Search Results

Search found 21463 results on 859 pages for 'broken link'.

Page 571/859 | < Previous Page | 567 568 569 570 571 572 573 574 575 576 577 578  | Next Page >

  • Create Adjustable Depth of Field Photos with a DSLR

    - by Jason Fitzpatrick
    If you’re fascinating by the Lytro camera–a camera that let’s you change the focus after you’ve taken the photo–this DSLR hack provides a similar post-photo focus processing without the $400 price tag. Photography tinkers at The Chaos Collective came up with a clever way of mimicking the adjustable depth-of-field adjustment effect from the Lytro camera. The secret sauce in their technique is setting the camera to manual focus and capturing a short 2-3 second video clip while they rotate the focus through the entire focal range. From there, they use a simple applet to separate out each frame of the video. Check out the interactive demo below: Anywhere you click in the photo shifts the focus to that point, just like the post processing in the Lytro camera. It’s a different approach to the problem but it yields roughly the same output. Hit up the link below for the full run down on their technique and how you can get started using it with your own video-enabled DLSR. Camera HACK: DOF-Changeable Photos with an SLR [via Hack A Day] Secure Yourself by Using Two-Step Verification on These 16 Web Services How to Fix a Stuck Pixel on an LCD Monitor How to Factory Reset Your Android Phone or Tablet When It Won’t Boot

    Read the article

  • VPN PPTPD with MPPE Support for Debian or Ubuntu

    - by user78395
    Having an unencrypted vpn connection from a windows client to linux is pretty easy by using pptpd. When I was looking for an solution for encrypted (per MPPE) connection, I found a lot of information about patching the kernel etc. - so it definitly works after some work. But all these information is pretty old (2005-2006). Is it the same solution nowadays? I am not asking for a complete instruction (only if it's short) - I am more asking for a link to the right solution.

    Read the article

  • Why are my Google searches redirected?

    - by Please Help
    This machine was infected with various malware. I have scanned the system with Malwarebytes. It found and removed some 600 or so infected files. Now the machine seems to be running well with only one exception. Some Google search results are being redirected to some shady search engines. If I were to copy the url from the Google Search results and paste it in the address bar it would go to the correct site but if I click the link I will be redirected somewhere else. Here is my log file from HijackThis: http://pastebin.com/ZE3wiCrk

    Read the article

  • Error page for OWA users on a different server?

    - by W_P
    We are getting ready to do a network-wide upgrade to Exchange 2010. The url for the old 2007 mailboxes is at https://mail.example.com and users who have had their mail box moved will have to go to https://Email.example.com If a user that has a 2010 mailbox attempts to login at the 2007 OWA location, they get a standard 403 Forbidden page. We would like to show them a page of our own making, that includes a link to the 2010 OWA login page. I assumed we could do this with an IIS Custom Error page, but setting the 403.4 error page in IIS on the Default web site doesn't seem to be working. Does anyone know how we could get around this? BTW, our OWA for the 2007 boxes in on Windows Server 2003, and IIS 6

    Read the article

  • How to Split a Big Postscript file (3000 pages) into one individual file per page (using Windows 7)?

    - by Pablo
    Hi, I'm having trouble doing the following: I have a big PDF file that I converted to postscript (for commercial printing). The resulting file is too big to be processed by the printer (machine). I've been trying to find a way to either: Convert from the original (many pages) PDF file to many Postscript file (one postcript file per PDF page in original PDF file(. Convert from PDF to PS (or even EPS). - I managed to do this Then split the PS file into a collection of smaller files. I've tried using Ghostscript, but it is all gibberish to me. Thanks. PS. If you have a good GS tutorial (for dummies?), please share the link.

    Read the article

  • Identifying elements from data feeds generated by affiliate sites

    - by SPI
    I am working with data feeds from affiliate sites. The basic idea is to provide an interface where the user can paste a link to an XML datafeed (these are huge btw, around 60 mb) that would then be streamed, parsed into small chunks, and mined for the required data which would then be stored in the database. The problem is that different affiliate sites have different Schemas for their XML's. It is a little hard mapping the elements in an XML to your database attributes when you don't actually know which element contains what. My Solution: Use XPath to traverse through the first set of parent and it's descendent's, fetch the elements as well as the data and and ask the user to map this data to the attributes in the database by selecting from a set of radio buttons that represent the attributes from the database. This will be done just once for each new Feed, once the system know's what's what it will automatically upload the data from the XML to the database. Does this sound viable? Is there a better solution? I realize this leaves an uncomfortable opening for human error.. Thanks.

