Search Results

Search found 15021 results on 601 pages for 'location aware'.

Page 590/601 | < Previous Page | 586 587 588 589 590 591 592 593 594 595 596 597  | Next Page >

  • Trouble updating my datagrid in WPF

    - by wrigley06
    As the title indicates, I'm having trouble updating a datagrid in WPF. Basically what I'm trying to accomplish is a datagrid, that is connected to a SQL Server database, that updates automatically once a user enters information into a few textboxes and clicks a submit button. You'll notice that I have a command that joins two tables. The data from the Quote_Data table will be inserted by a different user at a later time. For now my only concern is getting the information from the textboxes and into the General_Info table, and from there into my datagrid. The code, which I'll include below compiles fine, but when I hit the submit button, nothing happens. This is the first application I've ever built working with a SQL Database so many of these concepts are new to me, which is why you'll probably look at my code and wonder what is he thinking. public partial class MainWindow : Window { public MainWindow() { InitializeComponent(); } public DataSet mds; // main data set (mds) private void Window_Loaded_1(object sender, RoutedEventArgs e) { try { string connectionString = Sqtm.Properties.Settings.Default.SqtmDbConnectionString; using (SqlConnection connection = new SqlConnection(connectionString)) { connection.Open(); //Merging tables General_Info and Quote_Data SqlCommand cmd = new SqlCommand("SELECT General_Info.Quote_ID, General_Info.Open_Quote, General_Info.Customer_Name," + "General_Info.OEM_Name, General_Info.Qty, General_Info.Quote_Num, General_Info.Fab_Drawing_Num, " + "General_Info.Rfq_Num, General_Info.Rev_Num, Quote_Data.MOA, Quote_Data.MOQ, " + "Quote_Data.Markup, Quote_Data.FOB, Quote_Data.Shipping_Method, Quote_Data.Freight, " + "Quote_Data.Vendor_Price, Unit_Price, Quote_Data.Difference, Quote_Data.Vendor_NRE_ET, " + "Quote_Data.NRE, Quote_Data.ET, Quote_Data.STI_NET, Quote_Data.Mfg_Time, Quote_Data.Delivery_Time, " + "Quote_Data.Mfg_Name, Quote_Data.Mfg_Location " + "FROM General_Info INNER JOIN dbo.Quote_Data ON General_Info.Quote_ID = Quote_Data.Quote_ID", connection); SqlDataAdapter da = new SqlDataAdapter(cmd); DataTable dt = new DataTable(); da.Fill(dt); MainGrid.ItemsSource = dt.DefaultView; mds = new DataSet(); da.Fill(mds, "General_Info"); MainGrid.DataContext = mds.Tables["General_Info"]; } } catch (Exception ex) { MessageBox.Show(ex.Message); } // renaming column names from the database so they are easier to read in the datagrid MainGrid.Columns[0].Header = "#"; MainGrid.Columns[1].Header = "Date"; MainGrid.Columns[2].Header = "Customer"; MainGrid.Columns[3].Header = "OEM"; MainGrid.Columns[4].Header = "Qty"; MainGrid.Columns[5].Header = "Quote Number"; MainGrid.Columns[6].Header = "Fab Drawing Num"; MainGrid.Columns[7].Header = "RFQ Number"; MainGrid.Columns[8].Header = "Rev Number"; MainGrid.Columns[9].Header = "MOA"; MainGrid.Columns[10].Header = "MOQ"; MainGrid.Columns[11].Header = "Markup"; MainGrid.Columns[12].Header = "FOB"; MainGrid.Columns[13].Header = "Shipping"; MainGrid.Columns[14].Header = "Freight"; MainGrid.Columns[15].Header = "Vendor Price"; MainGrid.Columns[16].Header = "Unit Price"; MainGrid.Columns[17].Header = "Difference"; MainGrid.Columns[18].Header = "Vendor NRE/ET"; MainGrid.Columns[19].Header = "NRE"; MainGrid.Columns[20].Header = "ET"; MainGrid.Columns[21].Header = "STINET"; MainGrid.Columns[22].Header = "Mfg. Time"; MainGrid.Columns[23].Header = "Delivery Time"; MainGrid.Columns[24].Header = "Manufacturer"; MainGrid.Columns[25].Header = "Mfg. Location"; } private void submitQuotebtn_Click(object sender, RoutedEventArgs e) { CustomerData newQuote = new CustomerData(); int quantity; quantity = Convert.ToInt32(quantityTxt.Text); string theDate = System.DateTime.Today.Date.ToString("d"); newQuote.OpenQuote = theDate; newQuote.CustomerName = customerNameTxt.Text; newQuote.OEMName = oemNameTxt.Text; newQuote.Qty = quantity; newQuote.QuoteNumber = quoteNumberTxt.Text; newQuote.FdNumber = fabDrawingNumberTxt.Text; newQuote.RfqNumber = rfqNumberTxt.Text; newQuote.RevNumber = revNumberTxt.Text; try { string insertConString = Sqtm.Properties.Settings.Default.SqtmDbConnectionString; using (SqlConnection insertConnection = new SqlConnection(insertConString)) { insertConnection.Open(); SqlDataAdapter adapter = new SqlDataAdapter(Sqtm.Properties.Settings.Default.SqtmDbConnectionString, insertConnection); SqlCommand updateCmd = new SqlCommand("UPDATE General_Info " + "Quote_ID = @Quote_ID, " + "Open_Quote = @Open_Quote, " + "OEM_Name = @OEM_Name, " + "Qty = @Qty, " + "Quote_Num = @Quote_Num, " + "Fab_Drawing_Num = @Fab_Drawing_Num, " + "Rfq_Num = @Rfq_Num, " + "Rev_Num = @Rev_Num " + "WHERE Quote_ID = @Quote_ID"); updateCmd.Connection = insertConnection; System.Data.SqlClient.SqlParameterCollection param = updateCmd.Parameters; // // Add new SqlParameters to the command. // param.AddWithValue("Open_Quote", newQuote.OpenQuote); param.AddWithValue("Customer_Name", newQuote.CustomerName); param.AddWithValue("OEM_Name", newQuote.OEMName); param.AddWithValue("Qty", newQuote.Qty); param.AddWithValue("Quote_Num", newQuote.QuoteNumber); param.AddWithValue("Fab_Drawing_Num", newQuote.FdNumber); param.AddWithValue("Rfq_Num", newQuote.RfqNumber); param.AddWithValue("Rev_Num", newQuote.RevNumber); adapter.UpdateCommand = updateCmd; adapter.Update(mds.Tables[0]); mds.AcceptChanges(); } } catch (Exception ex) { MessageBox.Show(ex.Message); } } Thanks in advance to anyone who can help, I really appreciate it, Andrew

    Read the article

  • Of these 3 methods for reading linked lists from shared memory, why is the 3rd fastest?

    - by Joseph Garvin
    I have a 'server' program that updates many linked lists in shared memory in response to external events. I want client programs to notice an update on any of the lists as quickly as possible (lowest latency). The server marks a linked list's node's state_ as FILLED once its data is filled in and its next pointer has been set to a valid location. Until then, its state_ is NOT_FILLED_YET. I am using memory barriers to make sure that clients don't see the state_ as FILLED before the data within is actually ready (and it seems to work, I never see corrupt data). Also, state_ is volatile to be sure the compiler doesn't lift the client's checking of it out of loops. Keeping the server code exactly the same, I've come up with 3 different methods for the client to scan the linked lists for changes. The question is: Why is the 3rd method fastest? Method 1: Round robin over all the linked lists (called 'channels') continuously, looking to see if any nodes have changed to 'FILLED': void method_one() { std::vector<Data*> channel_cursors; for(ChannelList::iterator i = channel_list.begin(); i != channel_list.end(); ++i) { Data* current_item = static_cast<Data*>(i->get(segment)->tail_.get(segment)); channel_cursors.push_back(current_item); } while(true) { for(std::size_t i = 0; i < channel_list.size(); ++i) { Data* current_item = channel_cursors[i]; ACQUIRE_MEMORY_BARRIER; if(current_item->state_ == NOT_FILLED_YET) { continue; } log_latency(current_item->tv_sec_, current_item->tv_usec_); channel_cursors[i] = static_cast<Data*>(current_item->next_.get(segment)); } } } Method 1 gave very low latency when then number of channels was small. But when the number of channels grew (250K+) it became very slow because of looping over all the channels. So I tried... Method 2: Give each linked list an ID. Keep a separate 'update list' to the side. Every time one of the linked lists is updated, push its ID on to the update list. Now we just need to monitor the single update list, and check the IDs we get from it. void method_two() { std::vector<Data*> channel_cursors; for(ChannelList::iterator i = channel_list.begin(); i != channel_list.end(); ++i) { Data* current_item = static_cast<Data*>(i->get(segment)->tail_.get(segment)); channel_cursors.push_back(current_item); } UpdateID* update_cursor = static_cast<UpdateID*>(update_channel.tail_.get(segment)); while(true) { if(update_cursor->state_ == NOT_FILLED_YET) { continue; } ::uint32_t update_id = update_cursor->list_id_; Data* current_item = channel_cursors[update_id]; if(current_item->state_ == NOT_FILLED_YET) { std::cerr << "This should never print." << std::endl; // it doesn't continue; } log_latency(current_item->tv_sec_, current_item->tv_usec_); channel_cursors[update_id] = static_cast<Data*>(current_item->next_.get(segment)); update_cursor = static_cast<UpdateID*>(update_cursor->next_.get(segment)); } } Method 2 gave TERRIBLE latency. Whereas Method 1 might give under 10us latency, Method 2 would inexplicably often given 8ms latency! Using gettimeofday it appears that the change in update_cursor-state_ was very slow to propogate from the server's view to the client's (I'm on a multicore box, so I assume the delay is due to cache). So I tried a hybrid approach... Method 3: Keep the update list. But loop over all the channels continuously, and within each iteration check if the update list has updated. If it has, go with the number pushed onto it. If it hasn't, check the channel we've currently iterated to. void method_three() { std::vector<Data*> channel_cursors; for(ChannelList::iterator i = channel_list.begin(); i != channel_list.end(); ++i) { Data* current_item = static_cast<Data*>(i->get(segment)->tail_.get(segment)); channel_cursors.push_back(current_item); } UpdateID* update_cursor = static_cast<UpdateID*>(update_channel.tail_.get(segment)); while(true) { for(std::size_t i = 0; i < channel_list.size(); ++i) { std::size_t idx = i; ACQUIRE_MEMORY_BARRIER; if(update_cursor->state_ != NOT_FILLED_YET) { //std::cerr << "Found via update" << std::endl; i--; idx = update_cursor->list_id_; update_cursor = static_cast<UpdateID*>(update_cursor->next_.get(segment)); } Data* current_item = channel_cursors[idx]; ACQUIRE_MEMORY_BARRIER; if(current_item->state_ == NOT_FILLED_YET) { continue; } found_an_update = true; log_latency(current_item->tv_sec_, current_item->tv_usec_); channel_cursors[idx] = static_cast<Data*>(current_item->next_.get(segment)); } } } The latency of this method was as good as Method 1, but scaled to large numbers of channels. The problem is, I have no clue why. Just to throw a wrench in things: if I uncomment the 'found via update' part, it prints between EVERY LATENCY LOG MESSAGE. Which means things are only ever found on the update list! So I don't understand how this method can be faster than method 2. The full, compilable code (requires GCC and boost-1.41) that generates random strings as test data is at: http://pastebin.com/e3HuL0nr

    Read the article

  • A couple PHP/MySQL questions...

