.pack(); f.setVisible(true); } }

    Read the article

  • iPhone: Crash in Custom Autorelease Pool

    - by user338322
    My app is crashing when I try to post images in an HTTP request. I am trying to upload images to a server. The crash appears related to my autorelease pool because the crash is trapped at the [pool release] message. Here is the crash report: #0 0x326712f8 in prepareForMethodLookup () #1 0x3266cf5c in lookUpMethod () #2 0x32668f28 in objc_msgSend_uncached () #3 0x33f70996 in NSPopAutoreleasePool () #4 0x33f82a6c in -[NSAutoreleasePool drain] () #5 0x00003d3e in -[CameraViewcontroller save:] (self=0x811400, _cmd=0x319c00d4, number=0x11e210) at /Users/hardikrathore/Desktop/LiveVideoRecording/Classes/CameraViewcontroller.m:266 #6 0x33f36f8a in __NSFireDelayedPerform () #7 0x32da44c2 in CFRunLoopRunSpecific () #8 0x32da3c1e in CFRunLoopRunInMode () #9 0x31bb9374 in GSEventRunModal () #10 0x30bf3c30 in -[UIApplication _run] () #11 0x30bf2230 in UIApplicationMain () #12 0x00002650 in main (argc=1, argv=0x2ffff474) at /Users/hardikrathore/Desktop/LiveVideoRecording/main.m:14 The crash report says that final line of the following code is the point of the crash. (Line No. 266) -(void)save:(id)number { NSAutoreleasePool *pool = [[NSAutoreleasePool alloc] init]; j =[number intValue]; while(screens[j] != NULL){ NSLog(@" image made : %d",j); UIImage * image = [UIImage imageWithCGImage:screens[j]]; image=[self imageByCropping:image toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata = UIImageJPEGRepresentation(image,0.3); [image release]; CGImageRelease(screens[j]); screens[j] = NULL; UIImage * image1 = [UIImage imageWithCGImage:screens[j+1]]; image1=[self imageByCropping:image1 toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata1 = UIImageJPEGRepresentation(image1,0.3); [image1 release]; CGImageRelease(screens[j+1]); screens[j+1] = NULL; NSString *urlString=@"http://www.test.itmate4.com/iPhoneToServerTwice.php"; // setting up the request object now NSMutableURLRequest *request = [[NSMutableURLRequest alloc]init]; [request setURL:[NSURL URLWithString:urlString]]; [request setHTTPMethod:@"POST"]; NSString *fileName=[VideoID stringByAppendingString:@"_"]; fileName=[fileName stringByAppendingString:[NSString stringWithFormat:@"%d",k]]; NSString *fileName2=[VideoID stringByAppendingString:@"_"]; fileName2=[fileName2 stringByAppendingString:[NSString stringWithFormat:@"%d",k+1]]; /* add some header info now we always need a boundary when we post a file also we need to set the content type You might want to generate a random boundary.. this is just the same as my output from wireshark on a valid html post */ NSString *boundary = [NSString stringWithString:@"---------------------------14737809831466499882746641449"]; NSString *contentType = [NSString stringWithFormat:@"multipart/form-data; boundary=%@",boundary]; [request addValue:contentType forHTTPHeaderField: @"Content-Type"]; /* now lets create the body of the post */ //NSString *count=[NSString stringWithFormat:@"%d",front];; NSMutableData *body = [NSMutableData data]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; count=\"@\"";filename=\"%@.jpg\"\r\n",count,fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; filename=\"%@.jpg\"\r\n",fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata]]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //second boundary NSString *string1 = [[NSString alloc] initWithFormat:@"\r\n--%@\r\n",boundary]; NSString *string2 =[[NSString alloc] initWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2]; NSString *string3 =[[NSString alloc] initWithFormat:@"\r\n--%@--\r\n",boundary]; [body appendData:[string1 dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string2 dataUsingEncoding:NSUTF8StringEncoding]]; //experiment //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata1]]; //[body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string3 dataUsingEncoding:NSUTF8StringEncoding]]; // setting the body of the post to the reqeust [request setHTTPBody:body]; // now lets make the connection to the web NSData *returnData = [NSURLConnection sendSynchronousRequest:request returningResponse:nil error:nil]; NSString *returnString = [[NSString alloc] initWithData:returnData encoding:NSUTF8StringEncoding]; if([returnString isEqualToString:@"SUCCESS"]) { NSLog(returnString); k=k+2; j=j+2; [self performSelectorInBackground:@selector(save:) withObject:(id)[NSNumber numberWithInt:j]]; } [imgdata release]; [imgdata1 release]; [NSThread sleepForTimeInterval:.01]; } [pool drain]; //<-------------Line 266 } I don't understand what is causing the crash.

