Search Results

Search found 16838 results on 674 pages for 'writing patterns dita cms'.

Page 634/674 | < Previous Page | 630 631 632 633 634 635 636 637 638 639 640 641  | Next Page >

  • java concurrency: many writers, one reader

    - by Janning
    I need to gather some statistics in my software and i am trying to make it fast and correct, which is not easy (for me!) first my code so far with two classes, a StatsService and a StatsHarvester public class StatsService { private Map<String, Long> stats = new HashMap<String, Long>(1000); public void notify ( String key ) { Long value = 1l; synchronized (stats) { if (stats.containsKey(key)) { value = stats.get(key) + 1; } stats.put(key, value); } } public Map<String, Long> getStats ( ) { Map<String, Long> copy; synchronized (stats) { copy = new HashMap<String, Long>(stats); stats.clear(); } return copy; } } this is my second class, a harvester which collects the stats from time to time and writes them to a database. public class StatsHarvester implements Runnable { private StatsService statsService; private Thread t; public void init ( ) { t = new Thread(this); t.start(); } public synchronized void run ( ) { while (true) { try { wait(5 * 60 * 1000); // 5 minutes collectAndSave(); } catch (InterruptedException e) { e.printStackTrace(); } } } private void collectAndSave ( ) { Map<String, Long> stats = statsService.getStats(); // do something like: // saveRecords(stats); } } At runtime it will have about 30 concurrent running threads each calling notify(key) about 100 times. Only one StatsHarvester is calling statsService.getStats() So i have many writers and only one reader. it would be nice to have accurate stats but i don't care if some records are lost on high concurrency. The reader should run every 5 Minutes or whatever is reasonable. Writing should be as fast as possible. Reading should be fast but if it locks for about 300ms every 5 minutes, its fine. I've read many docs (Java concurrency in practice, effective java and so on), but i have the strong feeling that i need your advice to get it right. I hope i stated my problem clear and short enough to get valuable help.

    Read the article

  • xml dom node children

    - by matt
    Need some help I've got lots of code and i want to make it shorter i know there's a way but I can't remember it this is code example: <?xml version="1.0" encoding="ISO-8859-1"?> <bookstore> <book category="cooking"> <title lang="en">Everyday Italian</title> <author>Giada De Laurentiis</author> <year>2005</year> <price>30.00</price> </book> <book category="children"> <title lang="en">Harry Potter</title> <author>J K. Rowling</author> <year>2005</year> <price>29.99</price> </book> <book category="web"> <title lang="en">XQuery Kick Start</title> <author>James McGovern</author> <author>Per Bothner</author> <author>Kurt Cagle</author> <author>James Linn</author> <author>Vaidyanathan Nagarajan</author> <year>2003</year> <price>49.99</price> </book> <book category="web" cover="paperback"> <title lang="en">Learning XML</title> <author>Erik T. Ray</author> <year>2003</year> <price>39.95</price> </book> </bookstore As you can see the different nodes, children now is there a way to make this code smaller so I don't have to keep writing the nodes and children

    Read the article

  • How to generate and encode (for use in GA), random, strict, binary rooted trees with N leaves?

    - by Peter Simon
    First, I am an engineer, not a computer scientist, so I apologize in advance for any misuse of nomenclature and general ignorance of CS background. Here is the motivational background for my question: I am contemplating writing a genetic algorithm optimizer to aid in designing a power divider network (also called a beam forming network, or BFN for short). The BFN is intended to distribute power to each of N radiating elements in an array of antennas. The fraction of the total input power to be delivered to each radiating element has been specified. Topologically speaking, a BFN is a strictly binary, rooted tree. Each of the (N-1) interior nodes of the tree represents the input port of an unequal, binary power splitter. The N leaves of the tree are the power divider outputs. Given a particular power divider topology, one is still free to map the power divider outputs to the array inputs in an arbitrary order. There are N! such permutations of the outputs. There are several considerations in choosing the desired ordering: 1) The power ratio for each binary coupler should be within a specified range of values. 2) The ordering should be chosen to simplify the mechanical routing of the transmission lines connecting the power divider. The number of ouputs N of the BFN may range from, say, 6 to 22. I have already written a genetic algorithm optimizer that, given a particular BFN topology and desired array input power distribution, will search through the N! permutations of the BFN outputs to generate a design with compliant power ratios and good mechanical routing. I would now like to generalize my program to automatically generate and search through the space of possible BFN topologies. As I understand it, for N outputs (leaves of the binary tree), there are $C_{N-1}$ different topologies that can be constructed, where $C_N$ is the Catalan number. I would like to know how to encode an arbitrary tree having N leaves in a way that is consistent with a chromosomal description for use in a genetic algorithm. Also associated with this is the need to generate random instances for filling the initial population, and to implement crossover and mutations operators for this type of chromosome. Any suggestions will be welcome. Please minimize the amount of CS lingo in your reply, since I am not likely to be acquainted with it. Thanks in advance, Peter

    Read the article

  • Autocomplete server-side implementation

    - by toluju
    What is a fast and efficient way to implement the server-side component for an autocomplete feature in an html input box? I am writing a service to autocomplete user queries in our web interface's main search box, and the completions are displayed in an ajax-powered dropdown. The data we are running queries against is simply a large table of concepts our system knows about, which matches roughly with the set of wikipedia page titles. For this service obviously speed is of utmost importance, as responsiveness of the web page is important to the user experience. The current implementation simply loads all concepts into memory in a sorted set, and performs a simple log(n) lookup on a user keystroke. The tailset is then used to provide additional matches beyond the closest match. The problem with this solution is that it does not scale. It currently is running up against the VM heap space limit (I've set -Xmx2g, which is about the most we can push on our 32 bit machines), and this prevents us from expanding our concept table or adding more functionality. Switching to 64-bit VMs on machines with more memory isn't an immediate option. I've been hesitant to start working on a disk-based solution as I am concerned that disk seek time will kill performance. Are there possible solutions that will let me scale better, either entirely in memory or with some fast disk-backed implementations? Edits: @Gandalf: For our use case it is important the the autocompletion is comprehensive and isn't just extra help for the user. As for what we are completing, it is a list of concept-type pairs. For example, possible entries are [("Microsoft", "Software Company"), ("Jeff Atwood", "Programmer"), ("StackOverflow.com", "Website")]. We are using Lucene for the full search once a user selects an item from the autocomplete list, but I am not yet sure Lucene would work well for the autocomplete itself. @Glen: No databases are being used here. When I'm talking about a table I just mean the structured representation of my data. @Jason Day: My original implementation to this problem was to use a Trie, but the memory bloat with that was actually worse than the sorted set due to needing a large number of object references. I'll read on the ternary search trees to see if it could be of use.

