Search Results

Search found 21463 results on 859 pages for 'broken link'.

Page 570/859 | < Previous Page | 566 567 568 569 570 571 572 573 574 575 576 577  | Next Page >

• Upgrading Fedora on Amazon to 12 but getting libssl.so.* & libcrypto.so.* are missing

  - by bateman_ap

  I am upgrading to Fedora 12 on a Amazon EC2 using help here: http://www.ioncannon.net/system-administration/894/fedora-12-bootable-root-ebs-on-ec2/ I managed to do a 64 bit instance OK, however facing some problems with a standard one. On the final bit of the install from 11 to 12 I am getting an error: Error: Missing Dependency: libcrypto.so.8 is needed by package httpd-tools-2.2.1.5-1.fc11.1.i586 (installed) Error: Missing Dependency: libssl.so.8 is needed by package httpd-tools-2.2.1.5-1.fc11.1.i586 (installed) This is referenced in the comments from the link above but all it says is: Q: Apache failed, or libssl.so.* & libcrypto.so.* are missing A: These versions are mssing the symlinks they require. Easy fix, go symlink them to the newest versions in /lib However I am afraid I don't know how to do this. If it is any help I tried running the command locate libssl.so and got: /lib/libssl.so.0.9.8b /lib/libssl.so.6

  Read the article

• 64-bit Hardware Virtualization on VirtualBox

  - by Cat

  I am trying to set up a SQL Server practice lab using VirtualBox and a trial copy of Windows Server 2K8 R2 in ISO format. I received an error message that states my processor does not support 64-bit hardware virtualization. Although I "Enabled" Intel ardware virtualization in the BIOS that still doesn't work. According to the Intel website, the processor does support VT-x, however the accelerated tab in VirtualBox is greyed out and no references to VT-x are mentioned in the settings options available to me. Any ideas on how I can get around this? I checked around ServerFault and couldn't find anything but if I missed an applicable post a link is great too. Specs below - if additional information is needed please comment and I will provide. Thanks in advance. VirtualBox version - 4.1.18 Hardware - Lenovo B570 1068-A3U i3-2310M

  Read the article

• aptana/eclipse blocks other apps

  - by waquner

  Hi, I've got a fresh win7 installation, the only apps installed so far are aptana (beta 3)/eclipse and firefox + chrome (except antivirus and drivers) Every time I start aptana, chrome and firefox are blocked, so firefox can't load a webpage (or sometimes takes veeeery long) and chrome doesn't even take care of events (so for example hovering over a link doesn't change the cursor and a click does...nothing or typing in an url, press enter - nothing happens) First I thought, aptana downloads something and blocks my internet connection... but IE works well and also there are no signs in the taskmanager (cpu%, network or memory) When I close Aptana, all works as before. I tried updating Java, which didn't help... On my office-computer I use the same apps and it works perfect. Got any ideas? TIA, waquner

  Read the article

• SANS Mobility Policy Survey Webcast follow up

  - by Darin Pendergraft

  Hello Everyone!  If you missed the SANS mobility survey webcast on October 23 - here is a link to the replay and to the slides: [Warning -  you have to register to see the replay and to get the slides] https://www.sans.org/webcasts/byod-security-lists-policies-mobility-policy-management-survey-95429 The webcast had a lot of great information about how organizations are setting up and managing their mobile access policies.  Here are a couple of key takeaways: 1.  Who is most concerned about mobile access policy? Security Analysts >> CISOs >> CIOs - the focus is coming from the risk and security office - so what does that mean for the IT teams? 2. How important is mobile policy? 77% said "Critical" or "Extremely Important" - so this means mobile access policies will get a lot of attention.  3. When asked about the state of their mobile policies: Over 35% said they didn't have a mobile access policy and another 35% said they simply ask their employees to sign a usage agreement.  So basically ~70% of the respondents were not actively managing or monitoring mobile access. Be sure to watch the webcast replay for all of the details. Box, Oracle and RSA were all co-sponsors of the survey and webcast and all were invited to give a brief presentation at the end.

  Read the article

• MS Access 2007 end user access

  - by LtDan

  I need some good advise. I have used Access for many years and I use Sharepoint but never the two combined. My newly created Access db needs to be shared with many users across the organization. The back end is SQL and the old way to distribute the database would be placing the db on a shared drive, connecting their PC ODBC connections to the SQL db and then they would open the database and have at it. This has become the OLD way. What is the best (and simpliest) way to allow the end users to utilize a frontend for data entry/edit reporting etc. Can I create a link through SharePoint and the user just open it from there. Your good advise is greatly approciated.

