Search Results

Search found 21463 results on 859 pages for 'broken link'.

Page 571/859 | < Previous Page | 567 568 569 570 571 572 573 574 575 576 577 578  | Next Page >

  • What is your approach to draw a representation of your network ?

    - by Kartoch
    Hello, I'm looking to the community to see how people are drawing their networks, i.e. using symbols to represent complex topology. You can have hardware approach, where every hardware unit are represented. You can also have "entity" approach, where each "service" is shown. Both are interesting but it is difficult to have both on the same schema (but this is needed, especially using virtualization environment). Furthermore, it is difficult to have complex informations on such representation. For instance security parameters (encrypted link, need for authentication) or specific details (protocol type, ports, encapsulation). So my question is: where your are drawing a representation of your network, what is your approach ? Are you using methodology and/or specific softwares ? What is your recommendations for information to put (or not) ? How to deal with the complexity when the network becomes large and/or you want to put a lot of information on it ? Examples and links to good references will be appreciated.

    Read the article

  • reaching 99.9999% uptime

    - by christopher-mccann
    I am currently developing a project which is mission-critical. The actual domain name is registered with 1 & 1 and I plan on purchasing DynDNS Custom DNS service (which has 5 different geographical locations for DNS) and then another secondary DNS service to make sure my DNS is as failover safe as possible. Does it matter that the registration is with 1 & 1 - are they a weak link in the chain? All I really use them for is to say that DynDNS is my primary DNS nameserver and then my secondary DNS is my other nameserver. I can transfer the registration to DynDNS - Im just not sure if it really matters or not. Thanks

    Read the article

  • How to make the internal subwoofer work on an Asus G73JW?

    - by CodyLoco
    I have an Asus G73JW laptop which has an internal subwoofer built-in. Currently, the system detects the internal speakers as a 2.0 system (or I can change do 4.0 is the only other option). I found a bug report here: https://bugs.launchpad.net/ubuntu/+source/alsa-driver/+bug/673051 which discusses the bug and according to them a fix was sent upstream back at the end of 2010. I would have thought this would have made it into 12.04 but I guess not? I tried following the link given at the very bottom to install the latest ALSA drivers, here: https://wiki.ubuntu.com/Audio/InstallingLinuxAlsaDriverModules however I keep running into an error when trying to install: sudo apt-get install linux-alsa-driver-modules-$(uname -r) Reading package lists... Done Building dependency tree Reading state information... Done E: Unable to locate package linux-alsa-driver-modules-3.2.0-24-generic E: Couldn't find any package by regex 'linux-alsa-driver-modules-3.2.0-24-generic' I believe I have added the repository correctly: sudo add-apt-repository ppa:ubuntu-audio-dev/ppa [sudo] password for codyloco: You are about to add the following PPA to your system: This PPA will be used to provide testing versions of packages for supported Ubuntu releases. More info: https://launchpad.net/~ubuntu-audio-dev/+archive/ppa Press [ENTER] to continue or ctrl-c to cancel adding it Executing: gpg --ignore-time-conflict --no-options --no-default-keyring --secret-keyring /tmp/tmp.7apgZoNrqK --trustdb-name /etc/apt/trustdb.gpg --keyring /etc/apt/trusted.gpg --primary-keyring /etc/apt/trusted.gpg --keyserver hkp://keyserver.ubuntu.com:80/ --recv 4E9F485BF943EF0EABA10B5BD225991A72B194E5 gpg: requesting key 72B194E5 from hkp server keyserver.ubuntu.com gpg: key 72B194E5: public key "Launchpad Ubuntu Audio Dev team PPA" imported gpg: Total number processed: 1 gpg: imported: 1 (RSA: 1) And I also ran an update as well (followed the instructions on the fix above). Any ideas?

    Read the article

  • Microsoft Outlook 2007 Limit attachment size

    - by tasmanian_devil
    I have qmail server and authetication on Active Directory. All clients use Microsoft Outlook 2007 as default mail client. A have one central location and several remote location wich are connected with slow link speed connection. I have attachment limit on qmail, but i have problem when client attach file localy and send mail, attachment is been uploaded to qmail server and rejected because exceeded limit. Is it possible to limit attachment localy on MS Outlook 2007? I know that Office 2010 have attachment limitation but i think that is not working on Office 2007.

