Search Results

Search found 21463 results on 859 pages for 'broken link'.

Page 571/859 | < Previous Page | 567 568 569 570 571 572 573 574 575 576 577 578  | Next Page >

  • QNAP TS-419p as a VPN Gateway?

    - by heisenberg
    Hello, I am hoping one of you might be able to help. I want to make files stored on shared folders on a QNAP TS-409p available to users over a VPN link. How is the possible? Can someone explain what I need to do. What do I need to do at the router and what do I need to do on the QNAP NAS? Effectively, what I want do do is use the built in Windows vpn client to connect to my home network and then be able to browse the shared folders. Thanks in advance.

    Read the article

  • Protecting a webpage with an authentication form

    - by Luke
    I have created an employee webpage with a lot of company info, links, etc., but I want to protect the page because it contains some confidential company information. I am running IIS7.5 on Windows Server 2008 R2, and I already have the site setup as a normal, non-protected site. I want all active directory users to have access to the site. This is not an intranet site, it is exposed to the internet. I tried setting it up using Windows Authentication, but I had problems with multiple login prompts, etc. I just want a simple form for users to enter their credentials and have access to the site, and I need it to query the AD for login. I've searched the web for a guide on this, but I can't seem to find one that fits my situation. This is not a Web App. It is just a simple html site. Does anyone have any suggestions or a link to a guide on this? Thanks so much! -LB

    Read the article

  • What is your approach to draw a representation of your network ?

    - by Kartoch
    Hello, I'm looking to the community to see how people are drawing their networks, i.e. using symbols to represent complex topology. You can have hardware approach, where every hardware unit are represented. You can also have "entity" approach, where each "service" is shown. Both are interesting but it is difficult to have both on the same schema (but this is needed, especially using virtualization environment). Furthermore, it is difficult to have complex informations on such representation. For instance security parameters (encrypted link, need for authentication) or specific details (protocol type, ports, encapsulation). So my question is: where your are drawing a representation of your network, what is your approach ? Are you using methodology and/or specific softwares ? What is your recommendations for information to put (or not) ? How to deal with the complexity when the network becomes large and/or you want to put a lot of information on it ? Examples and links to good references will be appreciated.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Simple CMS (separate files for multiple users) [closed]

    - by Pentium100
    I need a simple CMS software (or maybe it's called something else). There are many users (adding new users has to be simple as it will be done manually, no "sign up" link) and those users have to access (just download, no uploading or modification) some files. A file can be shown just to one user or a group of users (a user can belong to multiple groups). Upload a file and tag which users/groups can access it. This can probably be done with FTP, but HTTP would be better. Any software (preferable open source) that can do this without much modification? I can modify PHP code a bit, but I am not a programmer.

    Read the article

  • Update 3 for "NetBeans Platform for Beginners"

    - by Geertjan
    The latest monthly update of NetBeans Platform for Beginners was released during the last few days. Without any question at all, this book is awesome. I love how it is a 'living book' and that on a monthly basis new updates are made available. In this particular update, as before, reader comments and questions have led to changes and enhancements in the book. In addition, there's now a tighter integration between the long list of samples on GitHub and the book, since wherever a sample relates to a text in the book, the book has a handy icon, so that you know when to hop over to GitHub to get a related sample. Do you have comments or questions about the book? That's what the feedback link is for: https://leanpub.com/nbp4beginners/feedback And there's also a free sample, just in case you'd like to get a feel for the book prior to buying it: http://samples.leanpub.com/nbp4beginners-sample.pdf If you're from a company where you're all sharing a single copy of the book, it would be great if you'd go back and support this great project (and hopefully encourage future books being written) by buying additional copies, ideally one for each developer. Let's show the authors that writing books on the NetBeans Platform is a really profitable thing to do (and I'm hoping they'll write one on Maven and the NetBeans Platform, as well)!

    Read the article

  • Firefox 11 Bookmarks Toolbar too Tall

    - by tba
    After updating to Firefox 11, my Bookmarks Toolbar is unpleasantly tall. This link implies that it's due to the presence of separators in my toolbar. I tried adding the suggested CSS in post 5 to my userChrome.css file, but this did nothing. I have also tried #PersonalToolbar {max-height:10px !important;} But this simply truncates the bottom of the toolbar. Does anyone know how to change the size of the bookmarks toolbar to match Firefox 10? More info: Here is a screenshot of my Bookmarks Toolbar. I'm using OSX 10.6.8 with the default theme. I have "View Toolbars Customize Use small icons" enabled. I'm also using the LiveClick 0.4.2.0 extension, but disabling it does not fix the issue.

