Search Results

Search found 21463 results on 859 pages for 'broken link'.

Page 571/859 | < Previous Page | 567 568 569 570 571 572 573 574 575 576 577 578  | Next Page >

• Firefox 11 Bookmarks Toolbar too Tall

  - by tba

  After updating to Firefox 11, my Bookmarks Toolbar is unpleasantly tall. This link implies that it's due to the presence of separators in my toolbar. I tried adding the suggested CSS in post 5 to my userChrome.css file, but this did nothing. I have also tried #PersonalToolbar {max-height:10px !important;} But this simply truncates the bottom of the toolbar. Does anyone know how to change the size of the bookmarks toolbar to match Firefox 10? More info: Here is a screenshot of my Bookmarks Toolbar. I'm using OSX 10.6.8 with the default theme. I have "View Toolbars Customize Use small icons" enabled. I'm also using the LiveClick 0.4.2.0 extension, but disabling it does not fix the issue.

  Read the article

• Proper way to do texture mapping in modern OpenGL?

  - by RubyKing

  I'm trying to do texture mapping using OpenGL 3.3 and GLSL 150. The problem is the texture shows but has this weird flicker I can show a video here. My texcords are in a vertex array. I have my fragment color set to the texture values and texel values. I have my vertex shader sending the texture cords to texture cordinates to be used in the fragment shader. I have my ins and outs setup and I still don't know what I'm missing that could be causing that flicker. Here is my code: Fragment shader #version 150 uniform sampler2D texture; in vec2 texture_coord; varying vec3 texture_coordinate; void main(void) { gl_FragColor = texture(texture, texture_coord); } Vertex shader #version 150 in vec4 position; out vec2 texture_coordinate; out vec2 texture_coord; uniform vec3 translations; void main() { texture_coord = (texture_coordinate); gl_Position = vec4(position.xyz + translations.xyz, 1.0); } Last bit Here is my vertex array with texture coordinates: GLfloat vVerts[] = { 0.5f, 0.5f, 0.0f, 0.0f, 1.0f, 0.0f, 0.5f, 0.0f, 1.0f, 1.0f, 0.0f, 0.0f, 0.0f, 0.0f, 0.0f, 0.5f, 0.0f, 0.0f, 1.0f, 0.0f}; //tex x and y If you need to see all the code, here is a link to every file. Thank you for your help.

  Read the article

• 1 ASPX Page, Multiple Master Pages

  - by csmith18119

  So recently I had an ASPX page that could be visited by two different user types.  User type A would use Master Page 1 and user type B would use Master Page 2.  So I put together a proof of concept to see if it was possible to change the MasterPage in code.  I found a great article on the Microsoft ASP.net website. Specifying the Master Page Programmatically (C#) by Scott Mitchell So I created a MasterPage call Alternate.Master to act as a generic place holder.  I also created a Master1.Master and a Master2.Master.  The ASPX page, Default.aspx will use this MasterPage.  It will also use the Page_PreInit event to programmatically set the MasterPage.  1: protected void Page_PreInit(object sender, EventArgs e) { 2: var useMasterPage = Request.QueryString["use"]; 3: if (useMasterPage == "1") 4: MasterPageFile = "~/Master1.Master"; 5: else if (useMasterPage == "2") 6: MasterPageFile = "~/Master2.Master"; 7: }   In my Default.aspx page I have the following links in the markup: 1: <p> 2: <asp:HyperLink runat="server" ID="cmdMaster1" NavigateUrl="~/Default.aspx?use=1" Text="Use Master Page 1" /> 3: </p> 4: <p> 5: <asp:HyperLink runat="server" ID="cmdMaster2" NavigateUrl="~/Default.aspx?use=2" Text="Use Master Page 2" /> 6: </p> So the basic idea is when a user clicks the HyperLink to use Master Page 1, the default.aspx.cs code behind will set the property MasterPageFile to use Master1.Master.  The same goes with the link to use Master Page 2.  It worked like a charm!  To see the actual code, feel free to download a copy here: Project Name: Skyhook.MultipleMasterPagesWeb http://skyhookprojectviewer.codeplex.com

  Read the article

• VPN PPTPD with MPPE Support for Debian or Ubuntu

  - by user78395

  Having an unencrypted vpn connection from a windows client to linux is pretty easy by using pptpd. When I was looking for an solution for encrypted (per MPPE) connection, I found a lot of information about patching the kernel etc. - so it definitly works after some work. But all these information is pretty old (2005-2006). Is it the same solution nowadays? I am not asking for a complete instruction (only if it's short) - I am more asking for a link to the right solution.

