Search Results

Search found 21463 results on 859 pages for 'broken link'.

Page 570/859 | < Previous Page | 566 567 568 569 570 571 572 573 574 575 576 577  | Next Page >

• Automatic subdomain creation in htaccess on Apache

  - by ANOther8660

  I have a domain in my HOSTS file; www.mytestbusiness.com However, I want to convert some folders into subdomains automatically, e.g. www.mytestbusiness.com/birmingham www.mytestbusiness.com/london which should be: www.birmingham.mytestbusiness.com www.london.mytestbusiness.com Only for some folders do I want to keep it as a domain/folder link, e.g. www.mytestbusiness.com/styles/ I don't want the CSS folder becoming a subdomain, or certain folders like cgi-bin, dwoo etc. (dwoo contains the site templates!) I am running Apache 2.2 on Windows 7 Home Edition, and the site has no issues, it's just creating subdomains in .htaccess without having to manually declare them which is the problem. What's the best way to do this, other than manually declaring them in httpd-vhosts.conf as I used to do? Thanks

  Read the article

• HTML Manifest for Content Folios

  - by Kyle Hatlestad

  I recently worked on a project to create a custom content folio renderer in WebCenter Content. It needed to output the native files in the folio along with a manifest file in HTML format which would list the contents of the folio along with any designated metadata and a relative link to the file within the download.  This way a person could hand someone the folio download and it would be a self-contained package with all of the content and a single file to display the information on the contents.  The default Zip rendition of the folio will output the web-viewable version of the file with an HDA formatted file for each one. And unless you are fluent in HDA or have a tool to read them, they are difficult to consume. I thought this might be useful for others, so I'm posting a copy of the component here. Beyond the standard instructions for installing a component, there is an environment configuration file (folionativezipwithmanifestrenderer_environment.cfg) which has a couple of options. FolioMetadataManifestList - This is a comma separated list of metadata fields (system or custom) that should be included in the manifest file. FolioMetadataManifestUseOriginalFilename - (True or False) If set to True, the filenames in the zip file will be based on the original filename as it was checked into WebCenter Content.  If False, it will use the 'Name' of the item as defined within the Folio.  This is usually the Title of the item. The component also includes the source code, so feel free to use this as a reference for creating other interesting folios. 

  Read the article

• Smart Phones Shockingly Energy Efficient; Lead to Decreased Household Power Consumption

  - by Jason Fitzpatrick

  Given how often our smart phones and tablets spend plugged in and topping off their battery reserves, it’s easy to assume they’re sucking down a lot of power. Analysis shows the lilliputian but powerful devices are surprisingly efficient and may be decreasing our overall power consumption. Courtesy of energy-centric blog Outlier, we’re treated to a look at the power sipping habits of popular smart phones and mobile devices. The simple take away? They use shockingly little electricity over the course of the year–you can charge your new iPhone for a year of regular usage for under a buck. The more complex analysis? The proliferation of tiny and energy efficient devices is displacing heavier energy consumers (large televisions, desktop computers, etc.) and driving a more efficient gadget-to-consumption ratio is many households. Hit up the link below to read the full post. How Much Does It Take to Charge an iPhone [via Mashable] 7 Ways To Free Up Hard Disk Space On Windows HTG Explains: How System Restore Works in Windows HTG Explains: How Antivirus Software Works

  Read the article

• SSH disconnects active session after 20 minutes

  - by Paramaeleon

  I’ve just set up a new Linux box (OpenSuSE 12.3 on VmWare). Now I stated that my SSH shell sessions are disconnected exactly after 20 minutes, clearly with activity. (Putty: “Network error: Software caused connection abort”) I already set Putty to send keep alives every 64 sec. In sshd_config, I set ClientAliveInterval 50 ClientAliveCountMax 2 and did a deamon reload. Didn’t help. About two minutes after the link breakdown, ssh reports to /var/log/messages: … … sshd[…]: Timeout, client not responding. … … sshd[…]: pam_unix(sshd:session): session closed for user root I don’t encounter this behaviour when connecting to other virtual machines, so I guess the problem isn’t in the network. Any help is appreciated.