    Read the article

  • Excel Single column into rows, VBA script insight

    - by Sanityvoid
    Okay, so much similiar to the below link but mine is a bit different. Paginate Rows into Columns in Excel I have a lot of data in column A, I want to take every 14 to 15 rows and make them a new row with multiple columns. I'm trying to get it into a format where SQL can intake the data. I figured the best way was to get them into rows then make a CSV with the data. So it would like like below: (wow, the format totally didn't stick when posting) column A column B C D etc 1 1 2 3 x 2 16 17 a b 3 x y z 15 16 17 a b c I can clarify if needed, but I'm stumped on how to get the data out of the single column with so many rows in the column. Thanks for the help!!!

    Read the article

  • Error page for OWA users on a different server?

    - by W_P
    We are getting ready to do a network-wide upgrade to Exchange 2010. The url for the old 2007 mailboxes is at https://mail.example.com and users who have had their mail box moved will have to go to https://Email.example.com If a user that has a 2010 mailbox attempts to login at the 2007 OWA location, they get a standard 403 Forbidden page. We would like to show them a page of our own making, that includes a link to the 2010 OWA login page. I assumed we could do this with an IIS Custom Error page, but setting the 403.4 error page in IIS on the Default web site doesn't seem to be working. Does anyone know how we could get around this? BTW, our OWA for the 2007 boxes in on Windows Server 2003, and IIS 6

    Read the article

  • Firefox 11 Bookmarks Toolbar too Tall

    - by tba
    After updating to Firefox 11, my Bookmarks Toolbar is unpleasantly tall. This link implies that it's due to the presence of separators in my toolbar. I tried adding the suggested CSS in post 5 to my userChrome.css file, but this did nothing. I have also tried #PersonalToolbar {max-height:10px !important;} But this simply truncates the bottom of the toolbar. Does anyone know how to change the size of the bookmarks toolbar to match Firefox 10? More info: Here is a screenshot of my Bookmarks Toolbar. I'm using OSX 10.6.8 with the default theme. I have "View Toolbars Customize Use small icons" enabled. I'm also using the LiveClick 0.4.2.0 extension, but disabling it does not fix the issue.

    Read the article

  • Enabling Office SharePoint Server Publishing Infrastructure Breaks Navigation

    - by swagers
    I'm migrating from WSS 3.0 to MOSS 2007, below are the steps I took to migrate. Backed up the content database of our WSS 3.0 site. Restored the database on our MOSS 2007 database server Create a new Web Application on our MOSS 2007 server and pointed the database to the newly restored database. Everything works correctly on the new server. I enabled Office SharePoint Server Publishing Infrastructure and navigations stops working correctly. Where it use to say Home it now says /. When I clicked on a link to any sub sites the top navigations reduces down to one button that says Error. Also any sub site navigation on the side bar reads Error. When I disable Office SharePoint Server Publishing Infrastructure everything goes back to the way it was.

    Read the article

  • Chrome tabs showing wrong page

    - by Jeff
    I have a problem with Google Chrome where occasionally when switching to a newly created tab (usually one made from opening a link into a new tab), the wrong page shows. The correct page is functional, links and other functions are present, but I cannot see them because Chrome seems to be reading the page I want but showing another. Sometimes it is identical to the tab I just left, sometimes it shows the content of a previously closed tab. The problem sorts out when I switch to another tab and back, and then the correct page shows. This happens fairly often and is rather annoying. Some of my friends have also experienced this, and have stopped using Chrome because of it. If anybody else has seen this problem and happens to know a fix, I'd really appreciate it.

    Read the article

  • Mail.app slow to include new messages

    - by Chris Tompsett
    With Leopard I was able to link to the University's Exchange 2003 server with and IMAP connection and mail out directly vie the SMTP client. With Snow Leopard I attempted to update to a full Exchange service (Exchange 2007). Almost all has worked OK (ical, address, etc.) except that new mail posted to my email account, which is visible using a 'web' interface to Exchange remains invisible for some random number of hours. Those who are running the Exchange server have no interest in discussing the problem. Has anyone else had a similar experience?

    Read the article

  • Simple CMS (separate files for multiple users) [closed]

    - by Pentium100
    I need a simple CMS software (or maybe it's called something else). There are many users (adding new users has to be simple as it will be done manually, no "sign up" link) and those users have to access (just download, no uploading or modification) some files. A file can be shown just to one user or a group of users (a user can belong to multiple groups). Upload a file and tag which users/groups can access it. This can probably be done with FTP, but HTTP would be better. Any software (preferable open source) that can do this without much modification? I can modify PHP code a bit, but I am not a programmer.