  Read the article

• Upgrading Fedora on Amazon to 12 but getting libssl.so.* & libcrypto.so.* are missing

  - by bateman_ap

  I am upgrading to Fedora 12 on a Amazon EC2 using help here: http://www.ioncannon.net/system-administration/894/fedora-12-bootable-root-ebs-on-ec2/ I managed to do a 64 bit instance OK, however facing some problems with a standard one. On the final bit of the install from 11 to 12 I am getting an error: Error: Missing Dependency: libcrypto.so.8 is needed by package httpd-tools-2.2.1.5-1.fc11.1.i586 (installed) Error: Missing Dependency: libssl.so.8 is needed by package httpd-tools-2.2.1.5-1.fc11.1.i586 (installed) This is referenced in the comments from the link above but all it says is: Q: Apache failed, or libssl.so.* & libcrypto.so.* are missing A: These versions are mssing the symlinks they require. Easy fix, go symlink them to the newest versions in /lib However I am afraid I don't know how to do this. If it is any help I tried running the command locate libssl.so and got: /lib/libssl.so.0.9.8b /lib/libssl.so.6

  Read the article

• What is the 'cacert.pem' and for what to use that?

  - by user65567

  I am developing a web application on localhost with domains and sub-domains and I would like to use a HTTPS connection. On my Mac OS, in order to enable SSL, I need to set Apache correctly, so I followed some guide to accomplish part of that. Now it is time to choose a certificate in order to test HTTPS requests. I seen the cacert.pem, but I don't know how to use that and for what it is used (can you explain to me some about its usage?)... So, is it possible to use the cacert.pem (see the link) for all my domains and subdomains (maybe, as a wildcard certificate) on localhost? If so, how to do that? What certificate I have to take and use? If no, what I need to do in order to use a wildcard certificate for all my domains and subdomains on localhost? Of course those certificates must be accepted by browsers and working for HTTPS connection between my domains.

  Read the article

• Software for Company internal Website [closed]

  - by LordT

  hope this is the right stackexchange site to ask this: We've a group of webpages/services at work (SE Startup), ranging from SVN, trac, continous integration to link collections to a DMS. Nearly everything has an RSS Feed to get the info I need, with the exception of SVN. I'm looking for some kind of software that can integrate these well on a kind of start-page. The most recent changes, upcoming events etc should be clearly visible, as well as an option to search (the search will be provided from a different tool). A news area should be included as well. Currently, I'm pondering doing this with either wordpress or TWiki, although wordpress seems to be the simpler solution in terms of getting something good looking quickly. Authentication should be handled by HTTP-Basic Auth, which we already have in place and working well. I normally would consider Sharepoint a viable option for this, but we're exclusively mac and linux, I won't put up a windows server just for this.

  Read the article

• Smart Phones Shockingly Energy Efficient; Lead to Decreased Household Power Consumption

  - by Jason Fitzpatrick

  Given how often our smart phones and tablets spend plugged in and topping off their battery reserves, it’s easy to assume they’re sucking down a lot of power. Analysis shows the lilliputian but powerful devices are surprisingly efficient and may be decreasing our overall power consumption. Courtesy of energy-centric blog Outlier, we’re treated to a look at the power sipping habits of popular smart phones and mobile devices. The simple take away? They use shockingly little electricity over the course of the year–you can charge your new iPhone for a year of regular usage for under a buck. The more complex analysis? The proliferation of tiny and energy efficient devices is displacing heavier energy consumers (large televisions, desktop computers, etc.) and driving a more efficient gadget-to-consumption ratio is many households. Hit up the link below to read the full post. How Much Does It Take to Charge an iPhone [via Mashable] 7 Ways To Free Up Hard Disk Space On Windows HTG Explains: How System Restore Works in Windows HTG Explains: How Antivirus Software Works

  Read the article

• How to migrate Notepad++ settings?