    Read the article

  • Receiving broadcast packets using packet socket

    - by user314336
    Hello I try to send DHCP RENEW packets to the network and receive the responses. I broadcast the packet and I can see that it's successfully sent using Wireshark. But I have difficulties receiving the responses.I use packet sockets to catch the packets. I can see that there are responses to my RENEW packet using Wireshark, but my function 'packet_receive_renew' sometimes catch the packets but sometimes it can not catch the packets. I set the file descriptor using FDSET but the 'select' in my code can not realize that there are new packets for that file descriptor and timeout occurs. I couldn't make it clear that why it sometimes catches the packets and sometimes doesn't. Anybody have an idea? Thanks in advance. Here's the receive function. int packet_receive_renew(struct client_info* info) { int fd; struct sockaddr_ll sock, si_other; struct sockaddr_in si_me; fd_set rfds; struct timeval tv; time_t start, end; int bcast = 1; int ret = 0, try = 0; char buf[1500] = {'\0'}; uint8_t tmp[BUFLEN] = {'\0'}; struct dhcp_packet pkt; socklen_t slen = sizeof(si_other); struct dhcps* new_dhcps; memset((char *) &si_me, 0, sizeof(si_me)); memset((char *) &si_other, 0, sizeof(si_other)); memset(&pkt, 0, sizeof(struct dhcp_packet)); define SERVER_AND_CLIENT_PORTS ((67 << 16) + 68) static const struct sock_filter filter_instr[] = { /* check for udp */ BPF_STMT(BPF_LD|BPF_B|BPF_ABS, 9), BPF_JUMP(BPF_JMP|BPF_JEQ|BPF_K, IPPROTO_UDP, 0, 4), /* L5, L1, is UDP? */ /* skip IP header */ BPF_STMT(BPF_LDX|BPF_B|BPF_MSH, 0), /* L5: */ /* check udp source and destination ports */ BPF_STMT(BPF_LD|BPF_W|BPF_IND, 0), BPF_JUMP(BPF_JMP|BPF_JEQ|BPF_K, SERVER_AND_CLIENT_PORTS, 0, 1), /* L3, L4 */ /* returns */ BPF_STMT(BPF_RET|BPF_K, 0x0fffffff ), /* L3: pass */ BPF_STMT(BPF_RET|BPF_K, 0), /* L4: reject */ }; static const struct sock_fprog filter_prog = { .len = sizeof(filter_instr) / sizeof(filter_instr[0]), /* casting const away: */ .filter = (struct sock_filter *) filter_instr, }; printf("opening raw socket on ifindex %d\n", info->interf.if_index); if (-1==(fd = socket(PF_PACKET, SOCK_DGRAM, htons(ETH_P_IP)))) { perror("packet_receive_renew::socket"); return -1; } printf("got raw socket fd %d\n", fd); /* Use only if standard ports are in use */ /* Ignoring error (kernel may lack support for this) */ if (-1==setsockopt(fd, SOL_SOCKET, SO_ATTACH_FILTER, &filter_prog, sizeof(filter_prog))) perror("packet_receive_renew::setsockopt"); sock.sll_family = AF_PACKET; sock.sll_protocol = htons(ETH_P_IP); //sock.sll_pkttype = PACKET_BROADCAST; sock.sll_ifindex = info->interf.if_index; if (-1 == bind(fd, (struct sockaddr *) &sock, sizeof(sock))) { perror("packet_receive_renew::bind"); close(fd); return -3; } if (-1 == setsockopt(fd, SOL_SOCKET, SO_BROADCAST, &bcast, sizeof(bcast))) { perror("packet_receive_renew::setsockopt"); close(fd); return -1; } FD_ZERO(&rfds); FD_SET(fd, &rfds); tv.tv_sec = TIMEOUT; tv.tv_usec = 0; ret = time(&start); if (-1 == ret) { perror("packet_receive_renew::time"); close(fd); return -1; } while(1) { ret = select(fd + 1, &rfds, NULL, NULL, &tv); time(&end); if (TOTAL_PENDING <= (end - start)) { fprintf(stderr, "End receiving\n"); break; } if (-1 == ret) { perror("packet_receive_renew::select"); close(fd); return -4; } else if (ret) { new_dhcps = (struct dhcps*)calloc(1, sizeof(struct dhcps)); if (-1 == recvfrom(fd, buf, 1500, 0, (struct sockaddr*)&si_other, &slen)) { perror("packet_receive_renew::recvfrom"); close(fd); return -4; } deref_packet((unsigned char*)buf, &pkt, info); if (-1!=(ret=get_option_val(pkt.options, DHO_DHCP_SERVER_IDENTIFIER, tmp))) { sprintf((char*)tmp, "%d.%d.%d.%d", tmp[0],tmp[1],tmp[2],tmp[3]); fprintf(stderr, "Received renew from %s\n", tmp); } else { fprintf(stderr, "Couldnt get DHO_DHCP_SERVER_IDENTIFIER%s\n", tmp); close(fd); return -5; } new_dhcps->dhcps_addr = strdup((char*)tmp); //add to list if (info->dhcps_list) info->dhcps_list->next = new_dhcps; else info->dhcps_list = new_dhcps; new_dhcps->next = NULL; } else { try++; tv.tv_sec = TOTAL_PENDING - try * TIMEOUT; tv.tv_usec = 0; fprintf(stderr, "Timeout occured\n"); } } close(fd); printf("close fd:%d\n", fd); return 0; }