    Read the article

  • Design Technique: How to design a complex system for processing orders, products and units.

    - by Shyam
    Hi, Programming is fun: I learned that by trying out simple challenges, reading up some books and following some tutorials. I am able to grasp the concepts of writing with OO (I do so in Ruby), and write a bit of code myself. What bugs me though is that I feel re-inventing the wheel: I haven't followed an education or found a book (a free one that is) that explains me the why's instead of the how's, and I've learned from the A-team that it is the plan that makes it come together. So, armed with my nuby Ruby skills, I decided I wanted to program a virtual store. I figured out the following: My virtual Store will have: Products and Services Inventories Orders and Shipping Customers Now this isn't complex at all. With the help of some cool tools (CMapTools), I drew out some concepts, but quickly enough (thanks to my inferior experience in designing), my design started to bite me. My very first product-line were virtual "laptops". So, I created a class (Ruby): class Product attr_accessor :name, :price def initialize(name, price) @name = name @price = price end end which can be instantiated by doing (IRb) x = Product.new("Banana Pro", 250) Since I want my virtual customers to be able to purchase more than one product, or various types, I figured out I needed some kind of "Order" mechanism. class Order def initialize(order_no) @order_no = order_no @line_items = [] end def add_product(myproduct) @line_items << myproduct end def show_order() puts @order_no @line_items.each do |x| puts x.name.to_s + "\t" + x.price.to_s end end end that can be instantiated by doing (IRb) z = Order.new(1234) z.add_product(x) z.show_order Splendid, I have now a very simple ordering system that allows me to add products to an order. But, here comes my real question. What if I have three models of my product (economy, business, showoff)? Or have my products be composed out of separate units (bigger screen, nicer keyboard, different OS)? Surely I could make them three separate products, or add complexity to my product class, but I am looking for are best practices to design a flexible product object that can be used in the real world, to facilitate a complex system. My apologies if my grammar and my spelling are with error, as english is not my first language and I took the time to check as far I could understand and translate properly! Thank you for your answers, comments and feedback!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Inserting contact with android and querying the result uri returns no entries

    - by th0m4d
    Im developing an application which is dealing with the android contacts API. I implemented methods to insert, update and query contacts. So far everything worked (writing and reading contacts). At one point in my project Im experiencing a strange behaviour. I insert a contact using batch mode. I receive the URI to the RawContact. I do this in a background thread. // use batchmode for contact insertion ArrayList ops = new ArrayList(); int rawContactInsertIndex = ops.size(); // create rawContact ops.add(ContentProviderOperation.newInsert(RawContacts.CONTENT_URI) .withValue(RawContacts.ACCOUNT_TYPE, ConstantsContract.ACCOUNT_TYPE) .withValue(RawContacts.ACCOUNT_NAME, accountName).build()); ops.add(createInsertOperation().withValueBackReference(Data.RAW_CONTACT_ID, rawContactInsertIndex) .withValue(Data.MIMETYPE, StructuredName.CONTENT_ITEM_TYPE) .withValue(StructuredName.DISPLAY_NAME, displayName).withValue(StructuredName.GIVEN_NAME, firstName) .withValue(StructuredName.FAMILY_NAME, lastName).build()); //other data values... ContentProviderResult[] results = context.getContentResolver().applyBatch(ContactsContract.AUTHORITY, ops); if (results.length 0) { result = results[0]; } Then i request and store the lookup uri RawContacts.getContactLookupUri(this.getContentResolver(), myContantRawContactUri); I am able to query the contact using the rawContactUri directly after inserting it (in the same thread). The lookup uri returns null. Uri rawContactUri = appUser.getRawContactUri(ctx); if (rawContactUri == null) { return null; } String lastPathSegment = rawContactUri.getLastPathSegment(); long rawContactId = Long.decode(lastPathSegment); if (rawContactUri != null) { contact = readContactWithID(rawContactId, ContactsContract.Data.RAW_CONTACT_ID); In a different place in the project I want to query the contact i inserted by the stored lookup uri or raw contact uri. Both return no rows from the content provider. I tried it in the main thread and in another background thread. ctx.getContentResolver().query(ContactsContract.Data.CONTENT_URI, null, ContactsContract.Data.RAW_CONTACT_ID + " = ? AND " + ContactsContract.Data.MIMETYPE + " = ?", new String[] { contactID + "", ContactsContract.CommonDataKinds.StructuredName.CONTENT_ITEM_TYPE }, null); My first thought was that it could be related to the context.getContentResolver(). But the android documentation states, that the ContentResolver objects scope is the application's package, so you have on ContentResolver for the whole app. Am I right? What am I doing wrong? Why does the same rawContactUri return the contact at one place and does not on another place? And why do I get a lookup uri from a raw contact, which is not working at all?

    Read the article

  • PHP: Condense array of similar strings into one merged array

    - by Matt Andrews
    Hi everyone. Working with an array of dates (opening times for a business). I want to condense them to their briefest possible form. So far, I started out with this structure Array ( [Mon] => 12noon-2:45pm, 5:30pm-10:30pm [Tue] => 12noon-2:45pm, 5:30pm-10:30pm [Wed] => 12noon-2:45pm, 5:30pm-10:30pm [Thu] => 12noon-2:45pm, 5:30pm-10:30pm [Fri] => 12noon-2:45pm, 5:30pm-10:30pm [Sat] => 12noon-11pm [Sun] => 12noon-9:30pm ) What I want to achieve is this: Array ( [Mon-Fri] => 12noon-2:45pm, 5:30pm-10:30pm [Sat] => 12noon-11pm [Sun] => 12noon-9:30pm ) I've tried writing a recursive function and have managed to output this so far: Array ( [Mon-Fri] => 12noon-2:45pm, 5:30pm-10:30pm [Tue-Fri] => 12noon-2:45pm, 5:30pm-10:30pm [Wed-Fri] => 12noon-2:45pm, 5:30pm-10:30pm [Thu-Fri] => 12noon-2:45pm, 5:30pm-10:30pm [Sat] => 12noon-11pm [Sun] => 12noon-9:30pm ) Can anybody see a simple way of comparing the values and combining the keys where they're similar? My recursive function is basically two nested foreach() loops - not very elegant. Thanks, Matt EDIT: Here's my code so far, which produces the 3rd array above (from the first one as input): $last_time = array('t' => '', 'd' => ''); // blank array for looping $i = 0; foreach($final_times as $day=>$time) { if($last_time['t'] != $time ) { // it's a new time if($i != 0) { $print_times[] = $day . ' ' . $time; } // only print if it's not the first, otherwise we get two mondays } else { // this day has the same time as last time $end_day = $day; foreach($final_times as $day2=>$time2) { if($time == $time2) { $end_day = $day2; } } $print_times[] = $last_time['d'] . '-' . $end_day . ' ' . $time; } $last_time = array('t' => $time, 'd' => $day); $i++; }

    Read the article

  • C++0x Overload on reference, versus sole pass-by-value + std::move?