    - by Jeff
    I am a college student taking a course in php and mysql progamming and my first question is about the "$variable" variables in the following code: <?php ob_start(); ?> <?php session_start(); if ($_SESSION['auth'] != "true") { header("Location: login.php"); exit; } $uid = $_SESSION['user']; $connection = mysql_connect("localhost", "username", "password"); mysql_select_db("username", $connection); $result = mysql_query ( "SELECT * FROM users where user_id = '$uid'", $connection); $num = mysql_numrows($result); $i=0; while ($i < $num) { $f1=mysql_result($result,$i,"firstname"); $f2=mysql_result($result,$i,"lastname"); ?> <html><body> <p> <td><center><font size = "18" face="Arial"><?php echo "Name: $f1 "; echo $f2; ?> </font></center></td> </p> </body></html> <?php $i++; } ?> <?php $result1 = mysql_query ( "SELECT * FROM phone where user_id = '$uid'", $connection); $num1 = mysql_numrows($result1); $j=0; while ($j < $num1) { $f3=mysql_result($result1,$j,"type"); $f4=mysql_result($result1,$j,"number"); ?> <html><body> <p> <br> <td><center><font size = "12" face="Arial"><?php echo "$f5: "; echo "($f3) "; echo "$f4 <br />"; ?> </font></center></td> </p> </body></html> <?php $j++; } ?> <?php $result2 = mysql_query ( "SELECT * FROM address where user_id = '$uid'", $connection); $num2 = mysql_numrows($result2); $h=0; while ($h < $num2) { $f6=mysql_result($result2,$h,"type"); $f7=mysql_result($result2,$h,"address"); $f8=mysql_result($result2,$h,"city"); $f9=mysql_result($result2,$h,"state"); $f10=mysql_result($result2,$h,"zip"); ?> <html><body> <p> <br> <td><center><font size = "12" face="Arial"><?php echo "$f10 Address: $f6, $f7, $f8 $f9"; ?></font></center></td> </p> </body></html> <?php $h++; } ?> <?php include 'navbar.php'; ob_end_flush(); ?> I just don't really understand the $variables at all. Are they user-generated or are they entities in the database? And how does the code know which $result is which? My second question is that, if this was someone else in my class's code and I wanted to modify it to make it my own and substitute my own variables, how would I go about doing that? Do the $variables need to be changed if they are not user-defined and if so, how? I apologize if these are dumb questions, but I am a beginner at this programming language. Thanks in advance for your help. -Jeff

    Read the article

  • Need help debugging a PHP 5 SOAP hello world application

    - by WarDoGG
    I've been trying to get PHP 5 SOAP extension to work after reading every tutorial there is on the web, but to no avail. This has been very frustrating and i would really appreciate it if someone could point out where i am going wrong and why. Thanks for your help in advance, and any more details needed i'll oblige. The WSDL is as follows : <?xml version="1.0" encoding="utf-8"?> <wsdl:definitions name="test" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:tm="http://microsoft.com/wsdl/mime/textMatching/" xmlns:soapenc="http://schemas.xmlsoap.org/soap/encoding/" xmlns:mime="http://schemas.xmlsoap.org/wsdl/mime/" xmlns:tns="http://tempuri.org/" xmlns:s1="http://microsoft.com/wsdl/types/" xmlns:s="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://schemas.xmlsoap.org/wsdl/soap12/" xmlns:http="http://schemas.xmlsoap.org/wsdl/http/" targetNamespace="http://tempuri.org/" xmlns:wsdl="http://schemas.xmlsoap.org/wsdl/"> <wsdl:types> <s:schema elementFormDefault="qualified" targetNamespace="http://tempuri.org/"> <s:import namespace="http://microsoft.com/wsdl/types/" /> <s:element name="getUser"> <s:complexType> <s:sequence> <s:element minOccurs="0" maxOccurs="1" name="username" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="password" type="s:string" /> </s:sequence> </s:complexType> </s:element> <s:element name="getUserResponse"> <s:complexType> <s:sequence> <s:element minOccurs="0" maxOccurs="1" name="getUserResult" type="tns:bookUser" /> </s:sequence> </s:complexType> </s:element> <s:complexType name="bookUser"> <s:sequence> <s:element minOccurs="1" maxOccurs="1" name="ID" type="s:int" /> <s:element minOccurs="1" maxOccurs="1" name="GUID" type="s1:guid" /> <s:element minOccurs="0" maxOccurs="1" name="login" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="pass" type="s:string" /> </s:sequence> </s:complexType> </s:schema> </wsdl:types> <wsdl:message name="getUserSoapIn"> <wsdl:part name="parameters" element="tns:getUser" /> </wsdl:message> <wsdl:message name="getUserSoapOut"> <wsdl:part name="parameters" element="tns:getUserResponse" /> </wsdl:message> <wsdl:portType name="test"> <wsdl:operation name="getUser"> <wsdl:input message="tns:getUserSoapIn" /> <wsdl:output message="tns:getUserSoapOut" /> </wsdl:operation> </wsdl:portType> <wsdl:binding name="testBinding" type="tns:test"> <soap:binding style="document" transport="http://schemas.xmlsoap.org/soap/http" /> <wsdl:operation name="getUser"> <soap:operation soapAction="http://tempuri.org/getUser" /> <wsdl:input> <soap:body use="literal" /> </wsdl:input> <wsdl:output> <soap:body use="literal" /> </wsdl:output> </wsdl:operation> </wsdl:binding> <wsdl:service name="testService"> <wsdl:port name="testPort" binding="tns:testBinding"> <soap:address location="http://127.0.0.1/index.php" /> </wsdl:port> </wsdl:service> </wsdl:definitions> The code for the server : <?php function getUser($param) { return array( 'bookUser'=>array ( 'ID'=>1, 'GUID'=>2, 'login'=>$param->username, 'pass'=>$param->password ) ); } ini_set("soap.wsdl_cache_enabled", "0"); // disabling WSDL cache $server = new SoapServer("http://127.0.0.1/1.wsdl"); $server->addFunction("getUser"); $server->handle(); ?> and the code for the client : $client = new SoapClient("http://127.0.0.1/index.php?wsdl", array('exceptions' => 0)); try { $arr_data = array ( array ( 'username'=>'xyz', 'password'=>'abc' ) ); print_r($client->__soapCall("getUser",$arr_data)); } catch (SoapFault $result) { print_r($result); }

    Read the article

  • Rename image file on upload php

    - by blasteralfred
    Hi, I have a form which uploads and re sizes image. The html file file submits data to a php file. The script is as follows; Index.html <form action="resizer.php" method="post" enctype="multipart/form-data"> Image: <input type="file" name="file" /> <input type="submit" name="submit" value="upload" /> </form> Resizer.php <?php require_once('imageresizer.class.php'); $imagename = "myimagename"; //Path To Upload Directory $dirpath = "uploaded/"; //MAX WIDTH AND HEIGHT OF IMAGE $max_height = 100; $max_width = 100; //Create Image Control Object - Parameters(file name, file tmp name, file type, directory path) $resizer = new ImageResizer($_FILES['file']['name'],$_FILES['file']['tmp_name'],$dirpath); //RESIZE IMAGE - Parameteres(max height, max width) $resizer->resizeImage($max_height,$max_width); //Display Image $resizer->showResizedImage(); ?> imageresizer.class.php <?php class ImageResizer{ public $file_name; public $tmp_name; public $dir_path; //Set variables public function __construct($file_name,$tmp_name,$dir_path){ $this->file_name = $file_name; $this->tmp_name = $tmp_name; $this->dir_path = $dir_path; $this->getImageInfo(); $this->moveImage(); } //Move the uploaded image to the new directory and rename public function moveImage(){ if(!is_dir($this->dir_path)){ mkdir($this->dir_path,0777,true); } if(move_uploaded_file($this->tmp_name,$this->dir_path.'_'.$this->file_name)){ $this->setFileName($this->dir_path.'_'.$this->file_name); } } //Define the new filename public function setFileName($file_name){ $this->file_name = $file_name; return $this->file_name; } //Resize the image function with new max height and width public function resizeImage($max_height,$max_width){ $this->max_height = $max_height; $this->max_width = $max_width; if($this->height > $this->width){ $ratio = $this->height / $this->max_height; $new_height = $this->max_height; $new_width = ($this->width / $ratio); } elseif($this->height < $this->width){ $ratio = ($this->width / $this->max_width); $new_width = $this->max_width; $new_height = ($this->height / $ratio); } else{ $new_width = $this->max_width; $new_height = $this->max_height; } $thumb = imagecreatetruecolor($new_width, $new_height); switch($this->file_type){ case 1: $image = imagecreatefromgif($this->file_name); break; case 2: $image = imagecreatefromjpeg($this->file_name); break; case 3: $image = imagecreatefrompng($this->file_name); break; case 4: $image = imagecreatefromwbmp($this->file_name); } imagecopyresampled($thumb, $image, 0, 0, 0, 0, $new_width, $new_height, $this->width, $this->height); switch($this->file_type){ case 1: imagegif($thumb,$this->file_name); break; case 2: imagejpeg($thumb,$this->file_name,100); break; case 3: imagepng($thumb,$this->file_name,0); break; case 4: imagewbmp($thumb,$this->file_name); } imagedestroy($image); imagedestroy($thumb); } public function getImageInfo(){ list($width, $height, $type) = getimagesize($this->tmp_name); $this->width = $width; $this->height = $height; $this->file_type = $type; } public function showResizedImage(){ echo "<img src='".$this->file_name." />"; } public function onSuccess(){ header("location: index.php"); } } ?> Everything is working well. The image will be uploaded in it's original filename and extension with a "_" prefix. But i want to rename the image to "myimagename" on upload, which is a variable in "Resizer.php". How can i make this possible?? Thanks in advance :) blasteralfred

    Read the article

  • Authoritative sources about Database vs. Flatfile decision

    - by FastAl
    <tldr>looking for a reference to a book or other undeniably authoritative source that gives reasons when you should choose a database vs. when you should choose other storage methods. I have provided an un-authoritative list of reasons about 2/3 of the way down this post.</tldr> I have a situation at my company where a database is being used where it would be better to use another solution (in this case, an auto-generated piece of source code that contains a static lookup table, searched by binary sort). Normally, a database would be an OK solution even though the problem does not require a database, e.g, none of the elements of ACID are needed, as it is read-only data, updated about every 3-5 years (also requiring other sourcecode changes), and fits in memory, and can be keyed into via binary search (a tad faster than db, but speed is not an issue). The problem is that this code runs on our enterprise server, but is shared with several PC platforms (some disconnected, some use a central DB, etc.), and parts of it are managed by multiple programming units, parts by the DBAs, parts even by mathematicians in another department, etc. These hit their own platform’s version of their databases (containing their own copy of the static data). What happens is that every implementation, every little change, something different goes wrong. There are many other issues as well. I can’t even use a flatfile, because one mode of running on our enterprise server does not have permission to read files (only databases, and of course, its own literal storage, e.g., in-source table). Of course, other parts of the system use databases in proper, less obscure manners; there is no problem with those parts. So why don’t we just change it? I don’t have administrative ability to force a change. But I’m affected because sometimes I have to help fix the problems, but mostly because it causes outages and tons of extra IT time by other programmers and d*mmit that makes me mad! The reason neither management, nor the designers of the system, can see the problem is that they propose a solution that won’t work: increase communication; implement more safeguards and standards; etc. But every time, in a different part of the already-pared-down but still multi-step processes, a few different diligent, hard-working, top performing IT personnel make a unique subtle error that causes it to fail, sometimes after the last round of testing! And in general these are not single-person failures, but understandable miscommunications. And communication at our company is actually better than most. People just don't think that's the case because they haven't dug into the matter. However, I have it on very good word from somebody with extensive formal study of sociology and psychology that the relatively small amount of less-than-proper database usage in this gigantic cross-platform multi-source, multi-language project is bureaucratically un-maintainable. Impossible. No chance. At least with Human Beings in the loop, and it can’t be automated. In addition, the management and developers who could change this, though intelligent and capable, don’t understand the rigidity of this ‘how humans are’ issue, and are not convincible on the matter. The reason putting the static data in sourcecode will solve the problem is, although the solution is less sexy than a database, it would function with no technical drawbacks; and since the sharing of sourcecode already works very well, you basically erase any database-related effort from this section of the project, along with all the drawbacks of it that are causing problems. OK, that’s the background, for the curious. I won’t be able to convince management that this is an unfixable sociological problem, and that the real solution is coding around these limits of human nature, just as you would code around a bug in a 3rd party component that you can’t change. So what I have to do is exploit the unsuitableness of the database solution, and not do it using logic, but rather authority. I am aware of many reasons, and posts on this site giving reasons for one over the other; I’m not looking for lists of reasons like these (although you can add a comment if I've miss a doozy): WHY USE A DATABASE? instead of flatfile/other DB vs. file: if you need... Random Read / Transparent search optimization Advanced / varied / customizable Searching and sorting capabilities Transaction/rollback Locks, semaphores Concurrency control / Shared users Security 1-many/m-m is easier Easy modification Scalability Load Balancing Random updates / inserts / deletes Advanced query Administrative control of design, etc. SQL / learning curve Debugging / Logging Centralized / Live Backup capabilities Cached queries / dvlp & cache execution plans Interleaved update/read Referential integrity, avoid redundant/missing/corrupt/out-of-sync data Reporting (from on olap or oltp db) / turnkey generation tools [Disadvantages:] Important to get right the first time - professional design - but only b/c it's meant to last s/w & h/w cost Usu. over a network, speed issue (best vs. best design vs. local=even then a separate process req's marshalling/netwk layers/inter-p comm) indicies and query processing can stand in the way of simple processing (vs. flatfile) WHY USE FLATFILE: If you only need... Sequential Row processing only Limited usage append only (no reading, no master key/update) Only Update the record you're reading (fixed length recs only) Too big to fit into memory If Local disk / read-ahead network connection Portability / small system Email / cut & Paste / store as document by novice - simple format Low design learning curve but high cost later WHY USE IN-MEMORY/TABLE (tables, arrays, etc.): if you need... Processing a single db/ff record that was imported Known size of data Static data if hardcoding the table Narrow, unchanging use (e.g., one program or proc) -includes a class that will be shared, but encapsulates its data manipulation Extreme speed needed / high transaction frequency Random access - but search is dependent on implementation Following are some other posts about the topic: http://stackoverflow.com/questions/1499239/database-vs-flat-text-file-what-are-some-technical-reasons-for-choosing-one-over http://stackoverflow.com/questions/332825/are-flat-file-databases-any-good http://stackoverflow.com/questions/2356851/database-vs-flat-files http://stackoverflow.com/questions/514455/databases-vs-plain-text/514530 What I’d like to know is if anybody could recommend a hard, authoritative source containing these reasons. I’m looking for a paper book I can buy, or a reputable website with whitepapers about the issue (e.g., Microsoft, IBM), not counting the user-generated content on those sites. This will have a greater change to elicit a change that I’m looking for: less wasted programmer time, and more reliable programs. Thanks very much for your help. You win a prize for reading such a large post!