    Read the article

  • Need some suggestions on my softwares architecture. [Code review]

    - by Sergio Tapia
    I'm making an open source C# library for other developers to use. My key concern is ease of use. This means using intuitive names, intuitive method usage and such. This is the first time I've done something with other people in mind, so I'm really concerned about the quality of the architecture. Plus, I wouldn't mind learning a thing or two. :) I have three classes: Downloader, Parser and Movie I was thinking that it would be best to only expose the Movie class of my library and have Downloader and Parser remain hidden from invocation. Ultimately, I see my library being used like this. using FreeIMDB; public void Test() { var MyMovie = Movie.FindMovie("The Matrix"); //Now MyMovie would have all it's fields set and ready for the big show. } Can you review how I'm planning this, and point out any wrong judgement calls I've made and where I could improve. Remember, my main concern is ease of use. Movie.cs using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Drawing; namespace FreeIMDB { public class Movie { public Image Poster { get; set; } public string Title { get; set; } public DateTime ReleaseDate { get; set; } public string Rating { get; set; } public string Director { get; set; } public List<string> Writers { get; set; } public List<string> Genres { get; set; } public string Tagline { get; set; } public string Plot { get; set; } public List<string> Cast { get; set; } public string Runtime { get; set; } public string Country { get; set; } public string Language { get; set; } public Movie FindMovie(string Title) { Movie film = new Movie(); Parser parser = Parser.FromMovieTitle(Title); film.Poster = parser.Poster(); film.Title = parser.Title(); film.ReleaseDate = parser.ReleaseDate(); //And so an so forth. } public Movie FindKnownMovie(string ID) { Movie film = new Movie(); Parser parser = Parser.FromMovieID(ID); film.Poster = parser.Poster(); film.Title = parser.Title(); film.ReleaseDate = parser.ReleaseDate(); //And so an so forth. } } } Parser.cs using System; using System.Collections.Generic; using System.Linq; using System.Text; using HtmlAgilityPack; namespace FreeIMDB { /// <summary> /// Provides a simple, and intuitive way for searching for movies and actors on IMDB. /// </summary> class Parser { private Downloader downloader = new Downloader(); private HtmlDocument Page; #region "Page Loader Events" private Parser() { } public static Parser FromMovieTitle(string MovieTitle) { var newParser = new Parser(); newParser.Page = newParser.downloader.FindMovie(MovieTitle); return newParser; } public static Parser FromActorName(string ActorName) { var newParser = new Parser(); newParser.Page = newParser.downloader.FindActor(ActorName); return newParser; } public static Parser FromMovieID(string MovieID) { var newParser = new Parser(); newParser.Page = newParser.downloader.FindKnownMovie(MovieID); return newParser; } public static Parser FromActorID(string ActorID) { var newParser = new Parser(); newParser.Page = newParser.downloader.FindKnownActor(ActorID); return newParser; } #endregion #region "Page Parsing Methods" public string Poster() { //Logic to scrape the Poster URL from the Page element of this. return null; } public string Title() { return null; } public DateTime ReleaseDate() { return null; } #endregion } } ----------------------------------------------- Do you guys think I'm heading towards a good path, or am I setting myself up for a world of hurt later on? My original thought was to separate the downloading, the parsing and the actual populating to easily have an extensible library. Imagine if one day the website changed its HTML, I would then only have to modifiy the parsing class without touching the Downloader.cs or Movie.cs class. Thanks for reading and for helping!