  Read the article

• VPN PPTPD with MPPE Support for Debian or Ubuntu

  - by user78395

  Having an unencrypted vpn connection from a windows client to linux is pretty easy by using pptpd. When I was looking for an solution for encrypted (per MPPE) connection, I found a lot of information about patching the kernel etc. - so it definitly works after some work. But all these information is pretty old (2005-2006). Is it the same solution nowadays? I am not asking for a complete instruction (only if it's short) - I am more asking for a link to the right solution.

  Read the article

• Only allow root to change filesystem

  - by Uejji

  The VPS I manage uses a simple hard link rsync archive daily backup system saved to a loop file. This is great, because each backup only takes up as much space as what has changed each day, and all user/group permissions are kept. I would like to give users direct access to their home directories in each backup, but I'm worried about intentional or accidental backup data destruction, as how it stands now users can actually change, destroy or add to backed up data they originally owned. I've been looking for a way to mount this filesystem similar to an ro mount option, but something that would still allow rw access to root, but I've had absolutely no luck. In other words, I want users to be able to view and copy their backed up data without actually being able to change it, and have that data maintain the original permissions. I've got no real preferences as far as filesystem, as long as it's a standard unix filesystem that can preserve permissions, support hard links and deny write access to users without actually stripping the w permission from everything.

  Read the article

• Loign Scren hangs after entering password in Ubuntu 12.04

  - by Ravi

  When I enter my password in the login box nothing happens. It is stucked there. It was running fine earlier. Actually, I installed the package gnome-panel and cairo-dock. Then I logged out and selected gnome classic session. Then I added a ppa from the webupd8.org to install the themes(link). I opened Ubuntu Tweak tool. When I changed the theme to Evolve the whole laptop stopped responding. None of my keyboard and mouse was working. So I was forced to do a forced shutdown. Now after restart I cannot login into ubuntu. I hear a loud sound of my laptop fan when the laptop is stucked. (Probably CPU will be at 100% when it stucked). Please help me. How can I login back to ubuntu? I am using ubuntu 12.04 and have installed all the latest updates..

  Read the article

• Error page for OWA users on a different server?

  - by W_P

  We are getting ready to do a network-wide upgrade to Exchange 2010. The url for the old 2007 mailboxes is at https://mail.example.com and users who have had their mail box moved will have to go to https://Email.example.com If a user that has a 2010 mailbox attempts to login at the 2007 OWA location, they get a standard 403 Forbidden page. We would like to show them a page of our own making, that includes a link to the 2010 OWA login page. I assumed we could do this with an IIS Custom Error page, but setting the 403.4 error page in IIS on the Default web site doesn't seem to be working. Does anyone know how we could get around this? BTW, our OWA for the 2007 boxes in on Windows Server 2003, and IIS 6

  Read the article

• Computer freezes, wireless network icon disappears

  - by Heidi

  As you can see I have two problems. I have a Toshiba Tecra A3 computer. It is 5-6 years old and it is connected to a D-link router. For a period now it has not been working correctly. The computer freezes either when i try turning it on or when I have been using the computer for a short period of time. The times the computer works normally I have a problem with a disappearing wireless network icon, and so I have no internet. Can this be fixed or do I have to buy a new computer? I only use the computer for internet surfing and easy tasks like word etc, so I would like to keep it as long as possible.

  Read the article

• How to customize the Ubuntu Live CD?

  - by karthick87

  I would like to customize Ubuntu live CD by installing some additional packages. I have followed this link but it doesn't seems to work. Can anyone provide clear instructions? Note: I do not prefer Remastersys, manual way will be appreciated. Customization Packages that I want to install: Thunderbird Samba SSH Changes that I need: Remove Games menu from the Application menu Firefox shortcut on desktop Radiance as the default theme Different default Ubuntu wallpaper Configuration file changes I want the panel to be placed at the bottom I want to paste my Samba configuration file instead of default Samba configuration I have few Firefox shortcuts and folders I would like to show that in Desktop Also it will be nice if you say me how to change the icon sets Recent Updates I have customized Ubuntu 10.10 with Firefox shortcuts and few folders on desktops. Everything went smooth. But the installer gets crashes after choosing the timezone. How do i fix this issue? Also setting wallpaper affects the login screen. The wallpaper which i set is displayed on the login screen also. I just want the default one for the login screen.