    Read the article

  • How to create a SOAP REQUEST using ASP.NET (VB) without using Visual

    - by user311691
    Hi all , I urgently need your help . I am new to consuming a web service using SOAP protocol. I have been given a demo webservice URL which ends in .WSDL and NOT .asml?WSDL. The problem is I cannot add a web reference using Visual studio OR Disco.exe or Wsdl.exe - This webservice has been created on a java platform and for security reasons the only way to make a invoke the webservice is at runtime using SOAP protocol IN asp.net (VB). I I have created some code but cannot seem to send the soap object to the receiving web service. If I could get a solution with step by step instructions on how I can send a SOAP REQUEST. Below is my code and all am trying to do is send a SOAP REQUEST and receive a SOAP RESPONSE which I will display in my browser. <%@ page language="vb" %> <%@ Import Namespace="System.Data"%> <%@ Import Namespace="System.Xml"%> <%@ Import Namespace="System.Net"%> <%@ Import Namespace="System.IO"%> <%@ Import Namespace="System.Text"%> <script runat=server> Private Sub Page_Load() Dim objHTTPReq As HttpWebRequest Dim WebserviceUrl As String = "http://xx.xx.xx:8084/asy/wsdl/asy.wsdl" objHTTPReq = CType(WebRequest.Create(WebserviceUrl), HttpWebRequest) Dim soapXML As String soapXML = "<?xml version='1.0' encoding='utf-8'?>" & _ " <soap:Envelope xmlns:xsi='http://www.w3.org/2001/XMLSchema-instance'" & _ " xmlns:xsd='http://www.w3.org/2001/XMLSchema'"& _ " xmlns:soap='http://schemas.xmlsoap.org/soap/envelope/' >"& _ " <soap:Body> "& _ " <validatePaymentData xmlns='http://asybanks.webservices.asycuda.org'> " & _ " <bankCode>"& bankCode &"</bankCode> " & _ " <PaymentDataType>" & _ " <paymentType>"& payment_type &"</paymentType> " & _ " <amount>"& ass_amount &"</amount> " & _ " <ReferenceType>" & _ " <year>"& year &"</year> " & _ " <customsOfficeCode>"& station &"</customsOfficeCode> " & _ " </ReferenceType>" & _ " <accountNumber>"& zra_account &"</accountNumber> " & _ " </PaymentDataType> " & _ " </validatePaymentData> " & _ " </soap:Body> " & _ " </soap:Envelope> " objHTTPReq.Headers.Add("SOAPAction", "http://asybanks.webservices.asycuda.org") objHTTPReq.ContentType = "text/xml; charset=utf-8" objHTTPReq.ContentLength = soapXML.Length objHTTPReq.Accept = "text/xml" objHTTPReq.Method = "POST" Dim objHTTPRes As HttpWebResponse = CType(objHTTPReq.GetResponse(), HttpWebResponse) Dim dataStream As Stream = objHTTPRes.GetResponseStream() Dim reader As StreamReader = new StreamReader(dataStream) Dim responseFromServer As String = reader.ReadToEnd() OurXml.text = responseFromServer End Sub </script> <html xmlns="http://www.w3.org/1999/xhtml"> <head runat="server"> <title> XML TRANSACTION SIMULATION - N@W@ TJ </title> </head> <body> <form id="form1" runat="server"> <div> <p>ZRA test Feedback:</p> <asp:label id="OurXml" runat="server"/> </div> </form> </body> </html> the demo webservice looks like this: <?xml version="1.0" encoding="UTF-8" ?> - <!-- WEB SERVICE JAVA DEMO --> - <definitions targetNamespace="http://asybanks.webservices.asycuda.org" xmlns="http://schemas.xmlsoap.org/wsdl/" xmlns:apachesoap="http://xml.apache.org/xml-soap" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:y="http://asybanks.webservices.asycuda.org"> - <types> - <xs:schema elementFormDefault="qualified" targetNamespace="http://asybanks.webservices.asycuda.org" xmlns="http://www.w3.org/2001/XMLSchema"> SOME OTHER INFORMATION AT THE BOTTOM <soap:address location="http://xx.xx.xx:8084/asy/services/asy" /> </port> </service> </definitions> From the above excerpt of the wsdl url webservice, I am not sure which namespace to use for soapACTION - please advise.... Please if you could comment every stage of a soap request and provide a working demo - I would be most grateful as I would be learning rather than just assuming stuff :)

    Read the article

  • How do I add the j2ee.jar to a Java2WSDL ant script programmatically?

    - by Marcus
    I am using IBM's Rational Application Developer. I have an ant script that contains the Java2WSDL task. When I run it via IBM, it gives compiler errors unless I include the j2ee.jar file in the classpath via the run tool (it does not pick up the jar files in the classpath in the script). However, I need to be able to call this script programmatically, and it is giving me this error: "java.lang.NoClassDefFoundError: org.eclipse.core.runtime.CoreException" I'm not sure which jars need to be added or where? Since a simple echo script runs, I assume that it is the j2ee.jar or another ant jar that needs to be added. I've added it to the project's buildpath, but that doesn't help. (I also have ant.jar, wsanttasks.jar, all the ant jars from the plugin, tools.jar, remoteAnt.jar, and the swt - all which are included in the buildpath when you run the script by itself.) Script: <?xml version="1.0" encoding="UTF-8"?> <project default="build" basedir="."> <path id="lib.path"> <fileset dir="C:\Program Files\IBM\WebSphere\AppServer\lib" includes="*.jar"/> <!-- Adding these does not help. <fileset dir="C:\Program Files\IBM\SDP70Shared\plugins\org.apache.ant_1.6.5\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70\jdk\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70\configuration\org.eclipse.osgi\bundles\1139\1\.cp\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70Shared\plugins" includes="*.jar"/> --> </path> <taskdef name="java2wsdl" classname="com.ibm.websphere.ant.tasks.Java2WSDL"> <classpath refid="lib.path"/> </taskdef> <target name="build"> <echo message="Beginning build"/> <javac srcdir="C:\J2W_Test\Java2Wsdl_Example" destdir="C:\J2W_Test\Java2Wsdl_Example"> <classpath refid="lib.path"/> <include name="WSExample.java"/> </javac> <echo message="Set up javac"/> <echo message="Running java2wsdl"/> <java2wsdl output="C:\J2W_Test\Java2Wsdl_Example\example\META-INF\wsdl\WSExample.wsdl" classpath="C:\J2W_Test\Java2Wsdl_Example" className= "example.WSExample" namespace="http://example" namespaceImpl="http://example" location="http://localhost:9080/example/services/WSExample" style="document" use="literal"> <mapping namespace="http://example" package="example"/> </java2wsdl> <echo message="Complete"/> </target> </project> Code: File buildFile = new File("build.xml"); Project p = new Project(); p.setUserProperty("ant.file", buildFile.getAbsolutePath()); DefaultLogger consoleLogger = new DefaultLogger(); consoleLogger.setErrorPrintStream(System.err); consoleLogger.setOutputPrintStream(System.out); consoleLogger.setMessageOutputLevel(Project.MSG_INFO); p.addBuildListener(consoleLogger); try { p.fireBuildStarted(); p.init(); ProjectHelper helper = ProjectHelper.getProjectHelper(); p.addReference("ant.projectHelper", helper); helper.parse(p, buildFile); p.executeTarget(p.getDefaultTarget()); p.fireBuildFinished(null); } catch (BuildException e) { p.fireBuildFinished(e); } Error: [java2wsdl] java.lang.NoClassDefFoundError: org.eclipse.core.runtime.CoreException [java2wsdl] at java.lang.J9VMInternals.verifyImpl(Native Method) [java2wsdl] at java.lang.J9VMInternals.verify(J9VMInternals.java:68) [java2wsdl] at java.lang.J9VMInternals.initialize(J9VMInternals.java:129) [java2wsdl] at com.ibm.ws.webservices.multiprotocol.discovery.ServiceProviderManager.getDiscoveredServiceProviders(ServiceProviderManager.java:378) [java2wsdl] at com.ibm.ws.webservices.multiprotocol.discovery.ServiceProviderManager.getAllServiceProviders(ServiceProviderManager.java:214) [java2wsdl] at com.ibm.ws.webservices.wsdl.fromJava.Emitter.initPluggableBindings(Emitter.java:2704) [java2wsdl] at com.ibm.ws.webservices.wsdl.fromJava.Emitter.<init>(Emitter.java:389) [java2wsdl] at com.ibm.ws.webservices.tools.ant.Java2WSDL.execute(Java2WSDL.java:122) [java2wsdl] at org.apache.tools.ant.UnknownElement.execute(UnknownElement.java:275) [java2wsdl] at org.apache.tools.ant.Task.perform(Task.java:364) [java2wsdl] at org.apache.tools.ant.Target.execute(Target.java:341) [java2wsdl] at org.apache.tools.ant.Target.performTasks(Target.java:369) [java2wsdl] at org.apache.tools.ant.Project.executeSortedTargets(Project.java:1216) [java2wsdl] at org.apache.tools.ant.Project.executeTarget(Project.java:1185) [java2wsdl] at att.ant.RunAnt.main(RunAnt.java:32)

    Read the article

  • Fix a box 250px from top of content with wrapping content

    - by Matt
    I'm having trouble left aligning a related links div inside a block of text, exactly 250 pixels from the top of a content area, while retaining word wrapping. I attempted to do this with absolute positioning, but the text in the content area doesn't wrap around the content. I would just fix the related links div in the content, however, this will display on an article page, so I would like for it to be done without placing it in a specific location in the content. Is this possible? If so, can someone help me out with the CSS for this? Example image of desired look & feel... UPDATE: For simplicity, I've added example code. You can view this here: http://www.focusontheclouds.com/files/example.html. Example HTML: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Example Page</title> <style> body { width: 400px; font-family: Arial, sans-serif; } h1 { font-family: Georgia, serif; font-weight: normal; } .relatedLinks { position: relative; width: 150px; text-align: center; background: #f00; height: 300px; float: left; margin: 0 10px 10px 0; } </style> </head> <body> <div class="relatedLinks"><h1>Related Links</h1></div> <p>Lorem ipsum dolor sit amet, consectetur adipiscing elit. Nunc tempus est luctus ante auctor et ullamcorper metus ullamcorper. Vestibulum molestie, lectus sed luctus egestas, dolor ipsum aliquet orci, ac bibendum quam elit blandit nulla.</p> <p>In sit amet sagittis urna. In fermentum enim et lectus consequat a congue elit porta. Pellentesque nisl quam, elementum vitae elementum et, facilisis quis velit. Nam odio neque, viverra in consectetur at, mollis eu mi. Etiam tempor odio vitae ligula ultrices mollis. </p> <p>Donec eget ligula id augue pulvinar lobortis. Mauris tincidunt suscipit felis, eget eleifend lectus molestie in. Donec et massa arcu. Aenean eleifend nulla at odio adipiscing quis interdum arcu dictum. Fusce tellus dolor, tempor ut blandit a, dapibus ac ante. Nulla eget ligula at turpis consequat accumsan egestas nec purus. Nullam sit amet turpis ac lacus tincidunt hendrerit. Nulla iaculis mauris sed enim ornare molestie. </p> <p>Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus. Maecenas non purus diam. Suspendisse iaculis tincidunt tempor. Suspendisse ut pretium lectus. Maecenas id est dui.</p> <p>Nunc pretium ipsum id libero rhoncus varius. Duis imperdiet elit ut turpis porta pharetra. Nulla vel dui vitae ipsum sollicitudin varius. Duis sagittis elit felis, quis interdum odio. </p> <p>Morbi imperdiet volutpat sodales. Aenean non euismod est. Cras ultricies felis non tortor congue ultrices. Proin quis enim arcu. Cras mattis sagittis erat, elementum bibendum ipsum imperdiet eu. Morbi fringilla ullamcorper elementum. Vestibulum semper dui non elit luctus quis accumsan ante scelerisque.</p> </body> </html>

    Read the article

  • Why does calling IEnumerable<string>.Count() create an additional assembly dependency ?