    Read the article

  • How can I map "insert='false' update='false'" on a composite-id key-property which is also used in a one-to-many FK?

    - by Gweebz
    I am working on a legacy code base with an existing DB schema. The existing code uses SQL and PL/SQL to execute queries on the DB. We have been tasked with making a small part of the project database-engine agnostic (at first, change everything eventually). We have chosen to use Hibernate 3.3.2.GA and "*.hbm.xml" mapping files (as opposed to annotations). Unfortunately, it is not feasible to change the existing schema because we cannot regress any legacy features. The problem I am encountering is when I am trying to map a uni-directional, one-to-many relationship where the FK is also part of a composite PK. Here are the classes and mapping file... CompanyEntity.java public class CompanyEntity { private Integer id; private Set<CompanyNameEntity> names; ... } CompanyNameEntity.java public class CompanyNameEntity implements Serializable { private Integer id; private String languageId; private String name; ... } CompanyNameEntity.hbm.xml <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://www.jboss.org/dtd/hibernate/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="com.example"> <class name="com.example.CompanyEntity" table="COMPANY"> <id name="id" column="COMPANY_ID"/> <set name="names" table="COMPANY_NAME" cascade="all-delete-orphan" fetch="join" batch-size="1" lazy="false"> <key column="COMPANY_ID"/> <one-to-many entity-name="vendorName"/> </set> </class> <class entity-name="companyName" name="com.example.CompanyNameEntity" table="COMPANY_NAME"> <composite-id> <key-property name="id" column="COMPANY_ID"/> <key-property name="languageId" column="LANGUAGE_ID"/> </composite-id> <property name="name" column="NAME" length="255"/> </class> </hibernate-mapping> This code works just fine for SELECT and INSERT of a Company with names. I encountered a problem when I tried to update and existing record. I received a BatchUpdateException and after looking through the SQL logs I saw Hibernate was trying to do something stupid... update COMPANY_NAME set COMPANY_ID=null where COMPANY_ID=? Hibernate was trying to dis-associate child records before updating them. The problem is that this field is part of the PK and not-nullable. I found the quick solution to make Hibernate not do this is to add "not-null='true'" to the "key" element in the parent mapping. SO now may mapping looks like this... CompanyNameEntity.hbm.xml <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://www.jboss.org/dtd/hibernate/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="com.example"> <class name="com.example.CompanyEntity" table="COMPANY"> <id name="id" column="COMPANY_ID"/> <set name="names" table="COMPANY_NAME" cascade="all-delete-orphan" fetch="join" batch-size="1" lazy="false"> <key column="COMPANY_ID" not-null="true"/> <one-to-many entity-name="vendorName"/> </set> </class> <class entity-name="companyName" name="com.example.CompanyNameEntity" table="COMPANY_NAME"> <composite-id> <key-property name="id" column="COMPANY_ID"/> <key-property name="languageId" column="LANGUAGE_ID"/> </composite-id> <property name="name" column="NAME" length="255"/> </class> </hibernate-mapping> This mapping gives the exception... org.hibernate.MappingException: Repeated column in mapping for entity: companyName column: COMPANY_ID (should be mapped with insert="false" update="false") My problem now is that I have tryed to add these attributes to the key-property element but that is not supported by the DTD. I have also tryed changing it to a key-many-to-one element but that didn't work either. So... How can I map "insert='false' update='false'" on a composite-id key-property which is also used in a one-to-many FK?