  Read the article

• Mail.app slow to include new messages

  - by Chris Tompsett

  With Leopard I was able to link to the University's Exchange 2003 server with and IMAP connection and mail out directly vie the SMTP client. With Snow Leopard I attempted to update to a full Exchange service (Exchange 2007). Almost all has worked OK (ical, address, etc.) except that new mail posted to my email account, which is visible using a 'web' interface to Exchange remains invisible for some random number of hours. Those who are running the Exchange server have no interest in discussing the problem. Has anyone else had a similar experience?

  Read the article

• OpenGL : sluggish performance in extracting texture from GPU

  - by Cyan

  I'm currently working on an algorithm which creates a texture within a render buffer. The operations are pretty complex, but for the GPU this is a simple task, done very quickly. The problem is that, after creating the texture, i would like to save it. This requires to extract it from GPU memory. For this operation, i'm using glGetTexImage(). It works, but the performance is sluggish. No, i mean even slower than that. For example, an 8MB texture (uncompressed) requires 3 seconds (yes, seconds) to be extracted. That's mind puzzling. I'm almost wondering if my graphic card is connected by a serial link... Well, anyway, i've looked around, and found some people complaining about the same, but no working solution so far. The most promising advise was to "extract data in the native format of the GPU". Which i've tried and tried, but failed so far. Edit : by moving the call to glGetTexImage() in a different place, the speed has been a bit improved for the most dramatic samples : looking again at the 8MB texture, it knows requires 500ms, instead of 3sec. It's better, but still much too slow. Smaller texture sizes were not affected by the change (typical timing remained into the 60-80ms range). Using glFinish() didn't help either. Note that, if i call glFinish() (without glGetTexImage), i'm getting a fixed 16ms result, whatever the texture size or complexity. It really looks like the timing for a frame at 60fps. The timing is measured for the full rendering + saving sequence. The call to glGetTexImage() alone does not really matter. That being said, it is this call which changes the performance. And yes, of course, as stated at the beginning, the texture is "created into the GPU", hence the need to save it.

  Read the article

• SSH disconnects active session after 20 minutes

  - by Paramaeleon

  I’ve just set up a new Linux box (OpenSuSE 12.3 on VmWare). Now I stated that my SSH shell sessions are disconnected exactly after 20 minutes, clearly with activity. (Putty: “Network error: Software caused connection abort”) I already set Putty to send keep alives every 64 sec. In sshd_config, I set ClientAliveInterval 50 ClientAliveCountMax 2 and did a deamon reload. Didn’t help. About two minutes after the link breakdown, ssh reports to /var/log/messages: … … sshd[…]: Timeout, client not responding. … … sshd[…]: pam_unix(sshd:session): session closed for user root I don’t encounter this behaviour when connecting to other virtual machines, so I guess the problem isn’t in the network. Any help is appreciated.

  Read the article

• no driver found error showing while installing windows 7

  - by Shyam s

  I accidentally deleted all my windows 7 drive partitions while installing Ubuntu in my laptop.On booting into ubuntu it is showing 450gb NTFs file partition.30 GB drive linux file system partition. so when i was reinstalling my Os with windows 7.i am not able to view my drives.it is showing drivers not found.I have searched the google followed the steps mentioned in this link. http://social.technet.microsoft.com/Forums/en/w7itproinstall/thread/d460efd3-eac4-4ef8-b95f-b8208b24f44f my laptop is i3 machine and i changed sata to ACHI.still it is showing same error. How can reinstall windows 7. thanks in advance.

  Read the article

• QNAP TS-419p as a VPN Gateway?

  - by heisenberg

  Hello, I am hoping one of you might be able to help. I want to make files stored on shared folders on a QNAP TS-409p available to users over a VPN link. How is the possible? Can someone explain what I need to do. What do I need to do at the router and what do I need to do on the QNAP NAS? Effectively, what I want do do is use the built in Windows vpn client to connect to my home network and then be able to browse the shared folders. Thanks in advance.

  Read the article

• Windows 8 Program Sharing?