    Read the article

  • 1 ASPX Page, Multiple Master Pages

    - by csmith18119
    So recently I had an ASPX page that could be visited by two different user types.  User type A would use Master Page 1 and user type B would use Master Page 2.  So I put together a proof of concept to see if it was possible to change the MasterPage in code.  I found a great article on the Microsoft ASP.net website. Specifying the Master Page Programmatically (C#) by Scott Mitchell So I created a MasterPage call Alternate.Master to act as a generic place holder.  I also created a Master1.Master and a Master2.Master.  The ASPX page, Default.aspx will use this MasterPage.  It will also use the Page_PreInit event to programmatically set the MasterPage.  1: protected void Page_PreInit(object sender, EventArgs e) { 2: var useMasterPage = Request.QueryString["use"]; 3: if (useMasterPage == "1") 4: MasterPageFile = "~/Master1.Master"; 5: else if (useMasterPage == "2") 6: MasterPageFile = "~/Master2.Master"; 7: }   In my Default.aspx page I have the following links in the markup: 1: <p> 2: <asp:HyperLink runat="server" ID="cmdMaster1" NavigateUrl="~/Default.aspx?use=1" Text="Use Master Page 1" /> 3: </p> 4: <p> 5: <asp:HyperLink runat="server" ID="cmdMaster2" NavigateUrl="~/Default.aspx?use=2" Text="Use Master Page 2" /> 6: </p> So the basic idea is when a user clicks the HyperLink to use Master Page 1, the default.aspx.cs code behind will set the property MasterPageFile to use Master1.Master.  The same goes with the link to use Master Page 2.  It worked like a charm!  To see the actual code, feel free to download a copy here: Project Name: Skyhook.MultipleMasterPagesWeb http://skyhookprojectviewer.codeplex.com

    Read the article

  • Proper way to do texture mapping in modern OpenGL?

    - by RubyKing
    I'm trying to do texture mapping using OpenGL 3.3 and GLSL 150. The problem is the texture shows but has this weird flicker I can show a video here. My texcords are in a vertex array. I have my fragment color set to the texture values and texel values. I have my vertex shader sending the texture cords to texture cordinates to be used in the fragment shader. I have my ins and outs setup and I still don't know what I'm missing that could be causing that flicker. Here is my code: Fragment shader #version 150 uniform sampler2D texture; in vec2 texture_coord; varying vec3 texture_coordinate; void main(void) { gl_FragColor = texture(texture, texture_coord); } Vertex shader #version 150 in vec4 position; out vec2 texture_coordinate; out vec2 texture_coord; uniform vec3 translations; void main() { texture_coord = (texture_coordinate); gl_Position = vec4(position.xyz + translations.xyz, 1.0); } Last bit Here is my vertex array with texture coordinates: GLfloat vVerts[] = { 0.5f, 0.5f, 0.0f, 0.0f, 1.0f, 0.0f, 0.5f, 0.0f, 1.0f, 1.0f, 0.0f, 0.0f, 0.0f, 0.0f, 0.0f, 0.5f, 0.0f, 0.0f, 1.0f, 0.0f}; //tex x and y If you need to see all the code, here is a link to every file. Thank you for your help.

    Read the article

  • Lookups targeting merged cells - only returning value for first row

    - by Ian
    I have a master worksheet which contains data that I wish to link to another 'summary' sheet using a lookup. However, some of the cells whose data I wish to include in the summary sheet are merged across two or more adjacent rows. To be clear, the 'primary' column A that I am using in my formula in order to identify the target row does not contain merged cells, but the column from which I wish to return a value does. I have tried VLOOKUP and INDEX+MATCH. The problem is that the data is only returned for the first row's key, and the others return zero (as though the cell in the target column were blank, where actually it is merged). I have tried inelegant ways around this, e.g. using IF statements to try to find the top row of the merged cell. However, these don't work well if the order of values in the summary sheet is different from that in the master sheet, as well as being messy. Can this be done?

    Read the article

  • My Router is fast when i reset it but slows down seconds later

    - by hglocke
    I have a Belkin N wireless router which until recently worked perfectly fine. Now i have to reset the router every few minutes, otherwise it slows down to a crawl. What can I do? I have tried turning the routers firewall off, but it does not make any difference. As far as I'm aware there have been no recent firmware updates. EDIT: The other devices on my network (laptop and iphone) do not have this problem. I connect to the router using a TP-Link wireless network card and I have already tried uninstalling and installing the driver. Hopefully this will narrow down the problem significantly.

    Read the article

  • What is the world wide web? [closed]

    - by think123
    I don't know where to post this question, so please move it if necessary. Ok, so I've heard of how the professional hosting companies can create 'links' to the world wide web to register an unregistered domain. So that's where my question comes from. Is the world wide web a server to which servers link? Is it created by abstract linkage? I'm not sure. Also, what does it mean for the DNS to be updated throughout the whole world?

    Read the article

  • Garage Sale Code &ndash; Everything must go!