    Read the article

  • Understanding the passing of data/life of a script in web development/CodeIgniter

    - by Pete Jodo
    I hope I worded the title accurately enough but I typically use Java and don't have much experience in Web Development/PHP/CodeIgniter. I have a difficult time understanding the life cycle of a script as I found out trying to implement a certain feature to a website I am developing (as a means of learning how to). I'll first describe the feature I tried implementing and then the problem I ran into that made me question my fundamental understanding of how scripts work since I'm used to typical OOP. Ok so here goes... I have a webpage that has 2 basic tasks a user can do, create and delete an entry. What I attempted to implement was a way to time a user how long it takes them to complete a certain task. The way I did this was have a homepage where there would be a list of tasks a user to choose from (in this case 2, create and delete). A user would click a task which would link to the 'true' homepage where the user then would be expected to complete the task. My script looks like this: <?php class Site extends CI_Controller { var $task1; var $tasks = array( "task1" => NULL, "date1" => 0, "date2" => 0, "diff" => 0); function __construct() { parent::__construct(); include 'timetask.php'; $this->task1 = new TimeTask("create"); } function index() { $this->tasks['task1'] = $this->task1->getTask(); $this->tasks['diff'] = $this->task1->getTimeDiff(); if($this->tasks['diff'] == NULL) { $this->tasks['diff'] = 0; } $this->load->view('usability_test', $this->tasks); } function origIndex() { $this->task1->setDate1(new DateTime()); $this->tasks['date1'] = $this->task1->getDate1()->getTimestamp(); $data = array(); if($q = $this->site_model->get_records()) { $data['records'] = $q; } $this->load->view('options_view', $data); } function create() { $this->task1->setDate2(new DateTime()); $this->tasks['date2'] = $this->task1->getDate2()->getTimestamp(); $data = array( 'author' => $this->input->post('author'), 'title' => $this->input->post('title'), 'contents' => $this->input->post('contents') ); $this->site_model->add_record($data); $this->index(); } I only included create to keep it short. Then I also have the TimeTask class, that actually another StackOverflow so kindly helped me with: <?php class TimeTask { private $task; /** * @var DateTime */ private $date1, $date2; function __construct($currTask) { $this->task = $currTask; } public function getTimeDiff() { $hasDiff = $this->date1 && $this->date2; if ($hasDiff) { return $this->date2->getTimestamp() - $this->date1->getTimestamp(); } else { return NULL; } } public function __toString() { return (string) $this->getTimeDiff(); } /** * @return \DateTime */ public function getDate1() { return $this->date1; } /** * @param \DateTime $date1 */ public function setDate1(DateTime $date1) { $this->date1 = $date1; } /** * @return \DateTime */ public function getDate2() { return $this->date2; } /** * @param \DateTime $date2 */ public function setDate2(DateTime $date2) { $this->date2 = $date2; } /** * @return get current task */ public function getTask() { return $this->task; } } ?> I don't think posting the views is necessary for the question but here is atleast how the links are made. ...and... id", $row-title); ? Now there's no error in the code but it doesn't do what I expect of it and the reason I assume why is because that each time a function of the script is called via a new page it is NOT the same instance of the script called previously so any previously created objects are no longer there. This confuses me and leaves me quite unsure of how to implement this gracefully. Some ways I would guess of how to do this is by passing the necessary data through the URL or have data saved in a database and retrieve it later to compare the times. What would be a recommended way to do, not just this, but anything that needs previously created data? Also, am I correct to think that a script is only 'alive' for one webpage at a time? Thanks!