    Read the article

  • MySQL keeps crashing due to bug

    - by mike
    So about a week ago, I finally figured out what was causing my server to continually crash. After reviewing my mysqld.log I keep seeing this same error, 101210 5:04:32 [Warning] option 'max_join_size': unsigned value 18446744073709551615 adjusted to 4294967295 Here is a link to the bug report, http://bugs.mysql.com/bug.php?id=35346 someone recommend that you set the max_join_size vaule in my.cnf to 4M, and I did. I assumed this fixed the issue, and it was working for about a week with no issues until today... I checked MySQL and the same error is now back, 101216 06:35:25 mysqld restarted 101216 6:38:15 [Warning] option 'max_join_size': unsigned value 18446744073709551615 adjusted to 4294967295 101216 6:38:15 [Warning] option 'max_join_size': unsigned value 18446744073709551615 adjusted to 4294967295 101216 06:40:42 mysqld ended Anyone know how I can really fix this issue? I can't keep having mysql crash like this. EDIT: I forgot to mention every time this happens I get an email from linode staying I have a high disk io rate Your Linode, has exceeded the notification threshold (1000) for disk io rate by averaging 2483.68 for the last 2 hours.

    Read the article

  • Setup Web Applications on Cisco ASA 9.1

    - by Scott
    I've been looking around the Cisco ASA administration screen with our network admin and haven't found the location where Web Applications can be setup. This seems like it should be a pretty straight forward procedure, especially if I just want to add a global application and not segment out by groups. I've looked through the docs, but they are a mess and answer most questions except for this. If you're going to post a RTFM answer, at least please provide link and location because I have looked. This is the location I'm looking to setup web applications on the clientless web VPN.

    Read the article

  • Software for Company internal Website [closed]

    - by LordT
    hope this is the right stackexchange site to ask this: We've a group of webpages/services at work (SE Startup), ranging from SVN, trac, continous integration to link collections to a DMS. Nearly everything has an RSS Feed to get the info I need, with the exception of SVN. I'm looking for some kind of software that can integrate these well on a kind of start-page. The most recent changes, upcoming events etc should be clearly visible, as well as an option to search (the search will be provided from a different tool). A news area should be included as well. Currently, I'm pondering doing this with either wordpress or TWiki, although wordpress seems to be the simpler solution in terms of getting something good looking quickly. Authentication should be handled by HTTP-Basic Auth, which we already have in place and working well. I normally would consider Sharepoint a viable option for this, but we're exclusively mac and linux, I won't put up a windows server just for this.

    Read the article

  • Alternatives to time tracking methodologies [closed]

    - by Brandon Wamboldt
    Question first: What are some feasible alternatives to time tracking for employees in a web/software development company, and why are they better options Explanation: I work at a company where we work like this. Everybody is paid salary. We have 3 types of work, Contract, Adhoc and Internal (Non billable). Adhoc is just small changes that take a few hours and we just bill the client at the end of the month. Contracts are signed and we have this big long process, the usual. We figure out how much to charge by getting an estimation of the time involved (From the design and the developers), multiplying it by our hourly rate and that's it. So say we estimate 50 hours for a website. We have time tracking software and have to record the time in 15 we spend on it (7:00 to 7:15 for example), the project name, and give it some comments. Now if we go over the 50 hours, we are both losing money and are inefficient. Now that I've explained how the system works, my question is how else can it be done if a better method exists (Which I'm sure one must). Nobody here likes the current system, we just can't find an alternative. I'd be more than willing to work after hours longer hours on a project to get it done in time, but I'm much inclined to do so with the current system. I'd love to be able to sum up (Or link) to this post for my manager to show them why we should use abc system instead of this system.