    - by mbcrump
    Garage Sale Code     The term “Garage Sale Code” came from a post by Scott Hanselman. He defines Garage Sale Code as: Complete – It’s a whole library or application. Concise – It does one discrete thing. Clear – It’ll work when you get it. Cheap – It’s free or < 25 cents. (Quite Possibly) Crap – As with a Garage Sale, you’ll never know until you get it home if it’s useless. With the code I’ve posted here, you’ll get all 5 of those things (with an emphasis on crap). All of the projects listed below are available on CodePlex with full source code and executables (for those that just want to run it).  I plan on keeping this page updated when I complete projects that benefit the community.  You can always find this page again by swinging by http://garagesale.michaelcrump.net or you can keep on driving and find another sale. Name Description Language/Technology Used WPF Alphabet WPF Alphabet is a application that I created to help my child learn the alphabet. It displays each letter and pronounces it using speech synthesis. It was developed using WPF and c# in about 3 hours (so its kinda rough). C#, WPF Windows 7 Playlist Generator This program allows you to quickly create wvx video playlist for Windows Media Center. This functionality is not included in WMC and is useful if you want to play video files back to back without selecting the next file. It is also useful to queue up video files to keep children occupied! C#, WinForms Windows 7 Automatic Playlist Creator This application is designed to create W7MC playlist automatically whenever you want. You can select if you want the playlist sorted Alphabetical, by Creation Date or Random. C#, WinForms, Console Generator Twitter Message for Live Writer This is a plug-in for Windows Live Writer that generates a twitter message with your blog post name and a TinyUrl link to the blog post. It will do all of this automatically after you publish your post. C#, LiveWriter API

    Read the article

  • When creating a GUI wizard, should all pages/tabs be of the same size? [closed]

    - by Job
    I understand that some libraries would force me to, but my question is general. If I have a set of buttons at the bottom: Back, Next, Cancel?, (other?), then should their location ever change? If the answer is no, then what do I do about pages with little content? Do I stretch things? Place them in the lone upper left corner? According to Steve Krug, it does not make sense to add anything to GUI that does not need to be there. I understand that there are different approaches to wizards - some have tabs, others do not. Some tabs are lined horizontally at the top; others - vertically on the left. Some do not show pages/tabs, and are simply sequences of dialogs. This is probably a must when the wizard is "non-linear", e.g. some earlier choices can result in branching. Either way the problem is the same - sacrifice on the consistency of the "big picture" (outline of the page/tab + location of buttons), or the consistency of details (some tabs might be somewhat packed; others having very little content). A third choice, I suppose is putting extra effort in the content in order to make sure that organizing the content such that it is more or less evenly distributed from page to page. However, this can be difficult to do (say, when the very first tab contains only a choice of three things, and then branches off from there; there are probably other examples), and hard to maintain this balance if any of the content changes later. Can you recommend a good approach? A link to a relevant good blog post or a chapter of a book is also welcome. Let me know if you have questions.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Ubuntu 12.04 startup is slow and dmesg output seems to lose several seconds

    - by cdowen
    I use ubuntu on Dell Inspiron n4050.I have upgraded to ubuntu 12.04 from 10.04. But now I find the system startup is a little slow and plymouth only show purple screen without logo during startup. When I use dmesg, it shows such messages: [ 2.497750] EXT4-fs (sda1): mounted filesystem with ordered data mode. Opts: (null) [ 2.603028] usb 2-1.6: new high-speed USB device number 3 using ehci_hcd [ 2.715538] Initializing USB Mass Storage driver... [ 2.715594] usbcore: registered new interface driver usb-storage [ 2.715596] USB Mass Storage support registered. [ 21.317843] Adding 2000892k swap on /dev/sda5. Priority:-1 extents:1 across:2000892k [ 21.323724] ADDRCONF(NETDEV_UP): eth0: link is not ready [ 21.391450] udevd[431]: starting version 175 I wonder what it is doing between 2 second and 21 second. Is it related to being so slow? I tried bootchart. It gave me a complex picture. Sorry I can't post it here. http://3.bp.blogspot.com/-7LX8T5uQvlw/UKhdFMVkp4I/AAAAAAAAADg/dtxePkE94mg/s320/lengzhen-ubuntu-precise-20121118-1.png While ubuntu is booting , I also noticed that it appears:/tmp is not ready or present And sometimes follows *Stop saving kernel messages. Is this the reason dmesg lost output?

    Read the article

  • Why doesn't wireless work on Wubi 12.04 with a Broadcom BCM4312 card?