    Read the article

  • Threads to make video out of images

    - by masood
    updates: I think/ suspect the imageIO is not thread safe. shared by all threads. the read() call might use resources that are also shared. Thus it will give the performance of a single thread no matter how many threads used. ? if its correct . what is the solution (in practical code) Single request and response model at one time do not utilizes full network/internet bandwidth, thus resulting in low performance. (benchmark is of half speed utilization or even lower) This is to make a video out of an IP cam that gives a new image on each request. http://149.5.43.10:8001/snapshot.jpg It makes a delay of 3 - 8 seconds no matter what I do. Changed thread no. and thread time intervals, debugged the code by System.out.println statements to see if threads work. All seems normal. Any help? Please show some practical code. You may modify mine. This code works (javascript) with much smoother frame rate and max bandwidth usage. but the later code (java) dont. same 3 to 8 seconds gap. <!DOCTYPE html> <html> <head> <script type="text/javascript"> (function(){ var img="/*url*/"; var interval=50; var pointer=0; function showImg(image,idx) { if(idx<=pointer) return; document.body.replaceChild(image,document.getElementsByTagName("img")[0]); pointer=idx; preload(); } function preload() { var cache=null,idx=0;; for(var i=0;i<5;i++) { idx=Date.now()+interval*(i+1); cache=new Image(); cache.onload=(function(ele,idx){return function(){showImg(ele,idx);};})(cache,idx); cache.src=img+"?"+idx; } } window.onload=function(){ document.getElementsByTagName("img")[0].onload=preload; document.getElementsByTagName("img")[0].src="/*initial url*/"; }; })(); </script> </head> <body> <img /> </body> </html> and of java (with problem) : package camba; import java.applet.Applet; import java.awt.Button; import java.awt.Graphics; import java.awt.Image; import java.awt.Label; import java.awt.Panel; import java.awt.TextField; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.net.URL; import java.security.Timestamp; import java.util.Date; import java.util.concurrent.TimeUnit; import java.util.concurrent.atomic.AtomicBoolean; import javax.imageio.ImageIO; public class Camba extends Applet implements ActionListener{ Image img; TextField textField; Label label; Button start,stop; boolean terminate = false; long viewTime; public void init(){ label = new Label("please enter camera URL "); add(label); textField = new TextField(30); add(textField); start = new Button("Start"); add(start); start.addActionListener(this); stop = new Button("Stop"); add(stop); stop.addActionListener(this); } public void actionPerformed(ActionEvent e){ Button source = (Button)e.getSource(); if(source.getLabel() == "Start"){ for (int i = 0; i < 7; i++) { myThread(50*i); } System.out.println("start..."); } if(source.getLabel() == "Stop"){ terminate = true; System.out.println("stop..."); } } public void paint(Graphics g) { update(g); } public void update(Graphics g){ try{ viewTime = System.currentTimeMillis(); g.drawImage(img, 100, 100, this); } catch(Exception e) { e.printStackTrace(); } } public void myThread(final int sleepTime){ new Thread(new Runnable() { public void run() { while(!terminate){ try { TimeUnit.MILLISECONDS.sleep(sleepTime); } catch (InterruptedException ex) { ex.printStackTrace(); } long requestTime= 0; Image tempImage = null; try { URL pic = null; requestTime= System.currentTimeMillis(); pic = new URL(getDocumentBase(), textField.getText()); tempImage = ImageIO.read(pic); } catch(Exception e) { e.printStackTrace(); } if(requestTime >= /*last view time*/viewTime){ img = tempImage; Camba.this.repaint(); } } }}).start(); System.out.println("thread started..."); } }

    Read the article

  • Json / Jsonp not connecting to php (Phonegap + jquerymobile)