    - by Gishu
    Assume this chain of dll references Tests.dll >> Automation.dll >> White.Core.dll with the following line of code in Tests.dll, where everything builds result.MissingPaths Now when I change this to result.MissingPaths.Count() I get the following build error for Tests.dll "White.UIItem is not defined in an assembly that is not referenced. You must add a reference to White.Core.dll." And I don't want to do that because it breaks my layering. Here is the type definition for result, which is in Automation.dll public class HasResult { public HasResult(IEnumerable<string> missingPaths ) { MissingPaths = missingPaths; } public IEnumerable<string> MissingPaths { get; set; } public bool AllExist { get { return !MissingPaths.Any(); } } } Down the call chain the input param to this ctor is created via (The TreeNode class is in White.Core.dll) assetPaths.Where(assetPath => !FindTreeNodeUsingCache(treeHandle, assetPath)); Why does this dependency leak when calling Count() on IEnumerable ? I then suspected that lazy evaluation was causing this (for some reason) - so I slotted in an ToArray() in the above line but didn't work. Update 2011 01 07: Curiouser and Curiouser! it won't build until I add a White.Core reference. So I add a reference and build it (in order to find the elusive dependency source). Open it up in Reflector and the only references listed are Automation, mscorlib, System.core and NUnit. So the compiler threw away the White reference as it was not needed. ILDASM also confirms that there is no White AssemblyRef entry. Any ideas on how to get to the bottom of this thing (primarily for 'now I wanna know why' reasons)? What are the chances that this is an VS2010/MSBuild bug? Update 2011 01 07 #2 As per Shimmy's suggestion, tried calling the method explcitly as an extension method Enumerable.Count(result.MissingPaths) and it stops cribbing (not sure why). However I moved some code around after that and now I'm getting the same issue at a different location using IEnumerable - this time reading and filtering lines out of a file on disk (totally unrelated to White). Seems like it's a 'symptom-fix'. var lines = File.ReadLines(aFilePath).ToArray(); once again, if I remove the ToArray() it compiles again - it seems that any method that causes the enumerable to be evaluated (ToArray, Count, ToList, etc.) causes this. Let me try and get a working tiny-app to demo this issue... Update 2011 01 07 #3 Phew! More information.. It turns out the problem is just in one source file - this file is LINQ-phobic. Any call to an Enumerable extension method has to be explicitly called out. The refactorings that I did caused a new method to be moved into this source file, which had some LINQ :) Still no clue as to why this class dislikes LINQ. using System; using System.Collections.Generic; using System.IO; using System.Linq; using G.S.OurAutomation.Constants; using G.S.OurAutomation.Framework; using NUnit.Framework; namespace G.S.AcceptanceTests { public abstract class ConfigureThingBase : OurTestFixture { .... private static IEnumerable<string> GetExpectedThingsFor(string param) { // even this won't compile - although it compiles fine in an adjoining source file in the same assembly //IEnumerable<string> s = new string[0]; //Console.WriteLine(s.Count()); // this is the line that is now causing a build failure // var expectedInfo = File.ReadLines(someCsvFilePath)) // .Where(line => !line.StartsWith("REM", StringComparison.InvariantCultureIgnoreCase)) // .Select(line => line.Replace("%PLACEHOLDER%", param)) // .ToArray(); // Unrolling the LINQ above removes the build error var expectedInfo = Enumerable.ToArray( Enumerable.Select( Enumerable.Where( File.ReadLines(someCsvFilePath)), line => !line.StartsWith("REM", StringComparison.InvariantCultureIgnoreCase)), line => line.Replace("%PLACEHOLDER%", param)));

    Read the article

  • How to declare a vector or array of reducer objects in Cilk++?

    - by Jin
    Hi All, I had a problem when I am using Cilk++, an extension to C++ for parallel computing. I found that I can't declare a vector of reducer objects: typedef cilk::reducer_opadd<int> T_reducer; vector<T_reducer> bitmiss_vec; for (int i = 0; i < 24; ++i) { T_reducer r; bitmiss_vec.push_back(r); } However, when I compile the code with Cilk++, it complains at the push_back() line: cilk++ geneAttack.cilk -O1 -g -lcilkutil -o geneAttack /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/cilk++/reducer_opadd.h: In member function ‘void __gnu_cxx::new_allocator<_Tp>::construct(_Tp*, const _Tp&) [with _Tp = cilk::reducer_opadd<int>]’: /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/stl_vector.h:601: instantiated from ‘void std::vector<_Tp, _Alloc>::push_back(const _Tp&) [with _Tp = cilk::reducer_opadd<int>, _Alloc = std::allocator<cilk::reducer_opadd<int> >]’ geneAttack.cilk:667: instantiated from here /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/cilk++/reducer_opadd.h:229: error: ‘cilk::reducer_opadd<Type>::reducer_opadd(const cilk::reducer_opadd<Type>&) [with Type = int]’ is private /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/ext/new_allocator.h:107: error: within this context /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/cilk++/reducer_opadd.h: In member function ‘void std::vector<_Tp, _Alloc>::_M_insert_aux(__gnu_cxx::__normal_iterator<typename std::_Vector_base<_Tp, _Alloc>::_Tp_alloc_type::pointer, std::vector<_Tp, _Alloc> >, const _Tp&) [with _Tp = cilk::reducer_opadd<int>, _Alloc = std::allocator<cilk::reducer_opadd<int> >]’: /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/stl_vector.h:605: instantiated from ‘void std::vector<_Tp, _Alloc>::push_back(const _Tp&) [with _Tp = cilk::reducer_opadd<int>, _Alloc = std::allocator<cilk::reducer_opadd<int> >]’ geneAttack.cilk:667: instantiated from here /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/cilk++/reducer_opadd.h:229: error: ‘cilk::reducer_opadd<Type>::reducer_opadd(const cilk::reducer_opadd<Type>&) [with Type = int]’ is private /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/vector.tcc:252: error: within this context /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/stl_vector.h:605: instantiated from ‘void std::vector<_Tp, _Alloc>::push_back(const _Tp&) [with _Tp = cilk::reducer_opadd<int>, _Alloc = std::allocator<cilk::reducer_opadd<int> >]’ geneAttack.cilk:667: instantiated from here /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/cilk++/reducer_opadd.h:230: error: ‘cilk::reducer_opadd<Type>& cilk::reducer_opadd<Type>::operator=(const cilk::reducer_opadd<Type>&) [with Type = int]’ is private /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/vector.tcc:256: error: within this context /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/cilk++/reducer_opadd.h: In static member function ‘static _BI2 std::__copy_backward<_BoolType, std::random_access_iterator_tag>::__copy_b(_BI1, _BI1, _BI2) [with _BI1 = cilk::reducer_opadd<int>*, _BI2 = cilk::reducer_opadd<int>*, bool _BoolType = false]’: /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/stl_algobase.h:465: instantiated from ‘_BI2 std::__copy_backward_aux(_BI1, _BI1, _BI2) [with _BI1 = cilk::reducer_opadd<int>*, _BI2 = cilk::reducer_opadd<int>*]’ /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/stl_algobase.h:474: instantiated from ‘static _BI2 std::__copy_backward_normal<<anonymous>, <anonymous> >::__copy_b_n(_BI1, _BI1, _BI2) [with _BI1 = cilk::reducer_opadd<int>*, _BI2 = cilk::reducer_opadd<int>*, bool <anonymous> = false, bool <anonymous> = false]’ /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/stl_algobase.h:540: instantiated from ‘_BI2 std::copy_backward(_BI1, _BI1, _BI2) [with _BI1 = cilk::reducer_opadd<int>*, _BI2 = cilk::reducer_opadd<int>*]’ /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/vector.tcc:253: instantiated from ‘void std::vector<_Tp, _Alloc>::_M_insert_aux(__gnu_cxx::__normal_iterator<typename std::_Vector_base<_Tp, _Alloc>::_Tp_alloc_type::pointer, std::vector<_Tp, _Alloc> >, const _Tp&) [with _Tp = cilk::reducer_opadd<int>, _Alloc = std::allocator<cilk::reducer_opadd<int> >]’ /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/stl_vector.h:605: instantiated from ‘void std::vector<_Tp, _Alloc>::push_back(const _Tp&) [with _Tp = cilk::reducer_opadd<int>, _Alloc = std::allocator<cilk::reducer_opadd<int> >]’ geneAttack.cilk:667: instantiated from here /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/cilk++/reducer_opadd.h:230: error: ‘cilk::reducer_opadd<Type>& cilk::reducer_opadd<Type>::operator=(const cilk::reducer_opadd<Type>&) [with Type = int]’ is private /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/stl_algobase.h:433: error: within this context /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/cilk++/reducer_opadd.h: In function ‘void std::_Construct(_T1*, const _T2&) [with _T1 = cilk::reducer_opadd<int>, _T2 = cilk::reducer_opadd<int>]’: /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/stl_uninitialized.h:87: instantiated from ‘_ForwardIterator std::__uninitialized_copy_aux(_InputIterator, _InputIterator, _ForwardIterator, std::__false_type) [with _InputIterator = cilk::reducer_opadd<int>*, _ForwardIterator = cilk::reducer_opadd<int>*]’ /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/stl_uninitialized.h:114: instantiated from ‘_ForwardIterator std::uninitialized_copy(_InputIterator, _InputIterator, _ForwardIterator) [with _InputIterator = cilk::reducer_opadd<int>*, _ForwardIterator = cilk::reducer_opadd<int>*]’ /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/stl_uninitialized.h:254: instantiated from ‘_ForwardIterator std::__uninitialized_copy_a(_InputIterator, _InputIterator, _ForwardIterator, std::allocator<_Tp>) [with _InputIterator = cilk::reducer_opadd<int>*, _ForwardIterator = cilk::reducer_opadd<int>*, _Tp = cilk::reducer_opadd<int>]’ /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/vector.tcc:275: instantiated from ‘void std::vector<_Tp, _Alloc>::_M_insert_aux(__gnu_cxx::__normal_iterator<typename std::_Vector_base<_Tp, _Alloc>::_Tp_alloc_type::pointer, std::vector<_Tp, _Alloc> >, const _Tp&) [with _Tp = cilk::reducer_opadd<int>, _Alloc = std::allocator<cilk::reducer_opadd<int> >]’ /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/stl_vector.h:605: instantiated from ‘void std::vector<_Tp, _Alloc>::push_back(const _Tp&) [with _Tp = cilk::reducer_opadd<int>, _Alloc = std::allocator<cilk::reducer_opadd<int> >]’ geneAttack.cilk:667: instantiated from here /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/cilk++/reducer_opadd.h:229: error: ‘cilk::reducer_opadd<Type>::reducer_opadd(const cilk::reducer_opadd<Type>&) [with Type = int]’ is private /usr/local/cilk/bin/../lib/gcc/x86_64-unknown-linux-gnu/4.2.4/../../../../include/c++/4.2.4/bits/stl_construct.h:81: error: within this context make: *** [geneAttack] Error 1 jinchen@galactica:~/workspace/biometrics/genAttack$ make cilk++ geneAttack.cilk -O1 -g -lcilkutil -o geneAttack geneAttack.cilk: In function ‘int cilk cilk_main(int, char**)’: geneAttack.cilk:670: error: expected primary-expression before ‘,’ token geneAttack.cilk:670: error: expected primary-expression before ‘}’ token geneAttack.cilk:674: error: ‘bitmiss_vec’ was not declared in this scope make: *** [geneAttack] Error 1 The Cilk++ manule says it supports array/vector of reducers, although there are performance issues to consider: "If you create a large number of reducers (for example, an array or vector of reducers) you must be aware that there is an overhead at steal and reduce that is proportional to the number of reducers in the program. " Anyone knows what is going on? How should I declare/use vector of reducers? Thank you

    Read the article

  • Does Ivy's url resolver support transitive retrieval?

