Search Results

Search found 7034 results on 282 pages for 'inverse match'.

Page 7/282 | < Previous Page | 3 4 5 6 7 8 9 10 11 12 13 14  | Next Page >

  • Inverse of COALESCE

    - by ercan
    Hi all, is there a function in SQL Server 2005 that returns NULL if any of the arguments (of any type) is NULL, which would saves me from writing IF a IS NULL OR b IS NULL OR c IS NULL ....

    Read the article

  • mod,prime -> inverse possible

    - by Piet
    Hi all. I was wondering if one can do the following: We have: X is a product of N-primes, thus I assume unique. C is a constant. We can assure that C is a number that is part of the N-primes or not. Whichever will work best. Thus: X mod C = Z We have Z and C and we know that X was a product of N-primes, where N is restricted lets say first 100 primes. Is there anyway we can get back X?

    Read the article

  • NHibernate cascade and inverse

    - by Kordonme
    I have three mappings as follows: public MainChapterMap() { // other properties HasMany(x => x.ClientSpecific).KeyColumn("MainChapterId"); } public MainChapterClientMap() { // other properties References(x => x.MainChapter).Column("MainChapterId"); HasMany(x => x.Details).KeyColumn("MainChapterClientId"); } public MainChapterClientDetailMap() { // other properties References(x => x.MainChapterClient).Column("MainChapterClientId"); } MainChapter has many client-specific chapters. The client-specific chapters (MainChapterClient) has many translations (MainChapterClientDetail) The dele rules should be as follow: When deleting a MainChapter Delete the MainChapterClient row Delete the MainChapterClientDetail row(s) When deleting a MainChapterClient Do NOT delete the MainChapter row Delete the MainChapterClientDetail row(s) When deleting a MainChapterClientDetail Do NOT delete the MainChapter row Do NOT delete the MainChapterClientDetail row(s) But I no matter what I end up getting this error: deleted object would be re-saved by cascade (remove deleted object from associations)[Entities.MainChapterClient#39] I'm not sure how to set up my cascades anymore. Any help are more than welcomed!

    Read the article

  • Inverse function of FormatDateTime

    - by Salvador
    i am looking an funtion to reverse any string (YYYYMDD,YY/MM/DD,YYMMDD,...) created by the function FormatDateTime to datetime. example i have a string-date in format YYYYMMDDcreated by FormatDateTime mydatestr:=FormatDateTime('YYYYMMDD',Mydate); now how i can convert mydatestr to DateTime again?

    Read the article

  • Find multiple regex in each line and skip result if one of the regex doesn't match

    - by williamx
    I have a list of variables: variables = ['VariableA', 'VariableB','VariableC'] which I'm going to search for, line by line ifile = open("temp.txt",'r') d = {} match = zeros(len(variables)) for line in ifile: emptyCells=0 for i in range(len(variables)): regex = r'('+variables[i]+r')[:|=|\(](-?\d+(?:\.\d+)?)(?:\))?' pattern_variable = re.compile(regex) match[i] = re.findall(pattern_variable, line) if match[j] == []: emptyCells = emptyCells+1 if emptyCells == 0: for k, v in match[j]: d.setdefault(k, []).append(v) The requirement is that I will only keep the lines where all the regex'es matches! I want to collect all results for each variable in a dictionary where the variable name is the key, and the value becomes a list of all matches. The code provided is only what I've found out so far, and is not working perfectly yet...

    Read the article

  • Regex to match partial words (JavaScript)

    - by nw
    I would like to craft a case-insensitive regex (for JavaScript) that matches street names, even if each word has been abbreviated. For example: n univ av should match N University Ave king blv should match Martin Luther King Jr. Blvd ne 9th should match both NE 9th St and 9th St NE Bonus points (JK) for a "replace" regex that wraps the matched text with <b> tags.

    Read the article

  • Lucene Fuzzy Match on Phrase instead of Single Word

    - by Koobz
    I'm trying to do a fuzzy match on the Phrase "Grand Prarie" (deliberately misspelled) using Apache Lucene. Part of my issue is that the ~ operator only does fuzzy matches on single word terms and behaves as a proximity match for phrases. Is there a way to do a fuzzy match on a phrase with lucene?