    - by dean
    It seems the main advice concerning C++0x's rvalues is to add move constructors and move operators to your classes, until compilers default-implement them. But waiting is a losing strategy if you use VC10, because automatic generation probably won't be here until VC10 SP1, or in worst case, VC11. Likely, the wait for this will be measured in years. Here lies my problem. Writing all this duplicate code is not fun. And it's unpleasant to look at. But this is a burden well received, for those classes deemed slow. Not so for the hundreds, if not thousands, of smaller classes. ::sighs:: C++0x was supposed to let me write less code, not more! And then I had a thought. Shared by many, I would guess. Why not just pass everything by value? Won't std::move + copy elision make this nearly optimal? Example 1 - Typical Pre-0x constructor OurClass::OurClass(const SomeClass& obj) : obj(obj) {} SomeClass o; OurClass(o); // single copy OurClass(std::move(o)); // single copy OurClass(SomeClass()); // single copy Cons: A wasted copy for rvalues. Example 2 - Recommended C++0x? OurClass::OurClass(const SomeClass& obj) : obj(obj) {} OurClass::OurClass(SomeClass&& obj) : obj(std::move(obj)) {} SomeClass o; OurClass(o); // single copy OurClass(std::move(o)); // zero copies, one move OurClass(SomeClass()); // zero copies, one move Pros: Presumably the fastest. Cons: Lots of code! Example 3 - Pass-by-value + std::move OurClass::OurClass(SomeClass obj) : obj(std::move(obj)) {} SomeClass o; OurClass(o); // single copy, one move OurClass(std::move(o)); // zero copies, two moves OurClass(SomeClass()); // zero copies, one move Pros: No additional code. Cons: A wasted move in cases 1 & 2. Performance will suffer greatly if SomeClass has no move constructor. What do you think? Is this correct? Is the incurred move a generally acceptable loss when compared to the benefit of code reduction?

    Read the article

  • Cannot run public class in one .java from another

    - by DIOS
    I have created a basic program that takes whatever is input into two textfields and exports them to a file. I would now like to encrypt that file, and alredy have the encryptor. The problem is that I cannot call it. Here is my code for the encryptor: import java.io.File; import java.io.FileInputStream; import java.io.FileOutputStream; import java.io.*; import javax.crypto.Cipher; import javax.crypto.CipherInputStream; import javax.crypto.CipherOutputStream; import javax.crypto.spec.SecretKeySpec; public class FileEncryptor { private String algo; private File file; public FileEncryptor(String algo,String path) { this.algo=algo; //setting algo this.file=new File(path); //settong file } public void encrypt() throws Exception{ //opening streams FileInputStream fis =new FileInputStream(file); file=new File(file.getAbsolutePath()); FileOutputStream fos =new FileOutputStream(file); //generating key byte k[] = "HignDlPs".getBytes(); SecretKeySpec key = new SecretKeySpec(k,algo.split("/")[0]); //creating and initialising cipher and cipher streams Cipher encrypt = Cipher.getInstance(algo); encrypt.init(Cipher.ENCRYPT_MODE, key); CipherOutputStream cout=new CipherOutputStream(fos, encrypt); byte[] buf = new byte[1024]; int read; while((read=fis.read(buf))!=-1) //reading data cout.write(buf,0,read); //writing encrypted data //closing streams fis.close(); cout.flush(); cout.close(); } public static void main (String[] args)throws Exception { new FileEncryptor("DES/ECB/PKCS5Padding","C:\\Users\\*******\\Desktop\\newtext").encrypt();//encrypts the current file. } } Here is the section of my file creator that is failing to call this: FileWriter fWriter = null; BufferedWriter writer = null; try{ fWriter = new FileWriter("C:\\Users\\*******\\Desktop\\newtext"); writer = new BufferedWriter(fWriter); writer.write(Data); writer.close(); f.dispose(); FileEncryptor encr = new FileEncryptor(); //problem lies here. encr.encrypt //public void that does the encryption. new complete(); //different .java that is working fine.

    Read the article

  • Programming a callback function within a jQuery plugin

    - by ILMV
    I'm writing a jQuery plug-in so I can reuse this code in many places as it is a very well used piece of code, the code itself adds a new line to a table which has been cloned from a hidden row, it continues to perform a load of manipulations on the new row. I'm currently referencing it like this: $(".abc .grid").grid(); But I want to include a callback so each area the plug-in is called from can do something a bit more unique when the row has been added. I've used the jQuery AJAX plug-in before, so have used the success callback function, but cannot understand how the code works in the background. Here's what I want to achieve: $(".abc .grid").grid({ row_added: function() { // do something a bit more specific here } }); Here's my plug-in code (function($){ $.fn.extend({ //pass the options variable to the function grid: function() { return this.each(function() { grid_table=$(this).find('.grid-table > tbody'); grid_hidden_row=$(this).find('.grid-hidden-row'); //console.debug(grid_hidden_row); $(this).find('.grid-add-row').click(function(event) { /* * clone row takes a hidden dummy row, clones it and appends a unique row * identifier to the id. Clone maintains our jQuery binds */ // get the last id last_row=$(grid_table).find('tr:last').attr('id'); if(last_row===undefined) { new_row=1; } else { new_row=parseInt(last_row.replace('row',''),10)+1; } // append element to target, changes it's id and shows it $(grid_table).append($(grid_hidden_row).clone(true).attr('id','row'+new_row).removeClass('grid-hidden-row').show()); // append unique row identifier on id and name attribute of seledct, input and a $('#row'+new_row).find('select, input, a').each(function(id) { $(this).appendAttr('id','_row'+new_row); $(this).replaceAttr('name','_REPLACE_',new_row); }); // disable all the readonly_if_lines options if this is the first row if(new_row==1) { $('.readonly_if_lines :not(:selected)').attr('disabled','disabled'); } }); $(this).find('.grid-remove-row').click(function(event) { /* * Remove row does what it says on the tin, as well as a few other house * keeping bits and pieces */ // remove the parent tr $(this).parents('tr').remove(); // recalculate the order value5 //calcTotal('.net_value ','#gridform','#gridform_total'); // if we've removed the last row remove readonly locks row_count=grid_table.find('tr').size(); console.info(row_count); if(row_count===0) { $('.readonly_if_lines :disabled').removeAttr('disabled'); } }); }); } }); })(jQuery); I've done the usually searching on elgooG... but I seem to be getting a lot of noise with little result, any help would be greatly appreciated. Thanks!