    Read the article

  • How to make the internal subwoofer work on an Asus G73JW?

    - by CodyLoco
    I have an Asus G73JW laptop which has an internal subwoofer built-in. Currently, the system detects the internal speakers as a 2.0 system (or I can change do 4.0 is the only other option). I found a bug report here: https://bugs.launchpad.net/ubuntu/+source/alsa-driver/+bug/673051 which discusses the bug and according to them a fix was sent upstream back at the end of 2010. I would have thought this would have made it into 12.04 but I guess not? I tried following the link given at the very bottom to install the latest ALSA drivers, here: https://wiki.ubuntu.com/Audio/InstallingLinuxAlsaDriverModules however I keep running into an error when trying to install: sudo apt-get install linux-alsa-driver-modules-$(uname -r) Reading package lists... Done Building dependency tree Reading state information... Done E: Unable to locate package linux-alsa-driver-modules-3.2.0-24-generic E: Couldn't find any package by regex 'linux-alsa-driver-modules-3.2.0-24-generic' I believe I have added the repository correctly: sudo add-apt-repository ppa:ubuntu-audio-dev/ppa [sudo] password for codyloco: You are about to add the following PPA to your system: This PPA will be used to provide testing versions of packages for supported Ubuntu releases. More info: https://launchpad.net/~ubuntu-audio-dev/+archive/ppa Press [ENTER] to continue or ctrl-c to cancel adding it Executing: gpg --ignore-time-conflict --no-options --no-default-keyring --secret-keyring /tmp/tmp.7apgZoNrqK --trustdb-name /etc/apt/trustdb.gpg --keyring /etc/apt/trusted.gpg --primary-keyring /etc/apt/trusted.gpg --keyserver hkp://keyserver.ubuntu.com:80/ --recv 4E9F485BF943EF0EABA10B5BD225991A72B194E5 gpg: requesting key 72B194E5 from hkp server keyserver.ubuntu.com gpg: key 72B194E5: public key "Launchpad Ubuntu Audio Dev team PPA" imported gpg: Total number processed: 1 gpg: imported: 1 (RSA: 1) And I also ran an update as well (followed the instructions on the fix above). Any ideas?

    Read the article

  • Install Problems on ASUS X401A Notebook

    - by tired_of_trying
    okay... I tried many approaches to install Ubuntu 12.xxx on my new Asus notebook with varying degrees of failure... First: I'm not a newbie but I'm as frustrated as one! Install background: Install from USB DVD drive: The install went well. Re-booted machine. choose ubuntu and it errors with a MBR file error (can't remember the exact wording - something to do with missing the file. Choosing to boot W7 works fine. Install from USB Stick: Couldn't get machine to recognize the .iso Install into Oracle's Vbox: Got the boot splash screen, then hangs with a zillion errors. Note: I didn't have any problems installing ubuntu in Vbox on my iMac and it run's great. Installed using wubi: Installed fine but get errors when booting ubuntu (it doesn't find the needed wubi files). I downloaded to the C: drive and tried installing from there - no luck. For kicks: I tried running Slax Linux .iso from a USB stick and it runs fine. Some Questions: Did I use the correct .iso? (I tried 12.04.0 and 12.04.1 both 32 and 64 bit versions. I simply downloaded them from the download link and didn't use/look for an alternate version. Do I need to do something special when burning the .iso to disc? What? I did read tons of posts but, no luck with finding the solution. Any help is appreciated... thanks

    Read the article

  • Microsoft Outlook 2007 Limit attachment size

    - by tasmanian_devil
    I have qmail server and authetication on Active Directory. All clients use Microsoft Outlook 2007 as default mail client. A have one central location and several remote location wich are connected with slow link speed connection. I have attachment limit on qmail, but i have problem when client attach file localy and send mail, attachment is been uploaded to qmail server and rejected because exceeded limit. Is it possible to limit attachment localy on MS Outlook 2007? I know that Office 2010 have attachment limitation but i think that is not working on Office 2007.

    Read the article

  • Tool or website or process to display previews of website templates residing in archive files?