    Read the article

  • How to tune Windows 2008r2 and IIS to maximize single file download speeds?

    - by uSlackr
    We recently put up an IIS site (on WinSvr 2008r2) that is used almost exclusively for downloading files over the internet. The data exists as a large collection of .zip files ranging from 1MB - 35GB in size. We want to allow a lot of downloads during a day (more than 500GB) but have implemented an outbound ASA throttle at 60mbps in order to preserve bandwidth for other uses. The total link speed is 100mbps. Here's the interesting part: While we can serve up multiple downloads to hit the 60mbps cap, we cannot get any single download to exceed 2.5M bytes/sec (20 Mbits/s). Is there any TCP or IIS tuning we can do to push up individual download speeds? Or something else to look at?

    Read the article

  • Enabling Office SharePoint Server Publishing Infrastructure Breaks Navigation

    - by swagers
    I'm migrating from WSS 3.0 to MOSS 2007, below are the steps I took to migrate. Backed up the content database of our WSS 3.0 site. Restored the database on our MOSS 2007 database server Create a new Web Application on our MOSS 2007 server and pointed the database to the newly restored database. Everything works correctly on the new server. I enabled Office SharePoint Server Publishing Infrastructure and navigations stops working correctly. Where it use to say Home it now says /. When I clicked on a link to any sub sites the top navigations reduces down to one button that says Error. Also any sub site navigation on the side bar reads Error. When I disable Office SharePoint Server Publishing Infrastructure everything goes back to the way it was.

    Read the article

  • Error page for OWA users on a different server?

    - by W_P
    We are getting ready to do a network-wide upgrade to Exchange 2010. The url for the old 2007 mailboxes is at https://mail.example.com and users who have had their mail box moved will have to go to https://Email.example.com If a user that has a 2010 mailbox attempts to login at the 2007 OWA location, they get a standard 403 Forbidden page. We would like to show them a page of our own making, that includes a link to the 2010 OWA login page. I assumed we could do this with an IIS Custom Error page, but setting the 403.4 error page in IIS on the Default web site doesn't seem to be working. Does anyone know how we could get around this? BTW, our OWA for the 2007 boxes in on Windows Server 2003, and IIS 6

    Read the article

  • Ubuntu 12.04 startup is slow and dmesg output seems to lose several seconds

    - by cdowen
    I use ubuntu on Dell Inspiron n4050.I have upgraded to ubuntu 12.04 from 10.04. But now I find the system startup is a little slow and plymouth only show purple screen without logo during startup. When I use dmesg, it shows such messages: [ 2.497750] EXT4-fs (sda1): mounted filesystem with ordered data mode. Opts: (null) [ 2.603028] usb 2-1.6: new high-speed USB device number 3 using ehci_hcd [ 2.715538] Initializing USB Mass Storage driver... [ 2.715594] usbcore: registered new interface driver usb-storage [ 2.715596] USB Mass Storage support registered. [ 21.317843] Adding 2000892k swap on /dev/sda5. Priority:-1 extents:1 across:2000892k [ 21.323724] ADDRCONF(NETDEV_UP): eth0: link is not ready [ 21.391450] udevd[431]: starting version 175 I wonder what it is doing between 2 second and 21 second. Is it related to being so slow? I tried bootchart. It gave me a complex picture. Sorry I can't post it here. http://3.bp.blogspot.com/-7LX8T5uQvlw/UKhdFMVkp4I/AAAAAAAAADg/dtxePkE94mg/s320/lengzhen-ubuntu-precise-20121118-1.png While ubuntu is booting , I also noticed that it appears:/tmp is not ready or present And sometimes follows *Stop saving kernel messages. Is this the reason dmesg lost output?

    Read the article

  • Lookups targeting merged cells - only returning value for first row

    - by Ian
    I have a master worksheet which contains data that I wish to link to another 'summary' sheet using a lookup. However, some of the cells whose data I wish to include in the summary sheet are merged across two or more adjacent rows. To be clear, the 'primary' column A that I am using in my formula in order to identify the target row does not contain merged cells, but the column from which I wish to return a value does. I have tried VLOOKUP and INDEX+MATCH. The problem is that the data is only returned for the first row's key, and the others return zero (as though the cell in the target column were blank, where actually it is merged). I have tried inelegant ways around this, e.g. using IF statements to try to find the top row of the merged cell. However, these don't work well if the order of values in the summary sheet is different from that in the master sheet, as well as being messy. Can this be done?