    Read the article

  • Transaction on Entity FrameWork Refactoring and best performance how can i?

    - by programmerist
    i try to use transaction in Entity FrameWork. i have 3 tables Personel, Prim, Finans. in Prim table you look SatisTutari (int) if i add data in SatisTutari.Text instead of int value adding float value. Trannsaction must be run! Everything is ok but how can i refactoring or give best performance or best writing Transaction coding! i have 3 table so i have 3 entities: CREATE TABLE Personel (PersonelID integer PRIMARY KEY identity not null, Ad varchar(30), Soyad varchar(30), Meslek varchar(100), DogumTarihi datetime, DogumYeri nvarchar(100), PirimToplami float); Go create TABLE Prim (PrimID integer PRIMARY KEY identity not null, PersonelID integer Foreign KEY references Personel(PersonelID), SatisTutari int, Prim float, SatisTarihi Datetime); Go CREATE TABLE Finans (ID integer PRIMARY KEY identity not null, Tutar float); Personel, Prim,Finans my tables. if you look Prim table you can see Prim value float value if i write a textbox not float value my transaction must run. protected void btnSave_Click(object sender, EventArgs e) { using (TestEntities testCtx = new TestEntities()) { using (TransactionScope scope = new TransactionScope()) { Personel personel = new Personel(); Prim prim = new Prim(); Finans finans = new Finans(); //-----------------------------------------------------------------------Step 1 personel.Ad = txtName.Text; personel.Soyad = txtSurName.Text; personel.Meslek = txtMeslek.Text; personel.DogumTarihi = DateTime.Parse(txtSatisTarihi.Text); personel.DogumYeri = txtDogumYeri.Text; personel.PirimToplami = float.Parse(txtPrimToplami.Text); testCtx.AddToPersonel(personel); testCtx.SaveChanges(); //----------------------------------------------------------------------- step 2 prim.PersonelID = personel.PersonelID; prim.SatisTutari = int.Parse(txtSatisTutari.Text); prim.SatisTarihi = DateTime.Parse(txtSatisTarihi.Text); prim.Prim1 = double.Parse(txtPrim.Text); finans.Tutar = prim.SatisTutari * prim.Prim1; testCtx.AddToPrim(prim); testCtx.SaveChanges(); //----------------------------------------------------------------------- step 3 lblTutar.Text = finans.Tutar.Value.ToString(); testCtx.AddToFinans(finans); testCtx.SaveChanges(); scope.Complete(); } } How can i rearrange codes. i need best practice refactoring and best solution for reading easly and performance!!!

    Read the article

  • C++ Using a class template argument as a template argument for another type

    - by toefel
    Hey Everyone, I'm having this problem while writing my own HashTable. It all works, but when I try to templatize the thing, it gave me errors. I recreated the problem as follows: THIS CODE WORKS: typedef double Item; class A { public: A() { v.push_back(pair<string, Item>("hey", 5.0)); } void iterate() { for(Iterator iter = v.begin(); iter != v.end(); ++iter) cout << iter->first << ", " << iter->second << endl; } private: vector<pair<string, double> > v; typedef vector< pair<string, double> >::iterator Iterator; }; THIS CODE DOES NOT: template<typename ValueType> class B { public: B(){} void iterate() { for(Iterator iter = v.begin(); iter != v.end(); ++iter) cout << iter->first << ", " << iter->second << endl; } private: vector<pair<string, ValueType> > v; typedef vector< pair<string, ValueType> >::iterator Iterator; }; the error messages: g++ -O0 -g3 -Wall -c -fmessage-length=0 -omain.o ..\main.cpp ..\main.cpp:50: error: type std::vector<std::pair<std::string, ValueType>, std::allocator<std::pair<std::string, ValueType> > >' is not derived from typeB' ..\main.cpp:50: error: ISO C++ forbids declaration of `iterator' with no type ..\main.cpp:50: error: expected `;' before "Iterator" ..\main.cpp: In member function `void B::iterate()': ..\main.cpp:44: error: `Iterator' was not declared in this scope ..\main.cpp:44: error: expected `;' before "iter" ..\main.cpp:44: error: `iter' was not declared in this scope Does anybody know why this is happening? Thanks!

    Read the article

  • How to use Crtl in a Delphi unit in a C++Builder project? (or link to C++Builder C runtime library)

    - by Craig Peterson
    I have a Delphi unit that is statically linking a C .obj file using the {$L xxx} directive. The C file is compiled with C++Builder's command line compiler. To satisfy the C file's runtime library dependencies (_assert, memmove, etc), I'm including the crtl unit Allen Bauer mentioned here. unit FooWrapper; interface implementation uses Crtl; // Part of the Delphi RTL {$L FooLib.obj} // Compiled with "bcc32 -q -c foolib.c" procedure Foo; cdecl; external; end. If I compile that unit in a Delphi project (.dproj) everthing works correctly. If I compile that unit in a C++Builder project (.cbproj) it fails with the error: [ILINK32 Error] Fatal: Unable to open file 'CRTL.OBJ' And indeed, there isn't a crtl.obj file in the RAD Studio install folder. There is a .dcu, but no .pas. Trying to add crtdbg to the uses clause (the C header where _assert is defined) gives an error that it can't find crtdbg.dcu. If I remove the uses clause, it instead fails with errors that __assert and _memmove aren't found. So, in a Delphi unit in a C++Builder project, how can I export functions from the C runtime library so they're available for linking? I'm already aware of Rudy Velthuis's article. I'd like to avoid manually writing Delphi wrappers if possible, since I don't need them in Delphi, and C++Builder must already include the necessary functions. Edit For anyone who wants to play along at home, the code is available in Abbrevia's Subversion repository at https://tpabbrevia.svn.sourceforge.net/svnroot/tpabbrevia/trunk. I've taken David Heffernan's advice and added a "AbCrtl.pas" unit that mimics crtl.dcu when compiled in C++Builder. That got the PPMd support working, but the Lzma and WavPack libraries both fail with link errors: [ILINK32 Error] Error: Unresolved external '_beginthreadex' referenced from ABLZMA.OBJ [ILINK32 Error] Error: Unresolved external 'sprintf' referenced from ABWAVPACK.OBJ [ILINK32 Error] Error: Unresolved external 'strncmp' referenced from ABWAVPACK.OBJ [ILINK32 Error] Error: Unresolved external '_ftol' referenced from ABWAVPACK.OBJ AFAICT, all of them are declared correctly, and the _beginthreadex one is actually declared in AbLzma.pas, so it's used by the pure Delphi compile as well. To see it yourself, just download the trunk (or just the "source" and "packages" directories), disable the {$IFDEF BCB} block at the bottom of AbDefine.inc, and try to compile the C++Builder "Abbrevia.cbproj" project.