  Read the article

• A Dozen USB Chargers Analyzed; Or: Beware the Knockoffs

  - by Jason Fitzpatrick

  When it comes to buying a USB charger one is just as good as another so you might as well buy the cheapest one, right? This interesting and detailed analysis of name brand, off-brand, and counterfeit chargers will have you rethinking that stance. Ken Shirriff gathered up a dozen USB chargers including official Apple chargers, counterfeit Apple chargers, as well as offerings from Monoprice, Belkin, Motorola, and other companies. After putting them all through a battery of tests he gave them overall rankings based on nine different categories including power stability, power quality, and efficiency. The take away from his research? Quality varied widely between brands but when sticking with big companies like Apple or HP the chargers were all safe. The counterfeit chargers (like the $2 Apple iPad charger knock-off he tested) proved to be outright dangerous–several actually melted or caught fire in the course of the project. Hit up the link below for his detailed analysis including power output readings for the dozen chargers. A Dozen USB Chargers in the Lab [via O'Reilly Radar] 6 Start Menu Replacements for Windows 8 What Is the Purpose of the “Do Not Cover This Hole” Hole on Hard Drives? How To Log Into The Desktop, Add a Start Menu, and Disable Hot Corners in Windows 8

  Read the article

• Computer freezes, wireless network icon disappears

  - by Heidi

  As you can see I have two problems. I have a Toshiba Tecra A3 computer. It is 5-6 years old and it is connected to a D-link router. For a period now it has not been working correctly. The computer freezes either when i try turning it on or when I have been using the computer for a short period of time. The times the computer works normally I have a problem with a disappearing wireless network icon, and so I have no internet. Can this be fixed or do I have to buy a new computer? I only use the computer for internet surfing and easy tasks like word etc, so I would like to keep it as long as possible.

  Read the article

• How do you move files to Windows Server 2008 cloud server from local computer?

  - by Mausimo

  I recently setup a Windows 2008 R2 server on Amazon EC2. I now want to move an application I created on my local desktop to this server. However, having never done this before I have no idea how to transfer files from my local desktop to the online server. What is the standard convention for transferring files from local machine to the server? As a side note, why can I not download the .NET framework 4 .exe file? Clicking the download link does nothing... (it is already a trusted site)

  Read the article

• How can I check the actual size used in an NTFS directory with many hardlinks?

  - by kbyrd

  On a Win7 NTFS volume, I'm using cwrsync which supports --link-dest correctly to create "snapshot" type backups. So I have: z:\backups\2010-11-28\cygdrive\c\Users\... z:\backups\2010-12-02\cygdrive\c\Users\... The content of 2010-12-02 is mostly hardlinks back to files in the 2010-11-28 directory, but there are a few new or changed files only in 2010-12-02. On linux, the 'du' utility will tell me the actual size taken by each incremental snapshot. On Windows, explorer and du under cygwin are both fooled by hardlinks and shows 2010-12-02 taking up a little more space than 2010-11-28. Is there a Windows utility that will show the correct space acutally used?

  Read the article

• OpenGL : sluggish performance in extracting texture from GPU

  - by Cyan

  I'm currently working on an algorithm which creates a texture within a render buffer. The operations are pretty complex, but for the GPU this is a simple task, done very quickly. The problem is that, after creating the texture, i would like to save it. This requires to extract it from GPU memory. For this operation, i'm using glGetTexImage(). It works, but the performance is sluggish. No, i mean even slower than that. For example, an 8MB texture (uncompressed) requires 3 seconds (yes, seconds) to be extracted. That's mind puzzling. I'm almost wondering if my graphic card is connected by a serial link... Well, anyway, i've looked around, and found some people complaining about the same, but no working solution so far. The most promising advise was to "extract data in the native format of the GPU". Which i've tried and tried, but failed so far. Edit : by moving the call to glGetTexImage() in a different place, the speed has been a bit improved for the most dramatic samples : looking again at the 8MB texture, it knows requires 500ms, instead of 3sec. It's better, but still much too slow. Smaller texture sizes were not affected by the change (typical timing remained into the 60-80ms range). Using glFinish() didn't help either. Note that, if i call glFinish() (without glGetTexImage), i'm getting a fixed 16ms result, whatever the texture size or complexity. It really looks like the timing for a frame at 60fps. The timing is measured for the full rendering + saving sequence. The call to glGetTexImage() alone does not really matter. That being said, it is this call which changes the performance. And yes, of course, as stated at the beginning, the texture is "created into the GPU", hence the need to save it.