  - by NoCatharsis

  I am trying to portabilize every program I use if possible, and Notepad++ is on the list. The only problem is that I've had a native installation until now so that I'm not totally sure which settings files need to be moved to the portable directory. Surely there's a function tucked away somewhere in NPP exactly for this purpose, or some plugin out there? I mean the developers have literally thought of everything else, yet this is the one thing I cannot find specifically anywhere in the NPP wiki or otherwise, and I don't want to miss an important file. Here is the closest I've gotten: Notepad++'s configuration files and Where are all the files? Should I just copy every configuration file listed on the first link?

  Read the article

• Error page for OWA users on a different server?

  - by W_P

  We are getting ready to do a network-wide upgrade to Exchange 2010. The url for the old 2007 mailboxes is at https://mail.example.com and users who have had their mail box moved will have to go to https://Email.example.com If a user that has a 2010 mailbox attempts to login at the 2007 OWA location, they get a standard 403 Forbidden page. We would like to show them a page of our own making, that includes a link to the 2010 OWA login page. I assumed we could do this with an IIS Custom Error page, but setting the 403.4 error page in IIS on the Default web site doesn't seem to be working. Does anyone know how we could get around this? BTW, our OWA for the 2007 boxes in on Windows Server 2003, and IIS 6

  Read the article

• How can I make .vimrc read from an external file?

  - by GorillaSandwich

  I'd like to modify my .vimrc to read the value of a variable from an external file. How can I do this? Specifically, a friend and I share a git repo with our .vim files, but there are a few small differences in what we want in our configs. So most of the file is common, but we use if statements to determine whether to load user-specific sections, like this: let whoami = "user2" if whoami == "user1" ... After checking our common .vimrc out of source control, we each have to change the let whoami assignment so our own section will be loaded. Instead, I'd like to keep a separate file, which can be different for each of us, and from which vim will load that variable value. Maybe another angle on this is: Will vim automatically read all the files in my .vim directory? If so, we could each put a symlink in there called username.vim, and link that to an external file that would be different for each of us.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Simple CMS (separate files for multiple users) [closed]

  - by Pentium100

  I need a simple CMS software (or maybe it's called something else). There are many users (adding new users has to be simple as it will be done manually, no "sign up" link) and those users have to access (just download, no uploading or modification) some files. A file can be shown just to one user or a group of users (a user can belong to multiple groups). Upload a file and tag which users/groups can access it. This can probably be done with FTP, but HTTP would be better. Any software (preferable open source) that can do this without much modification? I can modify PHP code a bit, but I am not a programmer.

  Read the article

• What is the world wide web? [closed]

  - by think123

  I don't know where to post this question, so please move it if necessary. Ok, so I've heard of how the professional hosting companies can create 'links' to the world wide web to register an unregistered domain. So that's where my question comes from. Is the world wide web a server to which servers link? Is it created by abstract linkage? I'm not sure. Also, what does it mean for the DNS to be updated throughout the whole world?

  Read the article

• How to monitor nginx proxy cache?

  - by Isaac

  I would like to see which objects get cached by my nginx reverse proxy (with an apache as a backend). So far I could not find a way, only the info that its not implemented yet. The reason is that I would like to tweak my configuration for best performance without putting too much stress on the server, as the backend is a production system. I know benchmarking would be better, but its not an option right now. So I though an alternative measure would be to monitor the cache. Is that possible, and if yes, how? (despite patching nginx with the patch mentioned in the link above)

  Read the article

• Lookups targeting merged cells - only returning value for first row

  - by Ian

  I have a master worksheet which contains data that I wish to link to another 'summary' sheet using a lookup. However, some of the cells whose data I wish to include in the summary sheet are merged across two or more adjacent rows. To be clear, the 'primary' column A that I am using in my formula in order to identify the target row does not contain merged cells, but the column from which I wish to return a value does. I have tried VLOOKUP and INDEX+MATCH. The problem is that the data is only returned for the first row's key, and the others return zero (as though the cell in the target column were blank, where actually it is merged). I have tried inelegant ways around this, e.g. using IF statements to try to find the top row of the merged cell. However, these don't work well if the order of values in the summary sheet is different from that in the master sheet, as well as being messy. Can this be done?

  Read the article

• How to make the internal subwoofer work on an Asus G73JW?