    Read the article

  • USB windows xp final USB access issues

    - by Lex Dean
    I basically understand you C++ people, Please do not get distracted because I'm writing in Delphi. I have a stable USB Listing method that accesses all my USB devices I get the devicepath, and this structure: TSPDevInfoData = packed record Size: DWORD; ClassGuid: TGUID; DevInst: DWORD; // DEVINST handle Reserved: DWord; end; I get my ProductID and VenderID successfully from my DevicePath Lists all USB devices connected to the computer at the time That enables me to access the registry data to each device in a stable way. What I'm lacking is a little direction Is friendly name able to be written inside the connected USB Micro chips by the firmware programmer? (I'm thinking of this to identify the device even further, or is this to help identify Bulk data transfer devices like memory sticks and camera's) Can I use SPDRP_REMOVAL_POLICY_OVERRIDE to some how reset these polices What else can I do with the registry details. Identifying when some one unplugs a device The program is using (in windows XP standard) I used a documented windows event that did not respond. Can I read a registry value to identify if its still connected? using CreateFileA (DevicePath) to send and receive data I have read when some one unplugs in the middle of a data transfer its difficult clearing resources. what can IoCreateDevice do for me and how does one use it for that task This two way point of connection status and system lock up situations is very concerning. Has some one read anything about this subject recently? My objectives are to 1. list connected USB devices identify a in development Micro Controller from everything else send and receive data in a stable and fast way to the limits of the controller No lock up's transferring data Note I'm not using any service packs I understand everything USB is in ANSI when windows xp is not and .Net is all about ANSI (what a waste of memory) I plan to continue this project into a .net at a later date as an addition. MSDN gives me Structures and Functions and what should link to what ok but say little to what they get used for. What is available in my language Delphi is way over priced that it needs a major price drop.

    Read the article

  • Binary file reading problem

    - by ScReYm0
    Ok i have problem with my code for reading binary file... First i will show you my writing code: void book_saving(char *file_name, struct BOOK *current) { FILE *out; BOOK buf; out = fopen(file_name, "wb"); if(out != NULL) { printf_s("Writting to file..."); do { if(current != NULL) { strcpy(buf.catalog_number, current->catalog_number); strcpy(buf.author, current->author); buf.price = current->price; strcpy(buf.publisher, current->publisher); strcpy(buf.title, current->title); buf.price = current->year_published; fwrite(&buf, sizeof(BOOK), 1, out); } current = current->next; }while(current != NULL); printf_s("Done!\n"); fclose(out); } } and here is my "version" for reading it back: int book_open(struct BOOK *current, char *file_name) { FILE *in; BOOK buf; BOOK *vnext; int count; int i; in = fopen("west", "rb"); printf_s("Reading database from %s...", file_name); if(!in) { printf_s("\nERROR!"); return 1; } i = fread(&buf,sizeof(BOOK), 1, in); while(!feof(in)) { if(current != NULL) { current = malloc(sizeof(BOOK)); current->next = NULL; } strcpy(current->catalog_number, buf.catalog_number); strcpy(current->title, buf.title); strcpy(current->publisher, buf.publisher); current->price = buf.price; current->year_published = buf.year_published; fread(&buf, 1, sizeof(BOOK), in); while(current->next != NULL) current = current->next; fclose(in); } printf_s("Done!"); return 0; } I just need to save my linked list in binary file and to be able to read it back ... please help me. The program just don't read it or its crash every time different situation ...

    Read the article

  • Idiomatic use of auto_ptr to transfer ownership to a container

    - by heycam
    I'm refreshing my C++ knowledge after not having used it in anger for a number of years. In writing some code to implement some data structure for practice, I wanted to make sure that my code was exception safe. So I've tried to use std::auto_ptrs in what I think is an appropriate way. Simplifying somewhat, this is what I have: class Tree { public: ~Tree() { /* delete all Node*s in the tree */ } void insert(const string& to_insert); ... private: struct Node { ... vector<Node*> m_children; }; Node* m_root; }; template<T> void push_back(vector<T*>& v, auto_ptr<T> x) { v.push_back(x.get()); x.release(); } void Tree::insert(const string& to_insert) { Node* n = ...; // find where to insert the new node ... push_back(n->m_children, auto_ptr<Node>(new Node(to_insert)); ... } So I'm wrapping the function that would put the pointer into the container, vector::push_back, and relying on the by-value auto_ptr argument to ensure that the Node* is deleted if the vector resize fails. Is this an idiomatic use of auto_ptr to save a bit of boilerplate in my Tree::insert? Any improvements you can suggest? Otherwise I'd have to have something like: Node* n = ...; // find where to insert the new node auto_ptr<Node> new_node(new Node(to_insert)); n->m_children.push_back(new_node.get()); new_node.release(); which kind of clutters up what would have been a single line of code if I wasn't worrying about exception safety and a memory leak. (Actually I was wondering if I could post my whole code sample (about 300 lines) and ask people to critique it for idiomatic C++ usage in general, but I'm not sure whether that kind of question is appropriate on stackoverflow.)