  Read the article

• When creating a GUI wizard, should all pages/tabs be of the same size? [closed]

  - by Job

  I understand that some libraries would force me to, but my question is general. If I have a set of buttons at the bottom: Back, Next, Cancel?, (other?), then should their location ever change? If the answer is no, then what do I do about pages with little content? Do I stretch things? Place them in the lone upper left corner? According to Steve Krug, it does not make sense to add anything to GUI that does not need to be there. I understand that there are different approaches to wizards - some have tabs, others do not. Some tabs are lined horizontally at the top; others - vertically on the left. Some do not show pages/tabs, and are simply sequences of dialogs. This is probably a must when the wizard is "non-linear", e.g. some earlier choices can result in branching. Either way the problem is the same - sacrifice on the consistency of the "big picture" (outline of the page/tab + location of buttons), or the consistency of details (some tabs might be somewhat packed; others having very little content). A third choice, I suppose is putting extra effort in the content in order to make sure that organizing the content such that it is more or less evenly distributed from page to page. However, this can be difficult to do (say, when the very first tab contains only a choice of three things, and then branches off from there; there are probably other examples), and hard to maintain this balance if any of the content changes later. Can you recommend a good approach? A link to a relevant good blog post or a chapter of a book is also welcome. Let me know if you have questions.

  Read the article

• QNAP TS-419p as a VPN Gateway?

  - by heisenberg

  Hello, I am hoping one of you might be able to help. I want to make files stored on shared folders on a QNAP TS-409p available to users over a VPN link. How is the possible? Can someone explain what I need to do. What do I need to do at the router and what do I need to do on the QNAP NAS? Effectively, what I want do do is use the built in Windows vpn client to connect to my home network and then be able to browse the shared folders. Thanks in advance.

  Read the article

• How to make the internal subwoofer work on an Asus G73JW?

  - by CodyLoco

  I have an Asus G73JW laptop which has an internal subwoofer built-in. Currently, the system detects the internal speakers as a 2.0 system (or I can change do 4.0 is the only other option). I found a bug report here: https://bugs.launchpad.net/ubuntu/+source/alsa-driver/+bug/673051 which discusses the bug and according to them a fix was sent upstream back at the end of 2010. I would have thought this would have made it into 12.04 but I guess not? I tried following the link given at the very bottom to install the latest ALSA drivers, here: https://wiki.ubuntu.com/Audio/InstallingLinuxAlsaDriverModules however I keep running into an error when trying to install: sudo apt-get install linux-alsa-driver-modules-$(uname -r) Reading package lists... Done Building dependency tree Reading state information... Done E: Unable to locate package linux-alsa-driver-modules-3.2.0-24-generic E: Couldn't find any package by regex 'linux-alsa-driver-modules-3.2.0-24-generic' I believe I have added the repository correctly: sudo add-apt-repository ppa:ubuntu-audio-dev/ppa [sudo] password for codyloco: You are about to add the following PPA to your system: This PPA will be used to provide testing versions of packages for supported Ubuntu releases. More info: https://launchpad.net/~ubuntu-audio-dev/+archive/ppa Press [ENTER] to continue or ctrl-c to cancel adding it Executing: gpg --ignore-time-conflict --no-options --no-default-keyring --secret-keyring /tmp/tmp.7apgZoNrqK --trustdb-name /etc/apt/trustdb.gpg --keyring /etc/apt/trusted.gpg --primary-keyring /etc/apt/trusted.gpg --keyserver hkp://keyserver.ubuntu.com:80/ --recv 4E9F485BF943EF0EABA10B5BD225991A72B194E5 gpg: requesting key 72B194E5 from hkp server keyserver.ubuntu.com gpg: key 72B194E5: public key "Launchpad Ubuntu Audio Dev team PPA" imported gpg: Total number processed: 1 gpg: imported: 1 (RSA: 1) And I also ran an update as well (followed the instructions on the fix above). Any ideas?

  Read the article

• Only allow root to change filesystem

  - by Uejji

  The VPS I manage uses a simple hard link rsync archive daily backup system saved to a loop file. This is great, because each backup only takes up as much space as what has changed each day, and all user/group permissions are kept. I would like to give users direct access to their home directories in each backup, but I'm worried about intentional or accidental backup data destruction, as how it stands now users can actually change, destroy or add to backed up data they originally owned. I've been looking for a way to mount this filesystem similar to an ro mount option, but something that would still allow rw access to root, but I've had absolutely no luck. In other words, I want users to be able to view and copy their backed up data without actually being able to change it, and have that data maintain the original permissions. I've got no real preferences as far as filesystem, as long as it's a standard unix filesystem that can preserve permissions, support hard links and deny write access to users without actually stripping the w permission from everything.