  - by Martin W. Seitz

  How do I, as the administrator, share the Skype program with a user on the same PC? I tried to download Skype to the user from the windows store that said it was blocked and I must contact the administrator. The Skype icon appears on the user desktop but with an X in the corner with no way to allow it to work as the administrator. In the administrator desktop the Skype icon appears without the x and it does work. I have tried to research this issue and so far all I have been able to find and do is the enable $admin share at this link http://www.intelliadmin.com/index.php/2012/10/windows-8-enable-the-admin-share/ Now that I have done this how do I use it to share the Skype program? Thanks in advance. Marty Seitz

  Read the article

• How to make the internal subwoofer work on an Asus G73JW?

  - by CodyLoco

  I have an Asus G73JW laptop which has an internal subwoofer built-in. Currently, the system detects the internal speakers as a 2.0 system (or I can change do 4.0 is the only other option). I found a bug report here: https://bugs.launchpad.net/ubuntu/+source/alsa-driver/+bug/673051 which discusses the bug and according to them a fix was sent upstream back at the end of 2010. I would have thought this would have made it into 12.04 but I guess not? I tried following the link given at the very bottom to install the latest ALSA drivers, here: https://wiki.ubuntu.com/Audio/InstallingLinuxAlsaDriverModules however I keep running into an error when trying to install: sudo apt-get install linux-alsa-driver-modules-$(uname -r) Reading package lists... Done Building dependency tree Reading state information... Done E: Unable to locate package linux-alsa-driver-modules-3.2.0-24-generic E: Couldn't find any package by regex 'linux-alsa-driver-modules-3.2.0-24-generic' I believe I have added the repository correctly: sudo add-apt-repository ppa:ubuntu-audio-dev/ppa [sudo] password for codyloco: You are about to add the following PPA to your system: This PPA will be used to provide testing versions of packages for supported Ubuntu releases. More info: https://launchpad.net/~ubuntu-audio-dev/+archive/ppa Press [ENTER] to continue or ctrl-c to cancel adding it Executing: gpg --ignore-time-conflict --no-options --no-default-keyring --secret-keyring /tmp/tmp.7apgZoNrqK --trustdb-name /etc/apt/trustdb.gpg --keyring /etc/apt/trusted.gpg --primary-keyring /etc/apt/trusted.gpg --keyserver hkp://keyserver.ubuntu.com:80/ --recv 4E9F485BF943EF0EABA10B5BD225991A72B194E5 gpg: requesting key 72B194E5 from hkp server keyserver.ubuntu.com gpg: key 72B194E5: public key "Launchpad Ubuntu Audio Dev team PPA" imported gpg: Total number processed: 1 gpg: imported: 1 (RSA: 1) And I also ran an update as well (followed the instructions on the fix above). Any ideas?

  Read the article

• Create Adjustable Depth of Field Photos with a DSLR

  - by Jason Fitzpatrick

  If you’re fascinating by the Lytro camera–a camera that let’s you change the focus after you’ve taken the photo–this DSLR hack provides a similar post-photo focus processing without the $400 price tag. Photography tinkers at The Chaos Collective came up with a clever way of mimicking the adjustable depth-of-field adjustment effect from the Lytro camera. The secret sauce in their technique is setting the camera to manual focus and capturing a short 2-3 second video clip while they rotate the focus through the entire focal range. From there, they use a simple applet to separate out each frame of the video. Check out the interactive demo below: Anywhere you click in the photo shifts the focus to that point, just like the post processing in the Lytro camera. It’s a different approach to the problem but it yields roughly the same output. Hit up the link below for the full run down on their technique and how you can get started using it with your own video-enabled DLSR. Camera HACK: DOF-Changeable Photos with an SLR [via Hack A Day] Secure Yourself by Using Two-Step Verification on These 16 Web Services How to Fix a Stuck Pixel on an LCD Monitor How to Factory Reset Your Android Phone or Tablet When It Won’t Boot

  Read the article

• What is the 'cacert.pem' and for what to use that?