    Read the article

  • Deterministic key serialization

    - by Mike Boers
    I'm writing a mapping class which uses SQLite as the storage backend. I am currently allowing only basestring keys but it would be nice if I could use a couple more types hopefully up to anything that is hashable (ie. same requirements as the builtin dict). To that end I would like to derive a deterministic serialization scheme. Ideally, I would like to know if any implementation/protocol combination of pickle is deterministic for hashable objects (e.g. can only use cPickle with protocol 0). I noticed that pickle and cPickle do not match: >>> import pickle >>> import cPickle >>> def dumps(x): ... print repr(pickle.dumps(x)) ... print repr(cPickle.dumps(x)) ... >>> dumps(1) 'I1\n.' 'I1\n.' >>> dumps('hello') "S'hello'\np0\n." "S'hello'\np1\n." >>> dumps((1, 2, 'hello')) "(I1\nI2\nS'hello'\np0\ntp1\n." "(I1\nI2\nS'hello'\np1\ntp2\n." Another option is to use repr to dump and ast.literal_eval to load. This would only be valid for builtin hashable types. I have written a function to determine if a given key would survive this process (it is rather conservative on the types it allows): def is_reprable_key(key): return type(key) in (int, str, unicode) or (type(key) == tuple and all( is_reprable_key(x) for x in key)) The question for this method is if repr itself is deterministic for the types that I have allowed here. I believe this would not survive the 2/3 version barrier due to the change in str/unicode literals. This also would not work for integers where 2**32 - 1 < x < 2**64 jumping between 32 and 64 bit platforms. Are there any other conditions (ie. do strings serialize differently under different conditions)? (If this all fails miserably then I can store the hash of the key along with the pickle of both the key and value, then iterate across rows that have a matching hash looking for one that unpickles to the expected key, but that really does complicate a few other things and I would rather not do it.) Any insights?

    Read the article

  • Flatten date range memberships retaining only the highest priority membership (TRANSACT-SQL)

    - by shadowranger
    Problem statement: A table contains an item_id, a category_id and a date range (begin_date and end_date). No item may be in more than one category on any given date (in general; during daily rebuilding it can be in an invalid state temporarily). By default, all items are added (and re-added if removed) to a category (derived from outside data) automatically on a daily basis, and their membership in that category matches the lifespan of the item (items have their own begin and end date, and usually spend their entire lives in the same category, which is why this matches). For items in category X, it is occasionally desirable to override the default category by adding them to category Y. Membership in category Y could entirely replace membership in category X (that is, the begin and end dates for membership in category Y would match the begin and end dates of the item itself), or it could override it for an arbitrary period of time (at the beginning, middle or end the item's lifespan, possibly overriding for short periods at multiple times). Membership in category Y is not renewed automatically and additions to that category is done by manual data entry. Every day, when category X is rebuilt, we get an overlap, where any item in category Y will now be in category X as well (which is forbidden, as noted previously). Goal: After each repopulation of category X (which is done in a rather complicated and fragile manner, and ideally would be left alone), I'm trying to find an efficient means of writing a stored procedure that: Identifies the overlaps Changes existing entries, adds new ones where necessary (such as in the case where an item starts in category X, switches to category Y, then eventually switches back to category X before ending), or removes entries (when an item is in category Y for its entire life) such that every item remains in category Y (and only Y) where specified, while category X membership is maintained when not overridden by category Y. Does not affect memberships of categories A, B, C, Z, etc., which do not have override categories and are built separately, by completely different rules. Note: It can be assumed that X membership covers the entire lifespan of the item before this procedure is called, so it is unnecessary to query any data outside this table. Bonus credit: If for some reason there are two adjacent or overlapping memberships in for the same item in category Y, stitching them together into a single entry is appreciated, but not necessary. Example: item_id category_id begin_date end_date 1 X 20080101 20090628 1 Y 20090101 20090131 1 Y 20090601 20090628 2 X 20080201 20080731 2 Y 20080201 20080731 Should become: item_id category_id begin_date end_date 1 X 20080101 20081231 1 Y 20090101 20090131 1 X 20090201 20090531 1 Y 20090601 20090628 2 Y 20080201 20080731 If it matters, this needs to work on SQL Server 2005 and SQL Server 2008

    Read the article

  • Ajax success function firing before java class responds

    - by user1899281
    I am creating a login function with ajax and am having an issue where the success function (SuccessLogin) fires before getting an ajax response. I am running the code as google web app from eclipse and I can see when debugging the java class file, that the javascript is throwing an alert for the success response from the class being false before the debugger catches the break point in the class file. I have only been writing code for a couple months now so I am sure its a stupid little error on my part. $(document).ready(function() { sessionChecker() // sign in $('#signInForm').click(function () { $().button('loading') var email = $('#user_username').val(); sessionStorage.email = $('#user_username').val(); var password= $('#user_password').val(); var SignInRequest = { type: "UserLoginRequest", email: email, password: password } var data= JSON.stringify(SignInRequest); //disabled all the text fields $('.text').attr('disabled','true'); //start the ajax $.ajax({ url: "/resources/user/login", type: "POST", data: data, cache: false, success: successLogin(data) }); }); //if submit button is clicked $('#Register').click(function () { $().button('loading') var email = $('#email').val(); if ($('#InputPassword').val()== $('#ConfirmPassword').val()) { var password= $('input[id=InputPassword]').val(); } else {alert("Passwords do not match"); return ;} var UserRegistrationRequest = { type: "UserRegistrationRequest", email: email, password: password } var data= JSON.stringify(UserRegistrationRequest); //disabled all the text fields $('.text').attr('disabled','true'); //start the ajax $.ajax({ url: "/resources/user/register", type: "POST", data: data, cache: false, success: function (data) { if (data.success==true) { //hide the form $('form').fadeOut('slow'); //show the success message $('.done').fadeIn('slow'); } else alert('data.errorReason'); } }); return false; }); }); function successLogin (data){ if (data.success) { sessionStorage.userID= data.userID var userID = data.userID sessionChecker(userID); } else alert(data.errorReason); } //session check function sessionChecker(uid) { if (sessionStorage.userID!= null){ var userID = sessionStorage.userID }; if (userID != null){ $('#user').append(userID) $('#fat-menu_1').fadeOut('slow') $('#fat-menu_2').append(sessionStorage.email).fadeIn('slow') }; }