  Read the article

• Software for Company internal Website [closed]

  - by LordT

  hope this is the right stackexchange site to ask this: We've a group of webpages/services at work (SE Startup), ranging from SVN, trac, continous integration to link collections to a DMS. Nearly everything has an RSS Feed to get the info I need, with the exception of SVN. I'm looking for some kind of software that can integrate these well on a kind of start-page. The most recent changes, upcoming events etc should be clearly visible, as well as an option to search (the search will be provided from a different tool). A news area should be included as well. Currently, I'm pondering doing this with either wordpress or TWiki, although wordpress seems to be the simpler solution in terms of getting something good looking quickly. Authentication should be handled by HTTP-Basic Auth, which we already have in place and working well. I normally would consider Sharepoint a viable option for this, but we're exclusively mac and linux, I won't put up a windows server just for this.

  Read the article

• Firefox 11 Bookmarks Toolbar too Tall

  - by tba

  After updating to Firefox 11, my Bookmarks Toolbar is unpleasantly tall. This link implies that it's due to the presence of separators in my toolbar. I tried adding the suggested CSS in post 5 to my userChrome.css file, but this did nothing. I have also tried #PersonalToolbar {max-height:10px !important;} But this simply truncates the bottom of the toolbar. Does anyone know how to change the size of the bookmarks toolbar to match Firefox 10? More info: Here is a screenshot of my Bookmarks Toolbar. I'm using OSX 10.6.8 with the default theme. I have "View Toolbars Customize Use small icons" enabled. I'm also using the LiveClick 0.4.2.0 extension, but disabling it does not fix the issue.

  Read the article

• Upgrading Fedora on Amazon to 12 but getting libssl.so.* & libcrypto.so.* are missing

  - by bateman_ap

  I am upgrading to Fedora 12 on a Amazon EC2 using help here: http://www.ioncannon.net/system-administration/894/fedora-12-bootable-root-ebs-on-ec2/ I managed to do a 64 bit instance OK, however facing some problems with a standard one. On the final bit of the install from 11 to 12 I am getting an error: Error: Missing Dependency: libcrypto.so.8 is needed by package httpd-tools-2.2.1.5-1.fc11.1.i586 (installed) Error: Missing Dependency: libssl.so.8 is needed by package httpd-tools-2.2.1.5-1.fc11.1.i586 (installed) This is referenced in the comments from the link above but all it says is: Q: Apache failed, or libssl.so.* & libcrypto.so.* are missing A: These versions are mssing the symlinks they require. Easy fix, go symlink them to the newest versions in /lib However I am afraid I don't know how to do this. If it is any help I tried running the command locate libssl.so and got: /lib/libssl.so.0.9.8b /lib/libssl.so.6

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Error page for OWA users on a different server?

  - by W_P

  We are getting ready to do a network-wide upgrade to Exchange 2010. The url for the old 2007 mailboxes is at https://mail.example.com and users who have had their mail box moved will have to go to https://Email.example.com If a user that has a 2010 mailbox attempts to login at the 2007 OWA location, they get a standard 403 Forbidden page. We would like to show them a page of our own making, that includes a link to the 2010 OWA login page. I assumed we could do this with an IIS Custom Error page, but setting the 403.4 error page in IIS on the Default web site doesn't seem to be working. Does anyone know how we could get around this? BTW, our OWA for the 2007 boxes in on Windows Server 2003, and IIS 6

  Read the article

• VPN PPTPD with MPPE Support for Debian or Ubuntu

  - by user78395

  Having an unencrypted vpn connection from a windows client to linux is pretty easy by using pptpd. When I was looking for an solution for encrypted (per MPPE) connection, I found a lot of information about patching the kernel etc. - so it definitly works after some work. But all these information is pretty old (2005-2006). Is it the same solution nowadays? I am not asking for a complete instruction (only if it's short) - I am more asking for a link to the right solution.