  - by user65567

  I am developing a web application on localhost with domains and sub-domains and I would like to use a HTTPS connection. On my Mac OS, in order to enable SSL, I need to set Apache correctly, so I followed some guide to accomplish part of that. Now it is time to choose a certificate in order to test HTTPS requests. I seen the cacert.pem, but I don't know how to use that and for what it is used (can you explain to me some about its usage?)... So, is it possible to use the cacert.pem (see the link) for all my domains and subdomains (maybe, as a wildcard certificate) on localhost? If so, how to do that? What certificate I have to take and use? If no, what I need to do in order to use a wildcard certificate for all my domains and subdomains on localhost? Of course those certificates must be accepted by browsers and working for HTTPS connection between my domains.

  Read the article

• Simple CMS (separate files for multiple users) [closed]

  - by Pentium100

  I need a simple CMS software (or maybe it's called something else). There are many users (adding new users has to be simple as it will be done manually, no "sign up" link) and those users have to access (just download, no uploading or modification) some files. A file can be shown just to one user or a group of users (a user can belong to multiple groups). Upload a file and tag which users/groups can access it. This can probably be done with FTP, but HTTP would be better. Any software (preferable open source) that can do this without much modification? I can modify PHP code a bit, but I am not a programmer.

  Read the article

• A Dozen USB Chargers Analyzed; Or: Beware the Knockoffs

  - by Jason Fitzpatrick

  When it comes to buying a USB charger one is just as good as another so you might as well buy the cheapest one, right? This interesting and detailed analysis of name brand, off-brand, and counterfeit chargers will have you rethinking that stance. Ken Shirriff gathered up a dozen USB chargers including official Apple chargers, counterfeit Apple chargers, as well as offerings from Monoprice, Belkin, Motorola, and other companies. After putting them all through a battery of tests he gave them overall rankings based on nine different categories including power stability, power quality, and efficiency. The take away from his research? Quality varied widely between brands but when sticking with big companies like Apple or HP the chargers were all safe. The counterfeit chargers (like the $2 Apple iPad charger knock-off he tested) proved to be outright dangerous–several actually melted or caught fire in the course of the project. Hit up the link below for his detailed analysis including power output readings for the dozen chargers. A Dozen USB Chargers in the Lab [via O'Reilly Radar] 6 Start Menu Replacements for Windows 8 What Is the Purpose of the “Do Not Cover This Hole” Hole on Hard Drives? How To Log Into The Desktop, Add a Start Menu, and Disable Hot Corners in Windows 8

  Read the article

• Ubuntu 12.04 startup is slow and dmesg output seems to lose several seconds

  - by cdowen

  I use ubuntu on Dell Inspiron n4050.I have upgraded to ubuntu 12.04 from 10.04. But now I find the system startup is a little slow and plymouth only show purple screen without logo during startup. When I use dmesg, it shows such messages: [ 2.497750] EXT4-fs (sda1): mounted filesystem with ordered data mode. Opts: (null) [ 2.603028] usb 2-1.6: new high-speed USB device number 3 using ehci_hcd [ 2.715538] Initializing USB Mass Storage driver... [ 2.715594] usbcore: registered new interface driver usb-storage [ 2.715596] USB Mass Storage support registered. [ 21.317843] Adding 2000892k swap on /dev/sda5. Priority:-1 extents:1 across:2000892k [ 21.323724] ADDRCONF(NETDEV_UP): eth0: link is not ready [ 21.391450] udevd[431]: starting version 175 I wonder what it is doing between 2 second and 21 second. Is it related to being so slow? I tried bootchart. It gave me a complex picture. Sorry I can't post it here. http://3.bp.blogspot.com/-7LX8T5uQvlw/UKhdFMVkp4I/AAAAAAAAADg/dtxePkE94mg/s320/lengzhen-ubuntu-precise-20121118-1.png While ubuntu is booting , I also noticed that it appears:/tmp is not ready or present And sometimes follows *Stop saving kernel messages. Is this the reason dmesg lost output?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Microsoft Outlook 2007 Limit attachment size

  - by tasmanian_devil

  I have qmail server and authetication on Active Directory. All clients use Microsoft Outlook 2007 as default mail client. A have one central location and several remote location wich are connected with slow link speed connection. I have attachment limit on qmail, but i have problem when client attach file localy and send mail, attachment is been uploaded to qmail server and rejected because exceeded limit. Is it possible to limit attachment localy on MS Outlook 2007? I know that Office 2010 have attachment limitation but i think that is not working on Office 2007.

  Read the article

< Previous Page | 566 567 568 569 570 571 572 573 574 575 576 577  | Next Page >