    Read the article

  • Microsoft Outlook 2007 Limit attachment size

    - by tasmanian_devil
    I have qmail server and authetication on Active Directory. All clients use Microsoft Outlook 2007 as default mail client. A have one central location and several remote location wich are connected with slow link speed connection. I have attachment limit on qmail, but i have problem when client attach file localy and send mail, attachment is been uploaded to qmail server and rejected because exceeded limit. Is it possible to limit attachment localy on MS Outlook 2007? I know that Office 2010 have attachment limitation but i think that is not working on Office 2007.

    Read the article

  • 1 ASPX Page, Multiple Master Pages

    - by csmith18119
    So recently I had an ASPX page that could be visited by two different user types.  User type A would use Master Page 1 and user type B would use Master Page 2.  So I put together a proof of concept to see if it was possible to change the MasterPage in code.  I found a great article on the Microsoft ASP.net website. Specifying the Master Page Programmatically (C#) by Scott Mitchell So I created a MasterPage call Alternate.Master to act as a generic place holder.  I also created a Master1.Master and a Master2.Master.  The ASPX page, Default.aspx will use this MasterPage.  It will also use the Page_PreInit event to programmatically set the MasterPage.  1: protected void Page_PreInit(object sender, EventArgs e) { 2: var useMasterPage = Request.QueryString["use"]; 3: if (useMasterPage == "1") 4: MasterPageFile = "~/Master1.Master"; 5: else if (useMasterPage == "2") 6: MasterPageFile = "~/Master2.Master"; 7: }   In my Default.aspx page I have the following links in the markup: 1: <p> 2: <asp:HyperLink runat="server" ID="cmdMaster1" NavigateUrl="~/Default.aspx?use=1" Text="Use Master Page 1" /> 3: </p> 4: <p> 5: <asp:HyperLink runat="server" ID="cmdMaster2" NavigateUrl="~/Default.aspx?use=2" Text="Use Master Page 2" /> 6: </p> So the basic idea is when a user clicks the HyperLink to use Master Page 1, the default.aspx.cs code behind will set the property MasterPageFile to use Master1.Master.  The same goes with the link to use Master Page 2.  It worked like a charm!  To see the actual code, feel free to download a copy here: Project Name: Skyhook.MultipleMasterPagesWeb http://skyhookprojectviewer.codeplex.com

    Read the article

  • My Router is fast when i reset it but slows down seconds later

    - by hglocke
    I have a Belkin N wireless router which until recently worked perfectly fine. Now i have to reset the router every few minutes, otherwise it slows down to a crawl. What can I do? I have tried turning the routers firewall off, but it does not make any difference. As far as I'm aware there have been no recent firmware updates. EDIT: The other devices on my network (laptop and iphone) do not have this problem. I connect to the router using a TP-Link wireless network card and I have already tried uninstalling and installing the driver. Hopefully this will narrow down the problem significantly.

    Read the article

  • WiFi problems on several Ubuntu installations

    - by Rickyfresh
    Okay this is the first time I have ever had to ask a question as usually the Ubuntu community have answered everything already but on this occasion there are many people asking for the answer but not one good solution has become available so far so someone please help or I will have to install Windows on my sons and my girlfriends PCs and that would be a disaster as I am trying to help convince people to move from Windows. I installed 12.04 on three computers on the same day. Dell Inspiron (Works Perfect) Toshiba Satellite Home built Desktop The Dell works perfect but the other two either keep losing connection to the wireless Internet and even when they are connected they stop connecting to web sites, for some reason it searches Google fine but will not connect to web sites when a link is clicked. So far people have recommended in other forums: Removing network manager and installing wicd (didn't solve it) Changing the MTU in the wireless settings (didn't solve it) All sorts of messing about with Firefox settings (this doesn't solve it and even if it did this would leave most average PC users scratching their heads and wishing they had stuck to windows) The problem exists on two very different machines and different wireless cards so I doubt its a driver or hardware issue, also many other Ubuntu users are having the same problem with a vast array of different machines and wireless cards. Can someone please give a good solution to this as its going to turn a lot of people away from Ubuntu if they cannot get this sorted. I would give some PC specs but the two machines are vastly different and the other people complaining of this problem also have very different systems all showing the same problem.

    Read the article

  • Chrome tabs showing wrong page

    - by Jeff
    I have a problem with Google Chrome where occasionally when switching to a newly created tab (usually one made from opening a link into a new tab), the wrong page shows. The correct page is functional, links and other functions are present, but I cannot see them because Chrome seems to be reading the page I want but showing another. Sometimes it is identical to the tab I just left, sometimes it shows the content of a previously closed tab. The problem sorts out when I switch to another tab and back, and then the correct page shows. This happens fairly often and is rather annoying. Some of my friends have also experienced this, and have stopped using Chrome because of it. If anybody else has seen this problem and happens to know a fix, I'd really appreciate it.