    - by Kristin
    I have recently set up ubuntu 12.04 on my laptop using the Wubi installer. I am having a very difficult time setting up a wireless internet connection. I am currently set up with an ethernet connection which I have used to download all new updates and to activate the Broadcom STA wireless driver. I have tried several things in the terminal based on other people's posts: ~$ rfkill list 0: brcmwl-0: Wireless LAN Soft blocked: no Hard blocked: yes ~$ rfkill unblock all It doesn't change anything. I also tried rebooting and connecting to the internet on my Windows Vista OS, and it worked, so I know that the connection should not be hard blocked. I have also tried installing b43 firmware (lp/phy version) that is supposed to work with my chip (BCM4312). It seems to have no effect. Then I tried: ~$ iwconfig lo no wireless extensions. eth1 IEEE 802.11 Access Point: Not-Associated Link Quality:5 Signal level:0 Noise level:0 Rx invalid nwid:0 invalid crypt:0 invalid misc:0 eth0 no wireless extensions. This is my first time trying to work with ubuntu, so I would appreciate any help. Thanks. Also sorry this is poorly formatted. I'm having troubles with that too.

    Read the article

  • How to work with processes?

    - by Viesturs
    I have seen similar questions here, but I didn't get my answer. Maybe it's because I am new to all this and just don't understand. I want my app to work mostly as an indicator. And if user would start it again it would check if it is already running, if it is then give all the input data to that process and quit. So first I need to check if it is running. I saw the answer where you can make a file witch when the program starts and then check if it exists... But what if someone would delete it? Can't I just ask the OS if there is process named "myApp" or something? The next thing I don't really get is how to communicate with the process. How do I give it the input data and what is it going to do with it? Does it work just like starting a new app, through the main() method? I am trying to create this using Quickly. So it would be nice if you can give me some python examples or link to something like that.

    Read the article

  • Linux server failover

    - by Lukasz
    I have two Linux servers (CentOS6) - both are identically configured connected to the same switch with a direct link between them. I only have one external IP that is assigned to eth0 on both servers (connected to the internet switch) with the interface shutdown on server 2. How can I failover to server 2 if server 1 dies - as stated they are linked directly so they can check for availability of each other via ping/tcp/udp. I toyed with Heartbeat but the documentation seems to be non-existent - not sure how to bring up an interface and start some services if the other server dies.

    Read the article

  • NetworkManager detects no networks with a RTL8188CE

    - by Cormac O'Brien
    I'm on a 2011 Lenovo Thinkpad T420i with a Realtek RTL8188CE WiFi adapter. Here's the scenario: I pop in the Ubuntu LiveCD to install. Laptop detects all networks in range, I connect to my home network, internet working great. Once Ubuntu finishes installing, the home network I am connected to is the only one which appears in the applet list. Upon restarting or waking from suspend, NetworkManager does not detect any networks – it simply displays "Disconnected" under the Wireless Network section of the menu. I am able to connect to my home network by using the "Connect to Hidden Wireless Network" option and it works immediately. I have yet to test if this works with other SSIDs. I have tried reinstalling the entire OS as well as NetworkManager and my wireless drivers. For hardware info, I ran: cormac@cormac-T420:~$ sudo lshw -c network Here is the output for my wireless card: *-network description: Wireless interface product: RTL8188CE 802.11b/g/n WiFi Adapter vendor: Realtek Semiconductor Co., Ltd. physical id: 0 bus info: pci@0000:03:00.0 logical name: wlan0 version: 01 serial: d0:df:9a:08:73:50 width: 64 bits clock: 33MHz capabilities: pm msi pciexpress bus_master cap_list ethernet physical wireless configuration: broadcast=yes driver=rtl8192ce driverversion=3.2.0-26-generic firmware=N/A ip=192.168.1.138 latency=0 link=yes multicast=yes wireless=IEEE 802.11bgn resources: irq:17 ioport:5000(size=256) memory:f2500000-f2503fff I can provide more information if required. This was not a problem in Natty or Oneiric. I hope this can be fixed, I don't want to have to ask for an SSID wherever I need to connect.

    Read the article

  • Bonding and default gateway problem (CentOS)

    - by lg
    I configured network bonding on two machine with centos 5.5. Bonding works well, but the problem is default gateway: it is not configured! I follow this tutorial. I added GATEWAY in both (and either) /etc/sysconfig/network and /etc/sysconfig/network-scripts/ifcfg-bond0. But, when I restart network (or server) there is no default gateway (route command). This is ip route ls output after network restart: 10.0.0.0/16 dev bond0 proto kernel scope link src 10.0.0.88 Where is my mistake?

    Read the article

< Previous Page | 567 568 569 570 571 572 573 574 575 576 577 578  | Next Page >