    Read the article

  • UTF-8 GET using Indy 10.5.8.0 and Delphi XE2

    - by Bogdan Botezatu
    I'm writing my first Unicode application with Delphi XE2 and I've stumbled upon an issue with GET requests to an Unicode URL. Shortly put, it's a routine in a MP3 tagging application that takes a track title and an artist and queries Last.FM for the corresponding album, track no and genre. I have the following code: function GetMP3Info(artist, track: string) : TMP3Data //<---(This is a record) var TrackTitle, ArtistTitle : WideString; webquery : WideString; [....] WebQuery := UTF8Encode('http://ws.audioscrobbler.com/2.0/?method=track.getcorrection&api_key=' + apikey + '&artist=' + artist + '&track=' + track); //[processing the result in the web query, getting the correction for the artist and title] // eg: for artist := Bucovina and track := Mestecanis, the corrected values are //ArtistTitle := Bucovina; // TrackTitle := Mestecani?; //Now here is the tricky part: webquery := UTF8Encode('http://ws.audioscrobbler.com/2.0/?method=track.getInfo&api_key=' + apikey + '&artist=' + unescape(ArtistTitle) + '&track=' + unescape(TrackTitle)); //the unescape function replaces spaces (' ') with '+' to comply with the last.fm requests [some more processing] end; The webquery looks in a TMemo just right (http://ws.audioscrobbler.com/2.0/?method=track.getInfo&api_key=e5565002840xxxxxxxxxxxxxx23b98ad&artist=Bucovina&track=Mestecani?) Yet, when I try to send a GET() to the webquery using IdHTTP (with the ContentEncoding property set to 'UTF-8'), I see in Wireshark that the component is GET-ing the data to the ANSI value '/2.0/?method=track.getInfo&api_key=e5565002840xxxxxxxxxxxxxx23b98ad&artist=Bucovina&track=Mestec?ni?' Here is the full headers for the GET requests and responses: GET /2.0/?method=track.getInfo&api_key=e5565002840xxxxxxxxxxxxxx23b98ad&artist=Bucovina&track=Mestec?ni? HTTP/1.1 Content-Encoding: UTF-8 Host: ws.audioscrobbler.com Accept: text/html, */* Accept-Encoding: identity User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.23) Gecko/20110920 Firefox/3.6.23 SearchToolbar/1.22011-10-16 20:20:07 HTTP/1.0 400 Bad Request Date: Tue, 09 Oct 2012 20:46:31 GMT Server: Apache/2.2.22 (Unix) X-Web-Node: www204 Access-Control-Allow-Origin: * Access-Control-Allow-Methods: POST, GET, OPTIONS Access-Control-Max-Age: 86400 Cache-Control: max-age=10 Expires: Tue, 09 Oct 2012 20:46:42 GMT Content-Length: 114 Connection: close Content-Type: text/xml; charset=utf-8; <?xml version="1.0" encoding="utf-8"?> <lfm status="failed"> <error code="6"> Track not found </error> </lfm> The question that puzzles me is am I overseeing anything related to setting the property of the tidhttp control? How can I stop the well-formated URL i'm composing in the application from getting wrongfully sent to the server? Thanks.

    Read the article

  • Why does Module::Build's testcover gives me "use of uninitialized value" warnings?

    - by Kurt W. Leucht
    I'm kinda new to Module::Build, so maybe I did something wrong. Am I the only one who gets warnings when I change my dispatch from "test" to "testcover"? Is there a bug in Devel::Cover? Is there a bug in Module::Build? I probably just did something wrong. I'm using ActiveState Perl v5.10.0 with Module::Build version 0.31012 and Devel::Cover 0.64 and Eclipse 3.4.1 with EPIC 0.6.34 for my IDE. UPDATE: I upgraded to Module::Build 0.34 and the warnings are still output. *UPDATE: Looks like a bug in B::Deparse. Hope it gets fixed someday.* Here's my unit test build file: use strict; use warnings; use Module::Build; my $build = Module::Build->resume ( properties => { config_dir => '_build', }, ); $build->dispatch('test'); When I run this unit test build file, I get the following output: t\MyLib1.......ok t\MyLib2.......ok t\MyLib3.......ok All tests successful. Files=3, Tests=24, 0 wallclock secs ( 0.00 cusr + 0.00 csys = 0.00 CPU) But when I change the dispatch line to 'testcover' I get the following output which always includes a bunch of "use of uninitialized value in bitwise and" warning messages: Deleting database D:/Documents and Settings/<username>/My Documents/<SNIP>/cover_db t\MyLib1.......ok Use of uninitialized value in bitwise and (&) at D:/Perl/lib/B/Deparse.pm line 4252. Use of uninitialized value in bitwise and (&) at D:/Perl/lib/B/Deparse.pm line 4252. t\MyLib2.......ok Use of uninitialized value in bitwise and (&) at D:/Perl/lib/B/Deparse.pm line 4252. Use of uninitialized value in bitwise and (&) at D:/Perl/lib/B/Deparse.pm line 4252. t\MyLib3.......ok Use of uninitialized value in bitwise and (&) at D:/Perl/lib/B/Deparse.pm line 4252. Use of uninitialized value in bitwise and (&) at D:/Perl/lib/B/Deparse.pm line 4252. All tests successful. Files=3, Tests=24, 0 wallclock secs ( 0.00 cusr + 0.00 csys = 0.00 CPU) Reading database from D:/Documents and Settings/<username>/My Documents/<SNIP>/cover_db ---------------------------- ------ ------ ------ ------ ------ ------ ------ File stmt bran cond sub pod time total ---------------------------- ------ ------ ------ ------ ------ ------ ------ .../lib/ActivePerl/Config.pm 0.0 0.0 0.0 0.0 0.0 n/a 0.0 ...l/lib/ActiveState/Path.pm 0.0 0.0 0.0 0.0 100.0 n/a 4.8 <SNIP> blib/lib/<SNIP>/MyLib2.pm 100.0 90.0 n/a 100.0 100.0 0.0 98.5 blib/lib/<SNIP>/MyLib3.pm 100.0 90.9 100.0 100.0 100.0 0.6 98.0 Total 14.4 6.7 3.8 18.3 20.0 100.0 11.6 ---------------------------- ------ ------ ------ ------ ------ ------ ------ Writing HTML output to D:/Documents and Settings/<username>/My Documents/<SNIP>/cover_db/coverage.html ... done.

    Read the article

  • "Access violation reading location" while accessing a global vector..