  Read the article

• Microsoft Outlook 2007 Limit attachment size

  - by tasmanian_devil

  I have qmail server and authetication on Active Directory. All clients use Microsoft Outlook 2007 as default mail client. A have one central location and several remote location wich are connected with slow link speed connection. I have attachment limit on qmail, but i have problem when client attach file localy and send mail, attachment is been uploaded to qmail server and rejected because exceeded limit. Is it possible to limit attachment localy on MS Outlook 2007? I know that Office 2010 have attachment limitation but i think that is not working on Office 2007.

  Read the article

• Loign Scren hangs after entering password in Ubuntu 12.04

  - by Ravi

  When I enter my password in the login box nothing happens. It is stucked there. It was running fine earlier. Actually, I installed the package gnome-panel and cairo-dock. Then I logged out and selected gnome classic session. Then I added a ppa from the webupd8.org to install the themes(link). I opened Ubuntu Tweak tool. When I changed the theme to Evolve the whole laptop stopped responding. None of my keyboard and mouse was working. So I was forced to do a forced shutdown. Now after restart I cannot login into ubuntu. I hear a loud sound of my laptop fan when the laptop is stucked. (Probably CPU will be at 100% when it stucked). Please help me. How can I login back to ubuntu? I am using ubuntu 12.04 and have installed all the latest updates..

  Read the article

• Mail.app slow to include new messages

  - by Chris Tompsett

  With Leopard I was able to link to the University's Exchange 2003 server with and IMAP connection and mail out directly vie the SMTP client. With Snow Leopard I attempted to update to a full Exchange service (Exchange 2007). Almost all has worked OK (ical, address, etc.) except that new mail posted to my email account, which is visible using a 'web' interface to Exchange remains invisible for some random number of hours. Those who are running the Exchange server have no interest in discussing the problem. Has anyone else had a similar experience?

  Read the article

• Ubuntu 12.04 startup is slow and dmesg output seems to lose several seconds

  - by cdowen

  I use ubuntu on Dell Inspiron n4050.I have upgraded to ubuntu 12.04 from 10.04. But now I find the system startup is a little slow and plymouth only show purple screen without logo during startup. When I use dmesg, it shows such messages: [ 2.497750] EXT4-fs (sda1): mounted filesystem with ordered data mode. Opts: (null) [ 2.603028] usb 2-1.6: new high-speed USB device number 3 using ehci_hcd [ 2.715538] Initializing USB Mass Storage driver... [ 2.715594] usbcore: registered new interface driver usb-storage [ 2.715596] USB Mass Storage support registered. [ 21.317843] Adding 2000892k swap on /dev/sda5. Priority:-1 extents:1 across:2000892k [ 21.323724] ADDRCONF(NETDEV_UP): eth0: link is not ready [ 21.391450] udevd[431]: starting version 175 I wonder what it is doing between 2 second and 21 second. Is it related to being so slow? I tried bootchart. It gave me a complex picture. Sorry I can't post it here. http://3.bp.blogspot.com/-7LX8T5uQvlw/UKhdFMVkp4I/AAAAAAAAADg/dtxePkE94mg/s320/lengzhen-ubuntu-precise-20121118-1.png While ubuntu is booting , I also noticed that it appears:/tmp is not ready or present And sometimes follows *Stop saving kernel messages. Is this the reason dmesg lost output?

  Read the article

• Why are my Google searches redirected?

  - by Please Help

  This machine was infected with various malware. I have scanned the system with Malwarebytes. It found and removed some 600 or so infected files. Now the machine seems to be running well with only one exception. Some Google search results are being redirected to some shady search engines. If I were to copy the url from the Google Search results and paste it in the address bar it would go to the correct site but if I click the link I will be redirected somewhere else. Here is my log file from HijackThis: http://pastebin.com/ZE3wiCrk

  Read the article

• Windows 8 Program Sharing?

  - by Martin W. Seitz

  How do I, as the administrator, share the Skype program with a user on the same PC? I tried to download Skype to the user from the windows store that said it was blocked and I must contact the administrator. The Skype icon appears on the user desktop but with an X in the corner with no way to allow it to work as the administrator. In the administrator desktop the Skype icon appears without the x and it does work. I have tried to research this issue and so far all I have been able to find and do is the enable $admin share at this link http://www.intelliadmin.com/index.php/2012/10/windows-8-enable-the-admin-share/ Now that I have done this how do I use it to share the Skype program? Thanks in advance. Marty Seitz

  Read the article

< Previous Page | 566 567 568 569 570 571 572 573 574 575 576 577  | Next Page >