    - by Tony_Henrich
    I have hundreds of website templates in rar or zip files. To view any of them I have to extract the archive to a temporary folder and then view the template in there. It's a time consuming manual process to do this for each template Is there a tool which enables me to quickly preview the templates in the files? OR (if I extract each template into a separate folder off a master folder) A web app which can enable previewing of each template by automatically creating a link or a preview image (similar to template sites) of the home page for? OR any method to preview the templates in the fastest convenient way possible?

    Read the article

  • Lookups targeting merged cells - only returning value for first row

    - by Ian
    I have a master worksheet which contains data that I wish to link to another 'summary' sheet using a lookup. However, some of the cells whose data I wish to include in the summary sheet are merged across two or more adjacent rows. To be clear, the 'primary' column A that I am using in my formula in order to identify the target row does not contain merged cells, but the column from which I wish to return a value does. I have tried VLOOKUP and INDEX+MATCH. The problem is that the data is only returned for the first row's key, and the others return zero (as though the cell in the target column were blank, where actually it is merged). I have tried inelegant ways around this, e.g. using IF statements to try to find the top row of the merged cell. However, these don't work well if the order of values in the summary sheet is different from that in the master sheet, as well as being messy. Can this be done?

    Read the article

  • Smart Phones Shockingly Energy Efficient; Lead to Decreased Household Power Consumption

    - by Jason Fitzpatrick
    Given how often our smart phones and tablets spend plugged in and topping off their battery reserves, it’s easy to assume they’re sucking down a lot of power. Analysis shows the lilliputian but powerful devices are surprisingly efficient and may be decreasing our overall power consumption. Courtesy of energy-centric blog Outlier, we’re treated to a look at the power sipping habits of popular smart phones and mobile devices. The simple take away? They use shockingly little electricity over the course of the year–you can charge your new iPhone for a year of regular usage for under a buck. The more complex analysis? The proliferation of tiny and energy efficient devices is displacing heavier energy consumers (large televisions, desktop computers, etc.) and driving a more efficient gadget-to-consumption ratio is many households. Hit up the link below to read the full post. How Much Does It Take to Charge an iPhone [via Mashable] 7 Ways To Free Up Hard Disk Space On Windows HTG Explains: How System Restore Works in Windows HTG Explains: How Antivirus Software Works

    Read the article

  • How to maintain a demo version of an application?

    - by O.O
    I need to be able to demo our production application to prospective clients. The way I have it setup today is simple. The demo application is an exact duplicate of the production system, except that the data in the database is obfuscated to protect our current clients' data. This works great because it doesn't require any application changes. Boss dropped a potential BOMBSHELL today and said that the demo system needs to contain a special link and that ONLY shows up on demo. He went on to explain that in the future there may be much bigger differences between the demo and production apps (e.g. an entire area of functionality). What do I do now? Some things I have thought about doing: Maintain a different branch in subversion specific to the demo system Create an installation package that has the changes for demo, then revert and build a production installation package Modularize the application (no idea how) Say: "Screw you! I will not do it!" (LOL) Use some sort of conditional logic in the app to determine if it is a demo or a production app. E.g. (if the URL contains 'demo' then show else hide). If you haven't guessed by now, this is a web application Anyways, I have no experience in this scenario as to which one is better or if none of these are any good. Anyone have an answer, strategy, something!?

    Read the article

  • How to migrate Notepad++ settings?

    - by NoCatharsis
    I am trying to portabilize every program I use if possible, and Notepad++ is on the list. The only problem is that I've had a native installation until now so that I'm not totally sure which settings files need to be moved to the portable directory. Surely there's a function tucked away somewhere in NPP exactly for this purpose, or some plugin out there? I mean the developers have literally thought of everything else, yet this is the one thing I cannot find specifically anywhere in the NPP wiki or otherwise, and I don't want to miss an important file. Here is the closest I've gotten: Notepad++'s configuration files and Where are all the files? Should I just copy every configuration file listed on the first link?

    Read the article

  • How to monitor nginx proxy cache?