    - by Sean
    For some reason I can't seem to resolve the dependencies of my dependencies when using a url resolver to specify a repository's location. However, when using the ibiblio resolver, I am able to retrieve them. For example: <!-- Ivy File --> <ivy-module version="1.0"> <info organisation="org.apache" module="chained-resolvers"/> <dependencies> <dependency org="commons-lang" name="commons-lang" rev="2.0" conf="default"/> <dependency org="checkstyle" name="checkstyle" rev="5.0"/> </dependencies> </ivy-module> <!-- ivysettings file --> <ivysettings> <settings defaultResolver="chained"/> <resolvers> <chain name="chained"> <url name="custom-repo"> <ivy pattern="http://my.internal.domain.name/ivy/[organisation]/[module]/[revision]/ivy-[revision].xml"/> <artifact pattern="http://my.internal.domain.name/ivy/[organisation]/[module]/[revision]/[artifact]-[revision].[ext]"/> </url> <url name="ibiblio-mirror" m2compatible="true"> <artifact pattern="http://mirrors.ibiblio.org/pub/mirrors/maven2/[organisation]/[module]/[revision]/[artifact]-[revision].[ext]" /> </url> <ibiblio name="ibiblio" m2compatible="true"/> </chain> </resolvers> </ivysettings> <!-- checkstyle ivy.xml file generated from pom via ivy:install task --> <?xml version="1.0" encoding="UTF-8"?> <ivy-module version="1.0" xmlns:m="http://ant.apache.org/ivy/maven"> <info organisation="checkstyle" module="checkstyle" revision="5.0" status="release" publication="20090509202448" namespace="maven2" > <license name="GNU Lesser General Public License" url="http://www.gnu.org/licenses/lgpl.txt" /> <description homepage="http://checkstyle.sourceforge.net/"> Checkstyle is a development tool to help programmers write Java code that adheres to a coding standard </description> </info> <configurations> <conf name="default" visibility="public" description="runtime dependencies and master artifact can be used with this conf" extends="runtime,master"/> <conf name="master" visibility="public" description="contains only the artifact published by this module itself, with no transitive dependencies"/> <conf name="compile" visibility="public" description="this is the default scope, used if none is specified. Compile dependencies are available in all classpaths."/> <conf name="provided" visibility="public" description="this is much like compile, but indicates you expect the JDK or a container to provide it. It is only available on the compilation classpath, and is not transitive."/> <conf name="runtime" visibility="public" description="this scope indicates that the dependency is not required for compilation, but is for execution. It is in the runtime and test classpaths, but not the compile classpath." extends="compile"/> <conf name="test" visibility="private" description="this scope indicates that the dependency is not required for normal use of the application, and is only available for the test compilation and execution phases." extends="runtime"/> <conf name="system" visibility="public" description="this scope is similar to provided except that you have to provide the JAR which contains it explicitly. The artifact is always available and is not looked up in a repository."/> <conf name="sources" visibility="public" description="this configuration contains the source artifact of this module, if any."/> <conf name="javadoc" visibility="public" description="this configuration contains the javadoc artifact of this module, if any."/> <conf name="optional" visibility="public" description="contains all optional dependencies"/> </configurations> <publications> <artifact name="checkstyle" type="jar" ext="jar" conf="master"/> </publications> <dependencies> <dependency org="antlr" name="antlr" rev="2.7.6" force="true" conf="compile->compile(*),master(*);runtime->runtime(*)"/> <dependency org="apache" name="commons-beanutils-core" rev="1.7.0" force="true" conf="compile->compile(*),master(*);runtime->runtime(*)"/> <dependency org="apache" name="commons-cli" rev="1.0" force="true" conf="compile->compile(*),master(*);runtime->runtime(*)"/> <dependency org="apache" name="commons-logging" rev="1.0.3" force="true" conf="compile->compile(*),master(*);runtime->runtime(*)"/> <dependency org="com.google.collections" name="google-collections" rev="0.9" force="true" conf="compile->compile(*),master(*);runtime->runtime(*)"/> </dependencies> </ivy-module> Using the "ibiblio" resolver I have no problem resolving my project's two dependencies (commons-lang 2.0 and checkstyle 5.0) and checkstyle's dependencies. However, when attempting to exclusively use the "custom-repo" or "ibiblio-mirror" resolvers, I am able to resolve my project's two explicitly defined dependencies, but not checkstyle's dependencies. Is this possible? Any help would be greatly appreciated.

    Read the article

  • Dynamic scoping in Clojure?

    - by j-g-faustus
    Hi, I'm looking for an idiomatic way to get dynamically scoped variables in Clojure (or a similar effect) for use in templates and such. Here is an example problem using a lookup table to translate tag attributes from some non-HTML format to HTML, where the table needs access to a set of variables supplied from elsewhere: (def *attr-table* ; Key: [attr-key tag-name] or [boolean-function] ; Value: [attr-key attr-value] (empty array to ignore) ; Context: Variables "tagname", "akey", "aval" '( ; translate :LINK attribute in <a> to :href [:LINK "a"] [:href aval] ; translate :LINK attribute in <img> to :src [:LINK "img"] [:src aval] ; throw exception if :LINK attribute in any other tag [:LINK] (throw (RuntimeException. (str "No match for " tagname))) ; ... more rules ; ignore string keys, used for internal bookkeeping [(string? akey)] [] )) ; ignore I want to be able to evaluate the rules (left hand side) as well as the result (right hand side), and need some way to put the variables in scope at the location where the table is evaluated. I also want to keep the lookup and evaluation logic independent of any particular table or set of variables. I suppose there are similar issues involved in templates (for example for dynamic HTML), where you don't want to rewrite the template processing logic every time someone puts a new variable in a template. Here is one approach using global variables and bindings. I have included some logic for the table lookup: ;; Generic code, works with any table on the same format. (defn rule-match? [rule-val test-val] "true if a single rule matches a single argument value" (cond (not (coll? rule-val)) (= rule-val test-val) ; plain value (list? rule-val) (eval rule-val) ; function call :else false )) (defn rule-lookup [test-val rule-table] "looks up rule match for test-val. Returns result or nil." (loop [rules (partition 2 rule-table)] (when-not (empty? rules) (let [[select result] (first rules)] (if (every? #(boolean %) (map rule-match? select test-val)) (eval result) ; evaluate and return result (recur (rest rules)) ))))) ;; Code specific to *attr-table* (def tagname) ; need these globals for the binding in html-attr (def akey) (def aval) (defn html-attr [tagname h-attr] "converts to html attributes" (apply hash-map (flatten (map (fn [[k v :as kv]] (binding [tagname tagname akey k aval v] (or (rule-lookup [k tagname] *attr-table*) kv))) h-attr )))) (defn test-attr [] "test conversion" (prn "a" (html-attr "a" {:LINK "www.google.com" "internal" 42 :title "A link" })) (prn "img" (html-attr "img" {:LINK "logo.png" }))) user=> (test-attr) "a" {:href "www.google.com", :title "A link"} "img" {:src "logo.png"} This is nice in that the lookup logic is independent of the table, so it can be reused with other tables and different variables. (Plus of course that the general table approach is about a quarter of the size of the code I had when I did the translations "by hand" in a giant cond.) It is not so nice in that I need to declare every variable as a global for the binding to work. Here is another approach using a "semi-macro", a function with a syntax-quoted return value, that doesn't need globals: (defn attr-table [tagname akey aval] `( [:LINK "a"] [:href ~aval] [:LINK "img"] [:src ~aval] [:LINK] (throw (RuntimeException. (str "No match for " tagname))) ; ... more rules [(string? ~akey)] [] ))) Only a couple of changes are needed to the rest of the code: In rule-match?, when syntax-quoted the function call is no longer a list: - (list? rule-val) (eval rule-val) + (seq? rule-val) (eval rule-val) In html-attr: - (binding [tagname tagname akey k aval v] - (or (rule-lookup [k tagname] *attr-table*) kv))) + (or (rule-lookup [k tagname] (attr-table tagname k v)) kv))) And we get the same result without globals. (And without dynamic scoping.) Are there other alternatives to pass along sets of variable bindings declared elsewhere, without the globals required by Clojure's binding? Is there an idiomatic way of doing it, like Ruby's binding or Javascript's function.apply(context)?

    Read the article

  • How do I prove I should put a table of values in source code instead of a database table?

    - by FastAl
    <tldr>looking for a reference to a book or other undeniably authoritative source that gives reasons when you should choose a database vs. when you should choose other storage methods. I have provided an un-authoritative list of reasons about 2/3 of the way down this post.</tldr> I have a situation at my company where a database is being used where it would be better to use another solution (in this case, an auto-generated piece of source code that contains a static lookup table, searched by binary sort). Normally, a database would be an OK solution even though the problem does not require a database, e.g, none of the elements of ACID are needed, as it is read-only data, updated about every 3-5 years (also requiring other sourcecode changes), and fits in memory, and can be keyed into via binary search (a tad faster than db, but speed is not an issue). The problem is that this code runs on our enterprise server, but is shared with several PC platforms (some disconnected, some use a central DB, etc.), and parts of it are managed by multiple programming units, parts by the DBAs, parts even by mathematicians in another department, etc. These hit their own platform’s version of their databases (containing their own copy of the static data). What happens is that every implementation, every little change, something different goes wrong. There are many other issues as well. I can’t even use a flatfile, because one mode of running on our enterprise server does not have permission to read files (only databases, and of course, its own literal storage, e.g., in-source table). Of course, other parts of the system use databases in proper, less obscure manners; there is no problem with those parts. So why don’t we just change it? I don’t have administrative ability to force a change. But I’m affected because sometimes I have to help fix the problems, but mostly because it causes outages and tons of extra IT time by other programmers and d*mmit that makes me mad! The reason neither management, nor the designers of the system, can see the problem is that they propose a solution that won’t work: increase communication; implement more safeguards and standards; etc. But every time, in a different part of the already-pared-down but still multi-step processes, a few different diligent, hard-working, top performing IT personnel make a unique subtle error that causes it to fail, sometimes after the last round of testing! And in general these are not single-person failures, but understandable miscommunications. And communication at our company is actually better than most. People just don't think that's the case because they haven't dug into the matter. However, I have it on very good word from somebody with extensive formal study of sociology and psychology that the relatively small amount of less-than-proper database usage in this gigantic cross-platform multi-source, multi-language project is bureaucratically un-maintainable. Impossible. No chance. At least with Human Beings in the loop, and it can’t be automated. In addition, the management and developers who could change this, though intelligent and capable, don’t understand the rigidity of this ‘how humans are’ issue, and are not convincible on the matter. The reason putting the static data in sourcecode will solve the problem is, although the solution is less sexy than a database, it would function with no technical drawbacks; and since the sharing of sourcecode already works very well, you basically erase any database-related effort from this section of the project, along with all the drawbacks of it that are causing problems. OK, that’s the background, for the curious. I won’t be able to convince management that this is an unfixable sociological problem, and that the real solution is coding around these limits of human nature, just as you would code around a bug in a 3rd party component that you can’t change. So what I have to do is exploit the unsuitableness of the database solution, and not do it using logic, but rather authority. I am aware of many reasons, and posts on this site giving reasons for one over the other; I’m not looking for lists of reasons like these (although you can add a comment if I've miss a doozy): WHY USE A DATABASE? instead of flatfile/other DB vs. file: if you need... Random Read / Transparent search optimization Advanced / varied / customizable Searching and sorting capabilities Transaction/rollback Locks, semaphores Concurrency control / Shared users Security 1-many/m-m is easier Easy modification Scalability Load Balancing Random updates / inserts / deletes Advanced query Administrative control of design, etc. SQL / learning curve Debugging / Logging Centralized / Live Backup capabilities Cached queries / dvlp & cache execution plans Interleaved update/read Referential integrity, avoid redundant/missing/corrupt/out-of-sync data Reporting (from on olap or oltp db) / turnkey generation tools [Disadvantages:] Important to get right the first time - professional design - but only b/c it's meant to last s/w & h/w cost Usu. over a network, speed issue (best vs. best design vs. local=even then a separate process req's marshalling/netwk layers/inter-p comm) indicies and query processing can stand in the way of simple processing (vs. flatfile) WHY USE FLATFILE: If you only need... Sequential Row processing only Limited usage append only (no reading, no master key/update) Only Update the record you're reading (fixed length recs only) Too big to fit into memory If Local disk / read-ahead network connection Portability / small system Email / cut & Paste / store as document by novice - simple format Low design learning curve but high cost later WHY USE IN-MEMORY/TABLE (tables, arrays, etc.): if you need... Processing a single db/ff record that was imported Known size of data Static data if hardcoding the table Narrow, unchanging use (e.g., one program or proc) -includes a class that will be shared, but encapsulates its data manipulation Extreme speed needed / high transaction frequency Random access - but search is dependent on implementation Following are some other posts about the topic: http://stackoverflow.com/questions/1499239/database-vs-flat-text-file-what-are-some-technical-reasons-for-choosing-one-over http://stackoverflow.com/questions/332825/are-flat-file-databases-any-good http://stackoverflow.com/questions/2356851/database-vs-flat-files http://stackoverflow.com/questions/514455/databases-vs-plain-text/514530 What I’d like to know is if anybody could recommend a hard, authoritative source containing these reasons. I’m looking for a paper book I can buy, or a reputable website with whitepapers about the issue (e.g., Microsoft, IBM), not counting the user-generated content on those sites. This will have a greater change to elicit a change that I’m looking for: less wasted programmer time, and more reliable programs. Thanks very much for your help. You win a prize for reading such a large post!