    - by Madhulika Mukherjee
    I am trying to make - an android WEB application with phonegap layout with JqueryMobile What Im doing - An html form that takes ID, name, and address as input 'Serialize's this data using ajax makes a json object out of it Should send it to a file called 'connection.php' Where, this data is put into a database (MySql) Other details - My server is localhost, Im using xampp I have already created a database and table using phpmyadmin The problem - My html file, where my json object is created, does not connect to the php file which is hosted by my localhost Here is my COMPLETE html file: <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01//EN" "http://www.w3.org/TR/html4/strict.dtd"> <html> <head> <!-- Change this if you want to allow scaling --> <meta name="viewport" content="width=default-width; user-scalable=no" /> <meta http-equiv="Content-type" content="text/html;charset=utf-8"> <title>Trial app</title> <link rel="stylesheet" href="thestylesheet.css" type="text/css"> <script type="text/javascript" charset="utf-8" src="javascript1.js"></script> <script type="text/javascript" charset="utf-8" src="javascript2.js"></script> <script type="text/javascript" charset="utf-8" src="cordova-1.8.0.js"></script> <script> $(document).ready(function () { $("#btn").click( function() { alert('hello hello'); $.ajax({ url: "connection.php", type: "POST", data: { id: $('#id').val(), name: $('#name').val(), Address: $('#Address').val() }, datatype: "json", success: function (status) { if (status.success == false) { alert("Failure!"); } else { alert("Success!"); } } }); }); }); </script> </head> <body> <div data-role="header"> <h1>Heading of the app</h1> </div><!-- /header --> <div data-role="content"> <form id="target" method="post"> <label for="id"> <input type="text" id="id" placeholder="ID"> </label> <label for="name"> <input type="text" id="name" placeholder="Name"> </label> <label for="Address"> <input type="text" id="Address" placeholder="Address"> </label> <div id="btn" data-role="button" data-icon="star" data-theme="e">Add record</div> <!--<input type="submit" value="Add record" data-icon="star" data-theme="e"> --> </form> </div> </body> </html> And here is my 'connection.php' hosted by my localhost <?php header('Content-type: application/json'); $server = "localhost"; $username = "root"; $password = ""; $database = "jqueryex"; $con = mysql_connect($server, $username, $password); if($con) { echo "Connected to database!"; } else { echo "Could not connect!"; } //or die ("Could not connect: " . mysql_error()); mysql_select_db($database, $con); /* CREATE TABLE `sample` ( `id` int(11) unsigned NOT NULL AUTO_INCREMENT, `name` varchar(45) DEFAULT NULL, `Address` varchar(45) DEFAULT NULL, PRIMARY KEY (`id`) ) */ $id= json_decode($_POST['id']); $name = json_decode($_POST['name']); $Address = json_decode($_POST['Address']); $sql = "INSERT INTO sample (id, name, Address) "; $sql .= "VALUES ($id, '$name', '$Address')"; if (!mysql_query($sql, $con)) { die('Error: ' . mysql_error()); } else { echo "Comment added"; } mysql_close($con); ?> My doubts: No entry is made in my table 'sample' when i view it in phpmyadmin So obviously, i see no success messages either I dont get any errors, not from ajax and neither from the php file. Stuff Im suspecting: Should i be using jsonp instead of json? Im new to this. Is there a problem with my php file? Perhaps I need to include some more javascript files in my html file? I assume this is a very simple problem so please help me out! I think there is just some conceptual error, as i have only just started with jquery, ajax, and json. Thank you.