  - by CodyLoco

  I have an Asus G73JW laptop which has an internal subwoofer built-in. Currently, the system detects the internal speakers as a 2.0 system (or I can change do 4.0 is the only other option). I found a bug report here: https://bugs.launchpad.net/ubuntu/+source/alsa-driver/+bug/673051 which discusses the bug and according to them a fix was sent upstream back at the end of 2010. I would have thought this would have made it into 12.04 but I guess not? I tried following the link given at the very bottom to install the latest ALSA drivers, here: https://wiki.ubuntu.com/Audio/InstallingLinuxAlsaDriverModules however I keep running into an error when trying to install: sudo apt-get install linux-alsa-driver-modules-$(uname -r) Reading package lists... Done Building dependency tree Reading state information... Done E: Unable to locate package linux-alsa-driver-modules-3.2.0-24-generic E: Couldn't find any package by regex 'linux-alsa-driver-modules-3.2.0-24-generic' I believe I have added the repository correctly: sudo add-apt-repository ppa:ubuntu-audio-dev/ppa [sudo] password for codyloco: You are about to add the following PPA to your system: This PPA will be used to provide testing versions of packages for supported Ubuntu releases. More info: https://launchpad.net/~ubuntu-audio-dev/+archive/ppa Press [ENTER] to continue or ctrl-c to cancel adding it Executing: gpg --ignore-time-conflict --no-options --no-default-keyring --secret-keyring /tmp/tmp.7apgZoNrqK --trustdb-name /etc/apt/trustdb.gpg --keyring /etc/apt/trusted.gpg --primary-keyring /etc/apt/trusted.gpg --keyserver hkp://keyserver.ubuntu.com:80/ --recv 4E9F485BF943EF0EABA10B5BD225991A72B194E5 gpg: requesting key 72B194E5 from hkp server keyserver.ubuntu.com gpg: key 72B194E5: public key "Launchpad Ubuntu Audio Dev team PPA" imported gpg: Total number processed: 1 gpg: imported: 1 (RSA: 1) And I also ran an update as well (followed the instructions on the fix above). Any ideas?

  Read the article

• Microsoft Outlook 2007 Limit attachment size

  - by tasmanian_devil

  I have qmail server and authetication on Active Directory. All clients use Microsoft Outlook 2007 as default mail client. A have one central location and several remote location wich are connected with slow link speed connection. I have attachment limit on qmail, but i have problem when client attach file localy and send mail, attachment is been uploaded to qmail server and rejected because exceeded limit. Is it possible to limit attachment localy on MS Outlook 2007? I know that Office 2010 have attachment limitation but i think that is not working on Office 2007.

  Read the article

• Enabling Office SharePoint Server Publishing Infrastructure Breaks Navigation

  - by swagers

  I'm migrating from WSS 3.0 to MOSS 2007, below are the steps I took to migrate. Backed up the content database of our WSS 3.0 site. Restored the database on our MOSS 2007 database server Create a new Web Application on our MOSS 2007 server and pointed the database to the newly restored database. Everything works correctly on the new server. I enabled Office SharePoint Server Publishing Infrastructure and navigations stops working correctly. Where it use to say Home it now says /. When I clicked on a link to any sub sites the top navigations reduces down to one button that says Error. Also any sub site navigation on the side bar reads Error. When I disable Office SharePoint Server Publishing Infrastructure everything goes back to the way it was.

  Read the article

• How to compile gcc-4.0 on Mountain Lion

  - by Frizlab

  So far I've successfully launched the configure, but when I type make, I get the following error, after some time (there's a lot which compile successfully): ld: unknown/unsupported architecture name for: -arch i686 /usr/bin/libtool: internal link edit command failed make[2]: *** [libgcc_s.dylib] Error 1 make[1]: *** [libgcc.a] Error 2 make: *** [all-gcc] Error 2 Is there a way to tell gcc not to compile itself for the i686 architecture? Here's my uname -a if it can help: Darwin Frizlabs-Computer.local 12.2.0 Darwin Kernel Version 12.2.0: Sat Aug 25 00:48:52 PDT 2012; root:xnu-2050.18.24~1/RELEASE_X86_64 x86_64 PS: I know gcc-4.0 is ancient, but I do need it.

  Read the article

• How to work with processes?

  - by Viesturs

  I have seen similar questions here, but I didn't get my answer. Maybe it's because I am new to all this and just don't understand. I want my app to work mostly as an indicator. And if user would start it again it would check if it is already running, if it is then give all the input data to that process and quit. So first I need to check if it is running. I saw the answer where you can make a file witch when the program starts and then check if it exists... But what if someone would delete it? Can't I just ask the OS if there is process named "myApp" or something? The next thing I don't really get is how to communicate with the process. How do I give it the input data and what is it going to do with it? Does it work just like starting a new app, through the main() method? I am trying to create this using Quickly. So it would be nice if you can give me some python examples or link to something like that.