    Read the article

  • Html shows after submitting form and is nowhere to be found in php script.

    - by Kelbizzle
    Upon submitting this form on my site. It send me to a page that says. "Use Back - fill in all fields Use back! ! " But this html isn't in the mail script anywhere. Where could this be coming from? I started out using this contact form (http://www.ibdhost.com/contact/) then changed it a little. Here is the mail script. <?php session_start(); ?> <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <title>Sendemail Script</title> </head> <body> <!-- Reminder: Add the link for the 'next page' (at the bottom) --> <!-- Reminder: Change 'YourEmail' to Your real email --> <?php //the 3 variables below were changed to use the SERVER variable $ip = $_SERVER['REMOTE_ADDR']; $httpref = $_SERVER['HTTP_REFERER']; $httpagent = $_SERVER['HTTP_USER_AGENT']; $visitorf = $_POST['visitorf']; $visitorl = $_POST['visitorl']; $visitormail = $_POST['visitormail']; $visitorphone = $_POST['visitorphone']; //$notes = $_POST['notes']; //$attn = $_POST['attn']; $lookup = array( 'The Election Report' => 'http://www.mydowmain.net/', '5 Resons' => 'http://www.mydomain.net/', 'Report 3' => 'http://someotherurl3.com/', 'Report 4' => 'http://someotherurl4.com/', 'Report 5' => 'http://someotherurl5.com/', // et cetera for your other values ); $attn = trim($_POST['attn']); $url = $lookup[$attn]; //echo 'attn: ' . $attn . ', url:' . $url; die; //additional headers $headers = 'From: US <[email protected]>' . "\r\n"; //$headers .= 'BCC: [email protected]' . "\r\n"; $todayis = date("l, F j, Y, g:i a") ; $subject = "your lead has downloaded a report."; $subjectdp = "Someone has downloaded a report!"; $notes = stripcslashes($notes); $message = "Dear PAl Affiliate,\n\nA prospective lead of yours has downloaded a report from our Website.\nAny contact information they have left and a link to the report they downloaded\ncan be found below. This is the perfect opportunity for you to open up a line of\ncommunication with the prospect and find out their intrests! If you have any questions\nabout this email please feel free to email us at [email protected]\n\n\nFrom: $visitorf $visitorl ($visitormail)\nTelephone Number: $visitorphone \nReport Downloaded:$url\n \n\nBest regards,\nThe Crew"; //$message = "$todayis [EST] \nAttention: \nMessage: $notes \nFrom: $visitorf $visitorl ($visitormail) \nTelephone Number: //$visitorphone \nReport Downloaded:$url\nAdditional Info : IP = $ip \nBrowser Info: $httpagent \nReferral : $httpref\n"; $messagedp = "A Visitor has just downloaded a report. You can find their contact information below.\n \n ***********************************************************************\n From: $visitorf $visitorl\n Email: $visitormail\n Telephone Number: $visitorphone \n Report Downloaded:$url\n \n \n Best regards,\n The Crew\n"; $messagelead = "Dear, $visitorf\n \n \n We appreciate your interest. Below you will find the URL to download the report you requested.\n Things are always changing in costa rica , so check back often. Also, check us out on Facebook & Twitter \n for daily updates. If there is anything we can do at anytime to enhance your experience, please do\n not hesitate to contact us.\n \n To download your report simply click on the link below. (You must have Adobe Reader or an alternative PDF reader installed)\n \n *** Download Link ***\n $url\n"; //check if the function even exists if(function_exists("mail")) { //send the email mail($_SESSION['email'], $subject, $message, $headers) or die("could not send email"); } else { die("mail fucntion not enabled"); } //send the email to us mail('[email protected]', $subjectdp, $messagedp); //send the email to the lead mail($visitormail, 'Thanks for downloading the report!', $messagelead, $headers); header( "Location: http://www.mydomain.com/thanks_report.php" ); ?> </body> </html>

    Read the article

  • Access Violation

    - by Justin
    I've been learning how to NOP functions in C++ or even C but there are very few tutorials online about it. I've been googling for the past few hours now and I'm just stuck. Here is my code. #include <iostream> #include <windows.h> #include <tlhelp32.h> using namespace std; //#define NOP 0x90 byte NOP[] = {0x90}; void enableDebugPrivileges() { HANDLE hcurrent=GetCurrentProcess(); HANDLE hToken; BOOL bret=OpenProcessToken(hcurrent,40,&hToken); LUID luid; bret=LookupPrivilegeValue(NULL,"SeDebugPrivilege",&luid); TOKEN_PRIVILEGES NewState,PreviousState; DWORD ReturnLength; NewState.PrivilegeCount =1; NewState.Privileges[0].Luid =luid; NewState.Privileges[0].Attributes=2; AdjustTokenPrivileges(hToken,FALSE,&NewState,28,&PreviousState,&ReturnLength); } DWORD GetProcId(char* ProcName) { PROCESSENTRY32 pe32; HANDLE hSnapshot = NULL; pe32.dwSize = sizeof( PROCESSENTRY32 ); hSnapshot = CreateToolhelp32Snapshot( TH32CS_SNAPPROCESS, 0 ); if( Process32First( hSnapshot, &pe32 ) ) { do{ if( strcmp( pe32.szExeFile, ProcName ) == 0 ) break; }while( Process32Next( hSnapshot, &pe32 ) ); } if( hSnapshot != INVALID_HANDLE_VALUE ) CloseHandle( hSnapshot ); return pe32.th32ProcessID; } void WriteMem(DWORD Address, void* Value, size_t Size) { DWORD Protect = NULL; VirtualProtect((LPVOID)Address, 3, PAGE_READWRITE, &Protect); memcpy((void*)Address, Value, 3); VirtualProtect((LPVOID)Address, 3, Protect, &Protect); } void nop_(PVOID address, int bytes){ DWORD d, ds; VirtualProtect(address, bytes, PAGE_EXECUTE_READWRITE, &d); memset(address, 144, bytes); VirtualProtect(address,bytes,d,&ds); } void MemCopy(HANDLE pHandle, void* Dest, const void* Src, int Len) { DWORD OldProtect; DWORD OldProtect2; VirtualProtect(Dest, Len, PAGE_EXECUTE_READWRITE, &OldProtect); memcpy(Dest, Src, Len); VirtualProtect(Dest, Len, OldProtect, &OldProtect2); FlushInstructionCache(pHandle, Dest, Len); } int main() { enableDebugPrivileges(); DWORD pid; HANDLE phandle; // Obtain the process ID pid = GetProcId("gr.exe"); if(GetLastError()) { cout << "Error_PID_: " << GetLastError() << endl; system("pause"); return -1; } // Obtain the process handle phandle = OpenProcess(PROCESS_ALL_ACCESS,0,pid); if(GetLastError()) { cout << "Error_HANDLE_: " << GetLastError() << endl; system("pause"); return -1; } // Debug info, 0 = bad cout <<"pid : " << pid << endl; cout <<"HANDLE: " << phandle << endl << endl; system("pause"); // Change value to short iValue = -1; int choice = 0; BYTE * bGodMode = (BYTE *) (0x409A7E); // Lives Address bool hack = true; while(hack) { system("cls"); cout << "What hack?\n0. Exit\n1. Lives\n\n!> "; cin >> choice; switch(choice) { case 0: { hack=false; break; } case 1: // Modify Time cout << "God Mode On\n!> "; // cin >> iValue; // nop_((PVOID)(0x409A7E), 3); // MemCopy(phandle, (PVOID)0x409A7E, &NOP, 1); WriteMem((DWORD)(0x00409A7E), (void*)NOP, sizeof NOP); if(GetLastError()) { cout << "Error: " << GetLastError() << endl; system("pause"); } break; default: cout << "ERROR!\n"; break; } Sleep(100); } system("pause"); return 0; } This is suppose to NOP the DEC function that is 3 bytes long preventing me from losing lives. However each time I try it, it crashes the hack and says I had a access violation. I tried to look up the reasons and most of them dealt with with the size of the location I'm writing to and what I'm copying from. Otherwise, I have absolutely no idea. Any help would be nice. The game is GunRoar and the base address "0x409A7E" is where the DEC function is.

    Read the article

  • C++ 2d Array Class Function Call Help

    - by johnny-conrad
    I hope this question takes a simple fix, and I am just missing something very small. I am in my second semester of C++ in college, and we are just getting into OOP. This is my first OOP program, and it is causing me a little problem. Here are the errors I am getting: Member function must be called or its address taken in function displayGrid(int,Cell ( *)[20]) Member function must be called or its address taken in function Turn(int,int,Cell ( *)[20]) Member function must be called or its address taken in function Turn(int,int,Cell ( *)[20]) Warning: Parameter 'grid' is never used in function displayGrid(int,Cell ( *)[20]) Here is all of my code. I am aware It is much more code than necessary, sorry if it makes it more difficult. I was worried that I might accidentally delete something. const int MAX=20; //Struct Cell holds player and their symbol. class Cell { private: int Player; char Symbol; public: Cell(void); void setPlayer(int); void setSymbol(char); int getPlayer(void); char getSymbol(void); }; Cell::Cell(void) { Symbol ='-'; } void Cell::setPlayer(int player_num) { Player = player_num; } void Cell::setSymbol(char rps) { Symbol = rps; } int Cell::getPlayer(void) { return Player; } char Cell::getSymbol(void) { return Symbol; } void Turn(int, int, Cell[MAX][MAX]); void displayGrid(int, Cell[MAX][MAX]); void main(void) { int size; cout << "How big would you like the grid to be: "; cin >> size; //Checks to see valid grid size while(size>MAX || size<3) { cout << "Grid size must between 20 and 3." << endl; cout << "Please re-enter the grid size: "; cin >> size; } int cnt=1; int full; Cell grid[MAX][MAX]; //I use full to detect when the game is over by squaring size. full = size*size; cout << "Starting a new game." << endl; //Exits loop when cnt reaches full. while(cnt<full+1) { displayGrid(size, grid); //calls function to display grid if(cnt%2==0) //if cnt is even then it's 2nd players turn cout << "Player 2's turn." << endl; else cout << "Player 1's turn" << endl; Turn(size, cnt, grid); //calls Turn do each players turn cnt++; } cout << endl; cout << "Board is full... Game Over" << endl; } void displayGrid(int size, Cell grid[MAX][MAX]) { cout << endl; cout << " "; for(int x=1; x<size+1; x++) // prints first row cout << setw(3) << x; // of numbers. cout << endl; //Nested-For prints the grid. for(int i=1; i<size+1; i++) { cout << setw(2) << i; for(int c=1; c<size+1; c++) { cout << setw(3) << grid[i][c].getSymbol; } cout << endl; } cout << endl; } void Turn(int size, int cnt, Cell grid[MAX][MAX]) { char temp; char choice; int row=0; int column=0; cout << "Enter the Row: "; cin >> row; cout << "Enter the Column: "; cin >> column; //puts what is in the current cell in "temp" temp = grid[row][column].getSymbol; //Checks to see if temp is occupied or not while(temp!='-') { cout << "Cell space is Occupied..." << endl; cout << "Enter the Row: "; cin >> row; cout << "Enter the Column: "; cin >> column; temp = grid[row][column].getSymbol; //exits loop when finally correct } if(cnt%2==0) //if cnt is even then its player 2's turn { cout << "Enter your Symbol R, P, or S (Capitals): "; cin >> choice; grid[row][column].setPlayer(1); in >> choice; } //officially sets choice to grid cell grid[row][column].setSymbol(choice); } else //if cnt is odd then its player 1's turn { cout << "Enter your Symbol r, p, or s (Lower-Case): "; cin >> choice; grid[row][column].setPlayer(2); //checks for valid input by user1 while(choice!= 'r' && choice!='p' && choice!='s') { cout << "Invalid Symbol... Please Re-Enter: "; cin >> choice; } //officially sets choice to grid cell. grid[row][column].setSymbol(choice); } cout << endl; } Thanks alot for your help!