    Read the article

  • Access Qry Questions

    - by kralco626
    It was suggested that I repost this questions as I didn't do a very good job discribing my issue the first time. (http://stackoverflow.com/questions/2921286/access-question) THE SITUATION: I have inspections from many months of many years. Sometimes there is more than one inspection in a month, sometimes there is no inspection. However, the report that is desired by the clients requires that I have EXACTLY ONE record per month for the time frame they request the report. They understand the data issues and have stated that if there is more than one inspection in a month to take the latest one. If the is not an inspection for that month, go back in time untill you find one and use that one. So a sample of the data is as follows: (I am including many records because I was told I did not include enough data on my last try) equip_id month year runtime date 1 5 2008 400 5/10/2008 12:34 PM 1 7 2008 500 7/12/2008 1:45 PM 1 8 2008 600 8/20/2008 1:12 PM 1 8 2008 605 8/30/2008 8:00 AM 1 1 2010 2000 1/12/2010 2:00 PM 1 3 2010 2200 3/24/2010 10:00 AM 2 7 2009 1000 7/20/2009 8:00 AM 2 10 2009 1400 10/14/2009 9:00 AM 2 1 2010 1600 1/15/2010 1:00 PM 2 1 2010 1610 1/30/2010 4:00 PM 2 3 2010 1800 3/15/2010 1:00PM After all the transformations to the data are done, it should look like this: equip_id month year runtime date 1 5 2008 400 5/10/2008 12:34 PM 1 6 2008 400 5/10/2008 12:34 PM 1 7 2008 500 7/12/2008 1:45 PM 1 8 2008 605 8/30/2008 8:00 AM 1 9 2008 605 8/30/2008 8:00 AM 1 10 2008 605 8/30/2008 8:00 AM 1 11 2008 605 8/30/2008 8:00 AM 1 12 2008 605 8/30/2008 8:00 AM 1 1 2009 605 8/30/2008 8:00 AM 1 2 2009 605 8/30/2008 8:00 AM 1 3 2009 605 8/30/2008 8:00 AM 1 4 2009 605 8/30/2008 8:00 AM 1 5 2009 605 8/30/2008 8:00 AM 1 6 2009 605 8/30/2008 8:00 AM 1 7 2009 605 8/30/2008 8:00 AM 1 8 2009 605 8/30/2008 8:00 AM 1 9 2009 605 8/30/2008 8:00 AM 1 10 2009 605 8/30/2008 8:00 AM 1 11 2009 605 8/30/2008 8:00 AM 1 12 2009 605 8/30/2008 8:00 AM 1 1 2010 2000 1/12/2010 2:00 PM 1 2 2010 2000 1/12/2010 2:00 PM 1 3 2010 2200 3/24/2010 10:00 AM 2 7 2009 1000 7/20/2009 8:00 AM 2 8 2009 1000 7/20/2009 8:00 AM 2 9 2009 1000 7/20/2009 8:00 AM 2 10 2009 1400 10/14/2009 9:00 AM 2 11 2009 1400 10/14/2009 9:00 AM 2 12 2009 1400 10/14/2009 9:00 AM 2 1 2010 1610 1/30/2010 4:00 PM 2 2 2010 1610 1/30/2010 4:00 PM 2 3 2010 1800 3/15/2010 1:00PM I think that this is the most accurate dipiction of the problem that I can give. I will now say what I have tried. Although if someone else has a better approach, I am perfectly willing to throw away what I have done and do it differently... STEP 1: create a query that removes the duplicates from the data. Ie. only one record per equip_id for each month/year, keeping the latest one. (done successfully) STEP 2: create a table of the date ranges the client wants the report for. (This is done dynamically at runtime) This table two field, Month and Year. So if the client wants a report from FEb 2008 to March 2010 the table would look like: Month Year 2 2008 3 2008 . . . 12 2008 1 2009 . . . 12 2009 1 2010 2 2010 3 2010 I then left joined this table with my query from step 1. So now I have a record for every month and every year that they want the report for, with nulls(or blanks) or sometimes 0s (not sure why, access is weird, but sometiems they are nulls and sumtimes they are 0s...) for the runtimes that are not avaiable. I don't particurally like this solution, but ill do it if i have to. (this is also done successfully) STEP 3: Fill in the missing runtime values. This I HAVE NOT done successfully. Note that if the request range for the report is feb 2008 to march 2010 and the oldest record for a particular equip_id is say june 2008, it is O.K. for the runtimes to be null (or zeros) for feb - may 2008. I am working with the following query for this step: SELECT equip_id as e_id,year,month, (select top 1 runhours from qry_1_c_One_Record_per_Month a where a.equip_id = e_id order by year,month) FROM qry_1_c_One_Record_per_Month where runhours is null or runhours = 0; UNION SELECT equip_id, year, month, runhours FROM qry_1_c_One_Record_per_Month WHERE .runhours Is Not Null And runhours <> 0 However I clearly can't check the a.equip_id = e_id ... so i don't have anyway to make sure i'm looking at the correct equip_id SUMMARY: So like i said i'm willing to throw away any part, or all of what I tried. Just trying to give everyone a complete picture. I REALLY apreciate ANY help! Thanks so much in advance!

    Read the article

< Previous Page | 517 518 519 520 521 522 523 524 525 526 527 528  | Next Page >