    - by Isaac
    I would like to see which objects get cached by my nginx reverse proxy (with an apache as a backend). So far I could not find a way, only the info that its not implemented yet. The reason is that I would like to tweak my configuration for best performance without putting too much stress on the server, as the backend is a production system. I know benchmarking would be better, but its not an option right now. So I though an alternative measure would be to monitor the cache. Is that possible, and if yes, how? (despite patching nginx with the patch mentioned in the link above)

    Read the article

  • How to work with processes?

    - by Viesturs
    I have seen similar questions here, but I didn't get my answer. Maybe it's because I am new to all this and just don't understand. I want my app to work mostly as an indicator. And if user would start it again it would check if it is already running, if it is then give all the input data to that process and quit. So first I need to check if it is running. I saw the answer where you can make a file witch when the program starts and then check if it exists... But what if someone would delete it? Can't I just ask the OS if there is process named "myApp" or something? The next thing I don't really get is how to communicate with the process. How do I give it the input data and what is it going to do with it? Does it work just like starting a new app, through the main() method? I am trying to create this using Quickly. So it would be nice if you can give me some python examples or link to something like that.

    Read the article

  • Sharepoint asks for NTLM credentials for every unique URL. How do I stop it?

    - by CamronBute
    I'm tasked with troubleshooting a problem we're having with a SP2010 site. The app is external, and there are several clients that must connect. Some clients are receiving a crazy amount of credential requests when trying to log on. It appears to ask for every unique URL (eg. every different picture, link, etc) and it won't stop. Other clients are having no problems. I cannot seem to replicate the issue, either. I'm attempting to replicate by restricting all settings (including cookies) on my own browser, but to no avail. I put the HTTP request under a microscope, and it's asking for NTLM credentials. The client is using IE8, and the browser is running in Protected Mode, but the browser settings cannot be determined... I'm guessing this is a webserver thing, simply because it appears to be an authentication thing. What might the problem be?

    Read the article

  • How can I make .vimrc read from an external file?

    - by GorillaSandwich
    I'd like to modify my .vimrc to read the value of a variable from an external file. How can I do this? Specifically, a friend and I share a git repo with our .vim files, but there are a few small differences in what we want in our configs. So most of the file is common, but we use if statements to determine whether to load user-specific sections, like this: let whoami = "user2" if whoami == "user1" ... After checking our common .vimrc out of source control, we each have to change the let whoami assignment so our own section will be loaded. Instead, I'd like to keep a separate file, which can be different for each of us, and from which vim will load that variable value. Maybe another angle on this is: Will vim automatically read all the files in my .vim directory? If so, we could each put a symlink in there called username.vim, and link that to an external file that would be different for each of us.

    Read the article

  • model association or controller?

    - by andybritton
    I'm trying to create a rails app that allows users to submit information about their pets. I've come to a point where my knowledge is limited and I don't know enough about what/how this could be done so I'm hoping this will be relatively easy to answer. At the moment I have a model called Pet, this model currently stores basic information like name, picture etc but it also holds more specific data like type, breed, date of birth etc. What I would like to be able to do is create a page that can match various records without having to be manually categorized if that makes sense so a users pet could be matched to other pets with the same breed, age etc. I've read about nested models as I understand this information could be submitted to 2 models in one form but I am not sure whether this could be done directly in a separate controller which would only be visible to users with pets in these matched "groups" if that makes sense. So in essence is it best practice to use 1 table to store all the information and just use a controller to match pets based on rows having the same values or would it be far simpler to have a form with a nested model and link 2 tables together? The main feature needs to be matching without a user having to create a group or categorize pets so the second model would need to add id's to an array instead of just creating more and more rows.

    Read the article

  • Simple CMS (separate files for multiple users) [closed]

    - by Pentium100
    I need a simple CMS software (or maybe it's called something else). There are many users (adding new users has to be simple as it will be done manually, no "sign up" link) and those users have to access (just download, no uploading or modification) some files. A file can be shown just to one user or a group of users (a user can belong to multiple groups). Upload a file and tag which users/groups can access it. This can probably be done with FTP, but HTTP would be better. Any software (preferable open source) that can do this without much modification? I can modify PHP code a bit, but I am not a programmer.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

< Previous Page | 567 568 569 570 571 572 573 574 575 576 577 578  | Next Page >