    - by djzmo
    Hello there, -- First of all, I don't know whether the vector can be called as a "global vector" if I declared it under a namespace, but not in a class or function. -- I'm now writing a simple Irrlicht (http://irrlicht.sourceforge.net) wrapper for my game to make things simpler and easier, but recently I got an "Access violation reading location" error when trying to push_back a vector declared in the global scope. Here is my code so far: irrwrap.cpp: namespace irrw { //......... IrrlichtDevice *device; IVideoDriver *driver; irr::core::array<irr::video::ITexture*> TextureCollector; vector<int> TextureConnector; //......... } //.............. void irrInit(int iGraphicsDriver, int iWindowWidth, int iWindowHeight, int iScreenDepth, bool bFullScreen) { E_DRIVER_TYPE drvT; if(iGraphicsDriver == GD_SOFTWARE) drvT = EDT_SOFTWARE; else if(iGraphicsDriver == GD_D3D8) drvT = EDT_DIRECT3D8; else if(iGraphicsDriver == GD_D3D9) drvT = EDT_DIRECT3D9; else if(iGraphicsDriver == GD_OPENGL) drvT = EDT_OPENGL; //.............. irrw::device = createDevice(drvT, dimension2d<u32>(iWindowWidth, iWindowHeight), iScreenDepth, bFullScreen); irrw::driver = irrw::device->getVideoDriver(); //.................. } void irrLoadImage(irr::core::stringc szFileName, int iID, int iTextureFlag) { //........ irrw::TextureCollector.push_back(irrw::driver->getTexture(szFileName)); // the call stack pointed to this line irrw::TextureConnector.push_back(iID); } main.cpp: //......... INT WINAPI WinMain(HINSTANCE hInst, HINSTANCE, LPSTR strCmdLine, INT) { //......... irrInit(GD_OPENGL, 800, 600, 16, false); irrLoadImage("picture.jpg", 100, 1); //......... } and the error: Unhandled exception at 0x692804d6 in Game.exe: 0xC0000005: Access violation reading location 0x00000558. Now I really got no idea on how to fix the problem. Any kind of help would be appreciated :) Here are some prototypes: virtual ITexture* getTexture(const io::path& filename) = 0; typedef core::string<fschar_t> path; // under 'io' namespace typedef char fschar_t; typedef string<c8> stringc; typedef char c8; Just FYI, I am using MSVC++ 2008 EE. (CODE UPDATED)

    Read the article

  • Code golf - hex to (raw) binary conversion

    - by Alnitak
    In response to this question asking about hex to (raw) binary conversion, a comment suggested that it could be solved in "5-10 lines of C, or any other language." I'm sure that for (some) scripting languages that could be achieved, and would like to see how. Can we prove that comment true, for C, too? NB: this doesn't mean hex to ASCII binary - specifically the output should be a raw octet stream corresponding to the input ASCII hex. Also, the input parser should skip/ignore white space. edit (by Brian Campbell) May I propose the following rules, for consistency? Feel free to edit or delete these if you don't think these are helpful, but I think that since there has been some discussion of how certain cases should work, some clarification would be helpful. The program must read from stdin and write to stdout (we could also allow reading from and writing to files passed in on the command line, but I can't imagine that would be shorter in any language than stdin and stdout) The program must use only packages included with your base, standard language distribution. In the case of C/C++, this means their respective standard libraries, and not POSIX. The program must compile or run without any special options passed to the compiler or interpreter (so, 'gcc myprog.c' or 'python myprog.py' or 'ruby myprog.rb' are OK, while 'ruby -rscanf myprog.rb' is not allowed; requiring/importing modules counts against your character count). The program should read integer bytes represented by pairs of adjacent hexadecimal digits (upper, lower, or mixed case), optionally separated by whitespace, and write the corresponding bytes to output. Each pair of hexadecimal digits is written with most significant nibble first. The behavior of the program on invalid input (characters besides [a-fA-F \t\r\n], spaces separating the two characters in an individual byte, an odd number of hex digits in the input) is undefined; any behavior (other than actively damaging the user's computer or something) on bad input is acceptable (throwing an error, stopping output, ignoring bad characters, treating a single character as the value of one byte, are all OK) The program may write no additional bytes to output. Code is scored by fewest total bytes in the source file. (Or, if we wanted to be more true to the original challenge, the score would be based on lowest number of lines of code; I would impose an 80 character limit per line in that case, since otherwise you'd get a bunch of ties for 1 line).

    Read the article

  • How can I have a Makefile automatically rebuild source files that include a modified header file? (I

    - by Nicholas Flynt
    I have the following makefile that I use to build a program (a kernel, actually) that I'm working on. Its from scratch and I'm learning about the process, so its not perfect, but I think its powerful enough at this point for my level of experience writing makefiles. AS = nasm CC = gcc LD = ld TARGET = core BUILD = build SOURCES = source INCLUDE = include ASM = assembly VPATH = $(SOURCES) CFLAGS = -Wall -O -fstrength-reduce -fomit-frame-pointer -finline-functions \ -nostdinc -fno-builtin -I $(INCLUDE) ASFLAGS = -f elf #CFILES = core.c consoleio.c system.c CFILES = $(foreach dir,$(SOURCES),$(notdir $(wildcard $(dir)/*.c))) SFILES = assembly/start.asm SOBJS = $(SFILES:.asm=.o) COBJS = $(CFILES:.c=.o) OBJS = $(SOBJS) $(COBJS) build : $(TARGET).img $(TARGET).img : $(TARGET).elf c:/python26/python.exe concat.py stage1 stage2 pad.bin core.elf floppy.img $(TARGET).elf : $(OBJS) $(LD) -T link.ld -o $@ $^ $(SOBJS) : $(SFILES) $(AS) $(ASFLAGS) $< -o $@ %.o: %.c @echo Compiling $<... $(CC) $(CFLAGS) -c -o $@ $< #Clean Script - Should clear out all .o files everywhere and all that. clean: -del *.img -del *.o -del assembly\*.o -del core.elf My main issue with this makefile is that when I modify a header file that one or more C files include, the C files aren't rebuilt. I can fix this quite easily by having all of my header files be dependencies for all of my C files, but that would effectively cause a complete rebuild of the project any time I changed/added a header file, which would not be very graceful. What I want is for only the C files that include the header file I change to be rebuilt, and for the entire project to be linked again. I can do the linking by causing all header files to be dependencies of the target, but I cannot figure out how to make the C files be invalidated when their included header files are newer. I've heard that GCC has some commands to make this possible (so the makefile can somehow figure out which files need to be rebuilt) but I can't for the life of me find an actual implementation example to look at. Can someone post a solution that will enable this behavior in a makefile? EDIT: I should clarify, I'm familiar with the concept of putting the individual targets in and having each target.o require the header files. That requires me to be editing the makefile every time I include a header file somewhere, which is a bit of a pain. I'm looking for a solution that can derive the header file dependencies on its own, which I'm fairly certain I've seen in other projects.

    Read the article

< Previous Page | 630 631 632 633 634 635 636 637 638 639 640 641  | Next Page >