    Read the article

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

  • What's wrong with Bundler working with RubyGems to push a Git repo to Heroku?

    - by stanigator
    I've made sure that all the files are in the root of the repository as recommended in this discussion. However, as I follow the instructions in this section of the book, I can't get through the section without the problems. What do you think is happening with my system that's causing the error? I have no clue at the moment of what the problem means despite reading the following in the log. Thanks in advance for your help! stanley@ubuntu:~/rails_sample/first_app$ git push heroku master Warning: Permanently added the RSA host key for IP address '50.19.85.156' to the list of known hosts. Counting objects: 96, done. Compressing objects: 100% (79/79), done. Writing objects: 100% (96/96), 28.81 KiB, done. Total 96 (delta 22), reused 0 (delta 0) -----> Heroku receiving push -----> Ruby/Rails app detected -----> Installing dependencies using Bundler version 1.2.0.pre Running: bundle install --without development:test --path vendor/bundle --binstubs bin/ --deployment Fetching gem metadata from https://rubygems.org/....... Installing rake (0.9.2.2) Installing i18n (0.6.0) Installing multi_json (1.3.5) Installing activesupport (3.2.3) Installing builder (3.0.0) Installing activemodel (3.2.3) Installing erubis (2.7.0) Installing journey (1.0.3) Installing rack (1.4.1) Installing rack-cache (1.2) Installing rack-test (0.6.1) Installing hike (1.2.1) Installing tilt (1.3.3) Installing sprockets (2.1.3) Installing actionpack (3.2.3) Installing mime-types (1.18) Installing polyglot (0.3.3) Installing treetop (1.4.10) Installing mail (2.4.4) Installing actionmailer (3.2.3) Installing arel (3.0.2) Installing tzinfo (0.3.33) Installing activerecord (3.2.3) Installing activeresource (3.2.3) Installing coffee-script-source (1.3.3) Installing execjs (1.3.2) Installing coffee-script (2.2.0) Installing rack-ssl (1.3.2) Installing json (1.7.3) with native extensions Installing rdoc (3.12) Installing thor (0.14.6) Installing railties (3.2.3) Installing coffee-rails (3.2.2) Installing jquery-rails (2.0.2) Using bundler (1.2.0.pre) Installing rails (3.2.3) Installing sass (3.1.18) Installing sass-rails (3.2.5) Installing sqlite3 (1.3.6) with native extensions Gem::Installer::ExtensionBuildError: ERROR: Failed to build gem native extension. /usr/local/bin/ruby extconf.rb checking for sqlite3.h... no sqlite3.h is missing. Try 'port install sqlite3 +universal' or 'yum install sqlite-devel' and check your shared library search path (the location where your sqlite3 shared library is located). *** extconf.rb failed *** Could not create Makefile due to some reason, probably lack of necessary libraries and/or headers. Check the mkmf.log file for more details. You may need configuration options. Provided configuration options: --with-opt-dir --without-opt-dir --with-opt-include --without-opt-include=${opt-dir}/include --with-opt-lib --without-opt-lib=${opt-dir}/lib --with-make-prog --without-make-prog --srcdir=. --curdir --ruby=/usr/local/bin/ruby --with-sqlite3-dir --without-sqlite3-dir --with-sqlite3-include --without-sqlite3-include=${sqlite3-dir}/include --with-sqlite3-lib --without-sqlite3-lib=${sqlite3-dir}/lib --enable-local --disable-local Gem files will remain installed in /tmp/build_3tplrxvj7qa81/vendor/bundle/ruby/1.9.1/gems/sqlite3-1.3.6 for inspection. Results logged to /tmp/build_3tplrxvj7qa81/vendor/bundle/ruby/1.9.1/gems/sqlite3-1.3.6/ext/sqlite3/gem_make.out An error occurred while installing sqlite3 (1.3.6), and Bundler cannot continue. Make sure that `gem install sqlite3 -v '1.3.6'` succeeds before bundling. ! ! Failed to install gems via Bundler. ! ! Heroku push rejected, failed to compile Ruby/rails app To [email protected]:growing-mountain-2788.git ! [remote rejected] master -> master (pre-receive hook declined) error: failed to push some refs to '[email protected]:growing-mountain-2788.git' ------Gemfile------------------------ As requested, here's the auto-generated gemfile: source 'https://rubygems.org' gem 'rails', '3.2.3' # Bundle edge Rails instead: # gem 'rails', :git => 'git://github.com/rails/rails.git' gem 'sqlite3' gem 'json' # Gems used only for assets and not required # in production environments by default. group :assets do gem 'sass-rails', '~> 3.2.3' gem 'coffee-rails', '~> 3.2.1' # See https://github.com/sstephenson/execjs#readme for more supported runtimes # gem 'therubyracer', :platform => :ruby gem 'uglifier', '>= 1.0.3' end gem 'jquery-rails' # To use ActiveModel has_secure_password # gem 'bcrypt-ruby', '~> 3.0.0' # To use Jbuilder templates for JSON # gem 'jbuilder' # Use unicorn as the app server # gem 'unicorn' # Deploy with Capistrano # gem 'capistrano' # To use debugger # gem 'ruby-debug'

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • changing output in objective-c app

    - by Zack
    // // RC4.m // Play5 // // Created by svp on 24.05.10. // Copyright 2010 __MyCompanyName__. All rights reserved. // #import "RC4.h" @implementation RC4 @synthesize txtLyrics; @synthesize sbox; @synthesize mykey; - (IBAction) clicked: (id) sender { NSData *asciidata1 = [@"4875" dataUsingEncoding:NSASCIIStringEncoding allowLossyConversion:YES]; NSString *asciistr1 = [[NSString alloc] initWithData:asciidata1 encoding:NSASCIIStringEncoding]; //[txtLyrics setText:@"go"]; NSData *asciidata = [@"sdf883jsdf22" dataUsingEncoding:NSASCIIStringEncoding allowLossyConversion:YES]; NSString *asciistr = [[NSString alloc] initWithData:asciidata encoding:NSASCIIStringEncoding]; //RC4 * x = [RC4 alloc]; [txtLyrics setText:[self decrypt:asciistr1 andKey:asciistr]]; } - (NSMutableArray*) hexToChars: (NSString*) hex { NSMutableArray * arr = [[NSMutableArray alloc] init]; NSRange range; range.length = 2; for (int i = 0; i < [hex length]; i = i + 2) { range.location = 0; NSString * str = [[hex substringWithRange:range] uppercaseString]; unsigned int value; [[NSScanner scannerWithString:str] scanHexInt:&value]; [arr addObject:[[NSNumber alloc] initWithInt:(int)value]]; } return arr; } - (NSString*) charsToStr: (NSMutableArray*) chars { NSString * str = @""; for (int i = 0; i < [chars count]; i++) { str = [NSString stringWithFormat:@"%@%@",[NSString stringWithFormat:@"%c", [chars objectAtIndex:i]],str]; } return str; } //perfect except memory leaks - (NSMutableArray*) strToChars: (NSString*) str { NSData *asciidata = [str dataUsingEncoding:NSASCIIStringEncoding allowLossyConversion:YES]; NSString *asciistr = [[NSString alloc] initWithData:asciidata encoding:NSASCIIStringEncoding]; NSMutableArray * arr = [[NSMutableArray alloc] init]; for (int i = 0; i < [str length]; i++) { [arr addObject:[[NSNumber alloc] initWithInt:(int)[asciistr characterAtIndex:i]]]; } return arr; } - (void) initialize: (NSMutableArray*) pwd { sbox = [[NSMutableArray alloc] init]; mykey = [[NSMutableArray alloc] init]; int a = 0; int b; int c = [pwd count]; int d = 0; while (d < 256) { [mykey addObject:[pwd objectAtIndex:(d % c)]]; [sbox addObject:[[NSNumber alloc] initWithInt:d]]; d++; } d = 0; while (d < 256) { a = (a + [[sbox objectAtIndex:d] intValue] + [[mykey objectAtIndex:d] intValue]) % 256; b = [[sbox objectAtIndex:d] intValue]; [sbox replaceObjectAtIndex:d withObject:[sbox objectAtIndex:a]]; [sbox replaceObjectAtIndex:a withObject:[[NSNumber alloc] initWithInt:b]]; d++; } } - (NSMutableArray*) calculate: (NSMutableArray*) plaintxt andPsw: (NSMutableArray*) psw { [self initialize:psw]; int a = 0; int b = 0; NSMutableArray * c = [[NSMutableArray alloc] init]; int d; int e; int f; int g = 0; while (g < [plaintxt count]) { a = (a + 1) % 256; b = (b + [[sbox objectAtIndex:a] intValue]) % 256; e = [[sbox objectAtIndex:a] intValue]; [sbox replaceObjectAtIndex:a withObject:[sbox objectAtIndex:b]]; [sbox replaceObjectAtIndex:b withObject:[[NSNumber alloc] initWithInt:e]]; int h = ([[sbox objectAtIndex:a]intValue] + [[sbox objectAtIndex:b]intValue]) % 256; d = [[sbox objectAtIndex:h] intValue]; f = [[plaintxt objectAtIndex:g] intValue] ^ d; [c addObject:[[NSNumber alloc] initWithInt:f]]; g++; } return c; } - (NSString*) decrypt: (NSString*) src andKey: (NSString*) key { NSMutableArray * plaintxt = [self hexToChars:src]; NSMutableArray * psw = [self strToChars:key]; NSMutableArray * chars = [self calculate:plaintxt andPsw:psw]; NSData *asciidata = [[self charsToStr:chars] dataUsingEncoding:NSASCIIStringEncoding allowLossyConversion:YES]; NSString *asciistr = [[NSString alloc] initWithData:asciidata encoding:NSUTF8StringEncoding]; return asciistr; } @end This is supposed to decrypt a hex string with an ascii string, using rc4 decryption. I'm converting my java application to objective-c. The output keeps changing, every time i run it.

    Read the article

  • Android: who can help me with setting up this google maps class please??

    - by Capsud
    Hi, Firstly this has turned out to be quite a long post so please bear with me as its not too difficult but you may need to clarify something with me if i haven't explained it correctly. So with some help the other day from guys on this forum, i managed to partially set up my 'mapClass' class, but i'm having trouble with it and its not running correctly so i would like some help if possible. I will post the code below so you can see. What Ive got is a 'Dundrum' class which sets up the listView for an array of items. Then ive got a 'dundrumSelector' class which I use to set up the setOnClickListener() methods on the listItems and link them to their correct views. DundrumSelector class.. public static final int BUTTON1 = R.id.anandaAddressButton; public static final int BUTTON2 = R.id.bramblesCafeAddressButton; public static final int BUTTON3 = R.id.brannigansAddressButton; public void onCreate(Bundle savedInstanceState){ super.onCreate(savedInstanceState); int position = getIntent().getExtras().getInt("position"); if(position == 0){ setContentView(R.layout.ananda); }; if(position == 1){ setContentView(R.layout.bramblescafe); }; if(position == 2){ setContentView(R.layout.brannigans); Button anandabutton = (Button) findViewById(R.id.anandaAddressButton); anandabutton.setOnClickListener(new View.OnClickListener() { public void onClick(View view) { Intent myIntent = new Intent(view.getContext(),MapClass.class); myIntent.putExtra("button", BUTTON1); startActivityForResult(myIntent,0); } }); Button bramblesbutton = (Button) findViewById(R.id.bramblesCafeAddressButton); bramblesbutton.setOnClickListener(new View.OnClickListener() { public void onClick(View view) { Intent myIntent = new Intent(view.getContext(),MapClass.class); myIntent.putExtra("button", BUTTON2); startActivityForResult(myIntent, 0); } }); etc etc.... Then what i did was set up static ints to represent the buttons which you can see at the top of this class, the reason for this is because in my mapClass activity I just want to have one method, because the only thing that is varying is the coordinates to each location. ie. i dont want to have 100+ map classes essentially doing the same thing other than different coordinates into the method. So my map class is as follows... case DundrumSelector.BUTTON1: handleCoordinates("53.288719","-6.241179"); break; case DundrumSelector.BUTTON2: handleCoordinates("53.288719","-6.241179"); break; case DundrumSelector.BUTTON3: handleCoordinates("53.288719","-6.241179"); break; } } private void handleCoordinates(String l, String b){ mapView = (MapView) findViewById(R.id.mapView); LinearLayout zoomLayout = (LinearLayout)findViewById(R.id.zoom); View zoomView = mapView.getZoomControls(); zoomLayout.addView(zoomView, new LinearLayout.LayoutParams( LayoutParams.WRAP_CONTENT, LayoutParams.WRAP_CONTENT)); mapView.displayZoomControls(true); mc = mapView.getController(); String coordinates[] = {l, b}; double lat = Double.parseDouble(coordinates[0]); double lng = Double.parseDouble(coordinates[1]); p = new GeoPoint( (int) (lat*1E6), (int) (lng*1E6)); mc.animateTo(p); mc.setZoom(17); mapView.invalidate(); } Now this is where my problem is. The onClick() events don't even work from the listView to get into the correct views. I have to comment out the methods in 'DundrumSelector' before I can get into their views. And this is what I dont understand, firstly why wont the onClick() events work, because its not even on that next view where the map is. I know this is a very long post and it might be quite confusing so let me know if you want any clarification.. Just to recap, what i'm trying to do is just have one class that sets up the map coordinates, like what i'm trying to do in my 'mapClass'. Please can someone help or suggest another way of doing this! Thanks alot everyone for reading this.