    Read the article

  • When creating a GUI wizard, should all pages/tabs be of the same size? [closed]

    - by Job
    I understand that some libraries would force me to, but my question is general. If I have a set of buttons at the bottom: Back, Next, Cancel?, (other?), then should their location ever change? If the answer is no, then what do I do about pages with little content? Do I stretch things? Place them in the lone upper left corner? According to Steve Krug, it does not make sense to add anything to GUI that does not need to be there. I understand that there are different approaches to wizards - some have tabs, others do not. Some tabs are lined horizontally at the top; others - vertically on the left. Some do not show pages/tabs, and are simply sequences of dialogs. This is probably a must when the wizard is "non-linear", e.g. some earlier choices can result in branching. Either way the problem is the same - sacrifice on the consistency of the "big picture" (outline of the page/tab + location of buttons), or the consistency of details (some tabs might be somewhat packed; others having very little content). A third choice, I suppose is putting extra effort in the content in order to make sure that organizing the content such that it is more or less evenly distributed from page to page. However, this can be difficult to do (say, when the very first tab contains only a choice of three things, and then branches off from there; there are probably other examples), and hard to maintain this balance if any of the content changes later. Can you recommend a good approach? A link to a relevant good blog post or a chapter of a book is also welcome. Let me know if you have questions.

    Read the article

  • Why doesn't wireless work on Wubi 12.04 with a Broadcom BCM4312 card?

    - by Kristin
    I have recently set up ubuntu 12.04 on my laptop using the Wubi installer. I am having a very difficult time setting up a wireless internet connection. I am currently set up with an ethernet connection which I have used to download all new updates and to activate the Broadcom STA wireless driver. I have tried several things in the terminal based on other people's posts: ~$ rfkill list 0: brcmwl-0: Wireless LAN Soft blocked: no Hard blocked: yes ~$ rfkill unblock all It doesn't change anything. I also tried rebooting and connecting to the internet on my Windows Vista OS, and it worked, so I know that the connection should not be hard blocked. I have also tried installing b43 firmware (lp/phy version) that is supposed to work with my chip (BCM4312). It seems to have no effect. Then I tried: ~$ iwconfig lo no wireless extensions. eth1 IEEE 802.11 Access Point: Not-Associated Link Quality:5 Signal level:0 Noise level:0 Rx invalid nwid:0 invalid crypt:0 invalid misc:0 eth0 no wireless extensions. This is my first time trying to work with ubuntu, so I would appreciate any help. Thanks. Also sorry this is poorly formatted. I'm having troubles with that too.

    Read the article

  • News Applications internal working [on hold]

    - by Vijay
    How does news applications work other than RSS Feed based applications? I know some of them take the RSS content from the source site.But sometimes I see, those applications show - Title Description Date Image video etc. Even though when I see the original site's rss, image, video is not there in rss. So how does one get that to show in there applications? Some applications even shows feeds from magazine sites, newspaper sites. How do these applications work? I am creating an application which will link to different news sites feeds categorized (like top news, technology, games, articles etc.) On the front page it will show the website names, then on selection of any news site it will get the feed from that website and show it to user. So I would like to know All the fetching of data from should be done on user selection or data should be prefetched? Detailed information I want to fetch from the original like provided in the rss data. How should I go about it?

    Read the article

  • ADF Hands on Training &ndash; Prerequisites for 22nd March 2011

    - by Grant Ronald
    For those of you coming to the ADF Hands on training on the 22nd March in London, there was a link to the prerequisites.  Unfortunately, in a reshuffle of content on OTN, this page was removed.  So, over the next day or so I’m hoping to the pull together the relevant information into this blog post.  So keep checking back! Firstly, you need to being your laptop with you to do the hands on exercises.  No laptop, no hands on. Recommended 2GB RAM running Microsoft Windows XP SP2, 2003 Server SP2, Vista (32 bit only), Windows 7 or Linux or Mac 2GHz Processor (less will be acceptable but slower) Mozilla Firefox 2.0 or higher, Internet Explorer 7 or higher, Safari 3.0 and higher, Google Chrome 1.0 or higher Winzip or other extracting software Adobe Acrobat reader Flash (if you want to see dynamic graphs in your application) As for software, you will need have installed JDeveloper 11g.  The hands on instructions are based on 11.1.1.2 (or is it 11.1.1.3)! anyway, either of those or 11.1.1.4 would be required. You also need an Oracle database on your machine and access to the HR schema (which should be unlocked).  Don’t expect to have access to a network and VPN to a database. A simple test, unplug your laptop from your corporate network, run up JDev  and select File –> New –> Database connection and make sure you can connect to HR database and see the Emp/Dept etc tables.  If you can do that, you should be good to go. I would strongly recommend ensuring you have this in place before you arrive on Tuesday. Look forward to seeing you there.