  Read the article

• Bonding and default gateway problem (CentOS)

  - by lg

  I configured network bonding on two machine with centos 5.5. Bonding works well, but the problem is default gateway: it is not configured! I follow this tutorial. I added GATEWAY in both (and either) /etc/sysconfig/network and /etc/sysconfig/network-scripts/ifcfg-bond0. But, when I restart network (or server) there is no default gateway (route command). This is ip route ls output after network restart: 10.0.0.0/16 dev bond0 proto kernel scope link src 10.0.0.88 Where is my mistake?

  Read the article

• Load balanced proxies to avoid an API request limit

  - by ClickClickClick

  There is a certain API out there which limits the number of requests per day per IP. My plan is to create a bunch of EC2 instances with elastic IPs to sidestep the limitation. I'm familiar with EC2 and am just interested in the configuration of the proxies and a software load balancer. I think I want to run a simple TCP Proxy on each instance and a software load balancer on the machine I will be requesting from. Something that allows the following to return a response from a different IP (round robin, availability, doesn't really matter..) eg. curl http://www.bbc.co.uk -x http://myproxyloadbalancer:port Could anyone recommend a combination of software or even a link to an article that details a pleasing way to pull it off? (My client won't be curl but is proxy aware.. I'll be making the requests from a Ruby script..)

  Read the article

• Ubuntu 12.04 startup is slow and dmesg output seems to lose several seconds

  - by cdowen

  I use ubuntu on Dell Inspiron n4050.I have upgraded to ubuntu 12.04 from 10.04. But now I find the system startup is a little slow and plymouth only show purple screen without logo during startup. When I use dmesg, it shows such messages: [ 2.497750] EXT4-fs (sda1): mounted filesystem with ordered data mode. Opts: (null) [ 2.603028] usb 2-1.6: new high-speed USB device number 3 using ehci_hcd [ 2.715538] Initializing USB Mass Storage driver... [ 2.715594] usbcore: registered new interface driver usb-storage [ 2.715596] USB Mass Storage support registered. [ 21.317843] Adding 2000892k swap on /dev/sda5. Priority:-1 extents:1 across:2000892k [ 21.323724] ADDRCONF(NETDEV_UP): eth0: link is not ready [ 21.391450] udevd[431]: starting version 175 I wonder what it is doing between 2 second and 21 second. Is it related to being so slow? I tried bootchart. It gave me a complex picture. Sorry I can't post it here. http://3.bp.blogspot.com/-7LX8T5uQvlw/UKhdFMVkp4I/AAAAAAAAADg/dtxePkE94mg/s320/lengzhen-ubuntu-precise-20121118-1.png While ubuntu is booting , I also noticed that it appears:/tmp is not ready or present And sometimes follows *Stop saving kernel messages. Is this the reason dmesg lost output?

  Read the article

• Why doesn't wireless work on Wubi 12.04 with a Broadcom BCM4312 card?

  - by Kristin

  I have recently set up ubuntu 12.04 on my laptop using the Wubi installer. I am having a very difficult time setting up a wireless internet connection. I am currently set up with an ethernet connection which I have used to download all new updates and to activate the Broadcom STA wireless driver. I have tried several things in the terminal based on other people's posts: ~$ rfkill list 0: brcmwl-0: Wireless LAN Soft blocked: no Hard blocked: yes ~$ rfkill unblock all It doesn't change anything. I also tried rebooting and connecting to the internet on my Windows Vista OS, and it worked, so I know that the connection should not be hard blocked. I have also tried installing b43 firmware (lp/phy version) that is supposed to work with my chip (BCM4312). It seems to have no effect. Then I tried: ~$ iwconfig lo no wireless extensions. eth1 IEEE 802.11 Access Point: Not-Associated Link Quality:5 Signal level:0 Noise level:0 Rx invalid nwid:0 invalid crypt:0 invalid misc:0 eth0 no wireless extensions. This is my first time trying to work with ubuntu, so I would appreciate any help. Thanks. Also sorry this is poorly formatted. I'm having troubles with that too.

  Read the article

< Previous Page | 567 568 569 570 571 572 573 574 575 576 577 578  | Next Page >