    Read the article

  • Rails validation count limit on has_many :through

    - by Jeremy
    I've got the following models: Team, Member, Assignment, Role The Team model has_many Members. Each Member has_many roles through assignments. Role assignments are Captain and Runner. I have also installed devise and CanCan using the Member model. What I need to do is limit each Team to have a max of 1 captain and 5 runners. I found this example, and it seemed to work after some customization, but on update ('teams/1/members/4/edit'). It doesn't work on create ('teams/1/members/new'). But my other validation (validates :role_ids, :presence = true ) does work on both update and create. Any help would be appreciated. Update: I've found this example that would seem to be similar to my problem but I can't seem to make it work for my app. It seems that the root of the problem lies with how the count (or size) is performed before and during validation. For Example: When updating a record... It checks to see how many runners there are on a team and returns a count. (i.e. 5) Then when I select a role(s) to add to the member it takes the known count from the database (i.e. 5) and adds the proposed changes (i.e. 1), and then runs the validation check. (Team.find(self.team_id).members.runner.count 5) This works fine because it returns a value of 6 and 6 5 so the proposed update fails without saving and an error is given. But when I try to create a new member on the team... It checks to see how many runners there are on a team and returns a count. (i.e. 5) Then when I select a role(s) to add to the member it takes the known count from the database (i.e. 5) and then runs the validation check WITHOUT factoring in the proposed changes. This doesn't work because it returns a value of 5 known runner and 5 = 5 so the proposed update passes and the new member and role is saved to the database with no error. Member Model: class Member < ActiveRecord::Base devise :database_authenticatable, :registerable, :recoverable, :rememberable, :trackable, :validatable attr_accessible :password, :password_confirmation, :remember_me attr_accessible :age, :email, :first_name, :last_name, :sex, :shirt_size, :team_id, :assignments_attributes, :role_ids belongs_to :team has_many :assignments, :dependent => :destroy has_many :roles, through: :assignments accepts_nested_attributes_for :assignments scope :runner, joins(:roles).where('roles.title = ?', "Runner") scope :captain, joins(:roles).where('roles.title = ?', "Captain") validate :validate_runner_count validate :validate_captain_count validates :role_ids, :presence => true def validate_runner_count if Team.find(self.team_id).members.runner.count > 5 errors.add(:role_id, 'Error - Max runner limit reached') end end def validate_captain_count if Team.find(self.team_id).members.captain.count > 1 errors.add(:role_id, 'Error - Max captain limit reached') end end def has_role?(role_sym) roles.any? { |r| r.title.underscore.to_sym == role_sym } end end Member Controller: class MembersController < ApplicationController load_and_authorize_resource :team load_and_authorize_resource :member, :through => :team before_filter :get_team before_filter :initialize_check_boxes, :only => [:create, :update] def get_team @team = Team.find(params[:team_id]) end def index respond_to do |format| format.html # index.html.erb format.json { render json: @members } end end def show respond_to do |format| format.html # show.html.erb format.json { render json: @member } end end def new respond_to do |format| format.html # new.html.erb format.json { render json: @member } end end def edit end def create respond_to do |format| if @member.save format.html { redirect_to [@team, @member], notice: 'Member was successfully created.' } format.json { render json: [@team, @member], status: :created, location: [@team, @member] } else format.html { render action: "new" } format.json { render json: @member.errors, status: :unprocessable_entity } end end end def update respond_to do |format| if @member.update_attributes(params[:member]) format.html { redirect_to [@team, @member], notice: 'Member was successfully updated.' } format.json { head :no_content } else format.html { render action: "edit" } format.json { render json: @member.errors, status: :unprocessable_entity } end end end def destroy @member.destroy respond_to do |format| format.html { redirect_to team_members_url } format.json { head :no_content } end end # Allow empty checkboxes # http://railscasts.com/episodes/17-habtm-checkboxes def initialize_check_boxes params[:member][:role_ids] ||= [] end end _Form Partial <%= form_for [@team, @member], :html => { :class => 'form-horizontal' } do |f| %> #... # testing the count... <ul> <li>Captain - <%= Team.find(@member.team_id).members.captain.size %></li> <li>Runner - <%= Team.find(@member.team_id).members.runner.size %></li> <li>Driver - <%= Team.find(@member.team_id).members.driver.size %></li> </ul> <div class="control-group"> <div class="controls"> <%= f.fields_for :roles do %> <%= hidden_field_tag "member[role_ids][]", nil %> <% Role.all.each do |role| %> <%= check_box_tag "member[role_ids][]", role.id, @member.role_ids.include?(role.id), id: dom_id(role) %> <%= label_tag dom_id(role), role.title %> <% end %> <% end %> </div> </div> #... <% end %>

    Read the article

  • Pixel plot method errors out without error message.

    - by sonny5
    // The following method blows up (big red x on screen) without generating error info. Any // ideas why? // MyPlot.PlotPixel(x, y, Color.BlueViolet, Grf); // runs if commented out // My goal is to draw a pixel on a form. Is there a way to increase the pixel size also? using System; using System.Drawing; using System.Drawing.Drawing2D; using System.Collections; using System.ComponentModel; using System.Windows.Forms; using System.Data; public class Plot : System.Windows.Forms.Form { private Size _ClientArea; //keeps the pixels info private double _Xspan; private double _Yspan; public Plot() { InitializeComponent(); } public Size ClientArea { set { _ClientArea = value; } } private void InitializeComponent() { this.AutoScaleBaseSize = new System.Drawing.Size(5, 13); this.ClientSize = new System.Drawing.Size(400, 300); this.Text="World Plot (world_plot.cs)"; this.Resize += new System.EventHandler(this.Form1_Resize); this.Paint += new System.Windows.Forms.PaintEventHandler(this.doLine); this.Paint += new System.Windows.Forms.PaintEventHandler(this.TransformPoints); // new this.Paint += new System.Windows.Forms.PaintEventHandler(this.DrawRectangleFloat); this.Paint += new System.Windows.Forms.PaintEventHandler(this.DrawWindow_Paint); } private void DrawWindow_Paint(object sender, PaintEventArgs e) { Graphics Grf = e.Graphics; pixPlot(Grf); } static void Main() { Application.Run(new Plot()); } private void doLine(object sender, System.Windows.Forms.PaintEventArgs e) { // no transforms done yet!!! Graphics g = e.Graphics; g.FillRectangle(Brushes.White, this.ClientRectangle); Pen p = new Pen(Color.Black); g.DrawLine(p, 0, 0, 100, 100); // draw DOWN in y, which is positive since no matrix called p.Dispose(); } public void PlotPixel(double X, double Y, Color C, Graphics G) { Bitmap bm = new Bitmap(1, 1); bm.SetPixel(0, 0, C); G.DrawImageUnscaled(bm, TX(X), TY(Y)); } private int TX(double X) //transform real coordinates to pixels for the X-axis { double w; w = _ClientArea.Width / _Xspan * X + _ClientArea.Width / 2; return Convert.ToInt32(w); } private int TY(double Y) //transform real coordinates to pixels for the Y-axis { double w; w = _ClientArea.Height / _Yspan * Y + _ClientArea.Height / 2; return Convert.ToInt32(w); } private void pixPlot(Graphics Grf) { Plot MyPlot = new Plot(); double x = 12.0; double y = 10.0; MyPlot.ClientArea = this.ClientSize; Console.WriteLine("x = {0}", x); Console.WriteLine("y = {0}", y); //MyPlot.PlotPixel(x, y, Color.BlueViolet, Grf); // blows up } private void DrawRectangleFloat(object sender, PaintEventArgs e) { // Create pen. Pen penBlu = new Pen(Color.Blue, 2); // Create location and size of rectangle. float x = 0.0F; float y = 0.0F; float width = 200.0F; float height = 200.0F; // translate DOWN by 200 pixels // Draw rectangle to screen. e.Graphics.DrawRectangle(penBlu, x, y, width, height); } private void TransformPoints(object sender, System.Windows.Forms.PaintEventArgs e) { // after transforms Graphics g = this.CreateGraphics(); Pen penGrn = new Pen(Color.Green, 3); Matrix myMatrix2 = new Matrix(1, 0, 0, -1, 0, 0); // flip Y axis with -1 g.Transform = myMatrix2; g.TranslateTransform(0, 200, MatrixOrder.Append); // translate DOWN the same distance as the rectangle... // ...so this will put it at lower left corner g.DrawLine(penGrn, 0, 0, 100, 90); // notice that y 90 is going UP } private void Form1_Resize(object sender, System.EventArgs e) { Invalidate(); } }

    Read the article

  • How to make my robot move in a rectangular path along the black tape?

    - by Sahat
    I am working on a robot, it's part of the summer robotics workshop in our college. We are using C-STAMP micro controllers by A-WIT. I was able to make it move, turn left, turn right, move backward. I have even managed to make it go along the black tape using a contrast sensor. I send the robot at 30-45 degrees toward the black tape on the table and it aligns itself and starts to move along the black tape. It jerks a little, probably due to my programming logic below, it's running a while loop and constantly checking if statements, so it ends up trying to turn left and right every few milliseconds, which explains the jerking part. But it's okay, it works, not as smooth as I want it to work but it works! Problem is that I can't make my robot go into a rectangular path of the black tape. As soon as it reaches the corner it just keeps going straight instead of making a left/right turn. Here's my attempt. The following code is just part of the code. My 2 sensors are located right underneath the robot, next to the front wheel, almost at the floor level. It has "index" value ranging from 0 to 8. I believe it's 8 when you have a lot of light coming into the sensor , and 0 when it's nearly pitch black. So when the robot moves into the black-tape-zone, the index value drops, and based on that I have an if-statement telling my robot to either turn left or right. To avoid confusion I didn't post the entire source code, but only the logical part responsible for the movement of my robot along the black tape. while(1) { // don't worry about these. // 10 and 9 represent Sensor's PIN location on the motherboard V = ANALOGIN(10, 1, 0, 0, 0); V2 = ANALOGIN(9, 1, 0, 0, 0); // i got this "formula" from the example in my Manual. // V stands for voltage of the sensor. // it gives me the index value of the sensor. 0 = darkest, 8 = lightest. index = ((-(V - 5) / 5) * 8 + 0.5); index2 = ((-(V2 - 5) / 5) * 8 + 0.5); // i've tweaked the position of the sensors so index > 7 is just right number. // the robot will move anywhere on the table just fine with index > 7. // as soon as it drops to or below 7 (i.e. finds black tape), the robot will // either turn left or right and then go forward. // lp & rp represent left-wheel pin and right-wheel pin, 1 means run forever. // if i change it from 1 to 100, it will go forward for 100ms. if (index > 7 && index2 > 7) goForward(lp, rp, 1); if (index <= 7) { turnLeft(lp, rp, 1); goForward(lp, rp, 1); // this is the tricky part. i've added this code last minute // trying to make my robot turn, but i didn't work. if (index > 4) { turnLeft(lp, rp, 1); goForward(lp, rp, 1); } } else if (index2 <= 7) { turnRight(lp, rp, 1); goForward(lp, rp, 1); // this is also the last minute addition. it's same code as above // but it's for the 2nd sensor. if (index2 > 4) { turnRight(lp, rp, 1); goForward(lp, rp, 1); } } I've spent the entire day trying to figure it out. I've pretty much exhausted all avenues. Asking for the solution on stackoverflow is my very last option now. Thanks in advance! If you have any questions about the code, let me know, but comments should be self-explanatory.

    Read the article

< Previous Page | 586 587 588 589 590 591 592 593 594 595 596 597  | Next Page >