    Read the article

  • The Oracle EMEA Partner Event of the Year- FREE, LIVE & ONLINE!

    - by Claudia Costa
    New products. New specializations. New opportunities. Find out how you can use them to build your Oracle business even faster and more effectively in 2010/11. The date for your diary is the 29th of June 2010, at 11:00 GMT. And this summer's event is bigger and better than ever. You will learn: What Oracle's acquisition of Sun Microsystems means for your business and your customers How Oracle Specialization can help you grow faster and smarter, and how Oracle partners from across the region are already benefitting Why Oracle's latest technology, applications, middleware and hardware products and solutions offer you unbeatable new business opportunities How Oracle's partner program is evolving to help partners succeed with a live link to the Oracle FY11 Global Partner Kickoff How specialization has helped a former Microsoft executive become one of the world's most successful social entrepreneurs You'll also have the chance to network with Oracle experts and other partners, and download valuable collateral from specially constructed virtual information booths. Plus, at the end of the event, submit your feedback form for the chance to win two passes to Oracle OpenWorld in San Francisco this September! Don't miss out! REGISTER TODAY!  for this exciting, exclusive online event. Visit here for more information and to view the complete agenda We look forward to welcoming you on the 29th of June! Yours sincerely, Stein SurlienSenior Vice President, Alliances & Channels, Oracle EMEA PS. The Oracle PartnerNetwork Days Virtual Event will be followed by "Oracle PartnerNetwork Days Executive Forums", and "Oracle PartnerNetwork Days Satellite Events" in various countries. Please look out for further communications from your local Oracle team.

    Read the article

  • BSODs after Windows 8.1 Upgrade

    - by Techrocket9
    I just upgraded my system to Windows 8.1, and I have been getting BSODs that I did not get before the 8.1 upgrade. Though I cannot conclude that running the Android Emulator with Intel's HAXM is the cause, both crashes have occurred while the emulator was running. I get CRITICAL_STRUCTURE_CORRUPTION, the same error as this guy, except I don't have the hardware/software that he has that caused his problem. Minidumps here. Output of verifier.exe /all and then a reboot and then verifier /query: http://sdrv.ms/17CPVu9 Edit: According to software.intel.com/en-us/forums/topic/475129 (can't link due to lack of rep) it is being caused by HAXM. Will close question when I find a solution.

    Read the article

  • Bonding and default gateway problem (CentOS)

    - by lg
    I configured network bonding on two machine with centos 5.5. Bonding works well, but the problem is default gateway: it is not configured! I follow this tutorial. I added GATEWAY in both (and either) /etc/sysconfig/network and /etc/sysconfig/network-scripts/ifcfg-bond0. But, when I restart network (or server) there is no default gateway (route command). This is ip route ls output after network restart: 10.0.0.0/16 dev bond0 proto kernel scope link src 10.0.0.88 Where is my mistake?

    Read the article

  • Proper way to do texture mapping in modern OpenGL?

    - by RubyKing
    I'm trying to do texture mapping using OpenGL 3.3 and GLSL 150. The problem is the texture shows but has this weird flicker I can show a video here. My texcords are in a vertex array. I have my fragment color set to the texture values and texel values. I have my vertex shader sending the texture cords to texture cordinates to be used in the fragment shader. I have my ins and outs setup and I still don't know what I'm missing that could be causing that flicker. Here is my code: Fragment shader #version 150 uniform sampler2D texture; in vec2 texture_coord; varying vec3 texture_coordinate; void main(void) { gl_FragColor = texture(texture, texture_coord); } Vertex shader #version 150 in vec4 position; out vec2 texture_coordinate; out vec2 texture_coord; uniform vec3 translations; void main() { texture_coord = (texture_coordinate); gl_Position = vec4(position.xyz + translations.xyz, 1.0); } Last bit Here is my vertex array with texture coordinates: GLfloat vVerts[] = { 0.5f, 0.5f, 0.0f, 0.0f, 1.0f, 0.0f, 0.5f, 0.0f, 1.0f, 1.0f, 0.0f, 0.0f, 0.0f, 0.0f, 0.0f, 0.5f, 0.0f, 0.0f, 1.0f, 0.0f}; //tex x and y If you need to see all the code, here is a link to every file. Thank you for your help.

    Read the article

< Previous Page | 567 568 569 570 571 572 573 574 575 576 577 578  | Next Page >