    Read the article

  • MySQL "OR MATCH" hangs (long pause with no answer) on multiple tables

    - by Kerry
    After learning how to do MySQL Full-Text search, the recommended solution for multiple tables was OR MATCH and then do the other database call. You can see that in my query below. When I do this, it just gets stuck in a "busy" state, and I can't access the MySQL database. SELECT a.`product_id`, a.`name`, a.`slug`, a.`description`, b.`list_price`, b.`price`, c.`image`, c.`swatch`, e.`name` AS industry, MATCH( a.`name`, a.`sku`, a.`description` ) AGAINST ( '%s' IN BOOLEAN MODE ) AS relevance FROM `products` AS a LEFT JOIN `website_products` AS b ON (a.`product_id` = b.`product_id`) LEFT JOIN ( SELECT `product_id`, `image`, `swatch` FROM `product_images` WHERE `sequence` = 0) AS c ON (a.`product_id` = c.`product_id`) LEFT JOIN `brands` AS d ON (a.`brand_id` = d.`brand_id`) INNER JOIN `industries` AS e ON (a.`industry_id` = e.`industry_id`) WHERE b.`website_id` = %d AND b.`status` = %d AND b.`active` = %d AND MATCH( a.`name`, a.`sku`, a.`description` ) AGAINST ( '%s' IN BOOLEAN MODE ) OR MATCH ( d.`name` ) AGAINST ( '%s' IN BOOLEAN MODE ) GROUP BY a.`product_id` ORDER BY relevance DESC LIMIT 0, 9 Any help would be greatly appreciated.

    Read the article

  • Algorithm to match list of regular expressions

    - by DSII
    I have two algorithmic questions for a project I am working on. I have thought about these, and have some suspicions, but I would love to hear the community's input as well. Suppose I have a string, and a list of N regular expressions (actually they are wildcard patterns representing a subset of full regex functionality). I want to know whether the string matches at least one of the regular expressions in the list. Is there a data structure that can allow me to match the string against the list of regular expressions in sublinear (presumably logarithmic) time? This is an extension of the previous problem. Suppose I have the same situation: a string and a list of N regular expressions, only now each of the regular expressions is paired with an offset within the string at which the match must begin (or, if you prefer, each of the regular expressions must match a substring of the given string beginning at the given offset). To give an example, suppose I had the string: This is a test string and the regex patterns and offsets: (a) his.* at offset 0 (b) his.* at offset 1 The algorithm should return true. Although regex (a) does not match the string beginning at offset 0, regex (b) does match the substring beginning at offset 1 ("his is a test string"). Is there a data structure that can allow me to solve this problem in sublinear time? One possibly useful piece of information is that often, many of the offsets in the list of regular expressions are the same (i.e. often we are matching the substring at offset X many times). This may be useful to leverage the solution to problem #1 above. Thank you very much in advance for any suggestions you may have!

    Read the article

  • How can I match a twitter username with angular ui router

    - by user3929999
    I need to be able to match a path like '/@someusername' with angular ui router but can't figure out the regex for it. What I have are routes like the following $stateProvider .state('home', {url:'/', templateUrl:'/template/path.html'}) .state('author', {url:'/{username:[regex-to-match-@username-here]}'}) .state('info', {url:'/:slug', templateUrl:'/template/path.html'}) .state('entry', {url:'/:type/:slug', templateUrl:'/template/path.html'}); I need a bit of regex for the 'author' route that will match @usernames. Currently, everything I try is caught by the 'entry' route.

    Read the article

  • Find last match with python regular expression

    - by SDD
    I wanto to match the last occurence of a simple pattern in a string, e.g. list = re.findall(r"\w+ AAAA \w+", "foo bar AAAA foo2 AAAA bar2) print "last match: ", list[len(list)-1] however, if the string is very long, a huge list of matches is generated. Is there a more direct way to match the second occurence of "AAAA" or should I use this workaround?

    Read the article

  • MongoDb - $match filter not working in subdocument

    - by Ranjith
    This is Collection Structure [{ "_id" : "....", "name" : "aaaa", "level_max_leaves" : [ { level : "ObjectIdString 1", max_leaves : 4, } ] }, { "_id" : "....", "name" : "bbbb", "level_max_leaves" : [ { level : "ObjectIdString 2", max_leaves : 2, } ] }] I need to find the subdocument value of level_max_leaves.level filter when its matching with given input value. And this how I tried, For example, var empLevelId = 'ObjectIdString 1' ; MyModel.aggregate( {$unwind: "$level_max_leaves"}, {$match: {"$level_max_leaves.level": empLevelId } }, {$group: { "_id": "$level_max_leaves.level", "total": { "$sum": "$level_max_leaves.max_leaves" }}}, function (err, res) { console.log(res); }); But here the $match filter is not working. I can't find out exact results of ObjectIdString 1 If I filter with name field, its working fine. like this, {$match: {"$name": "aaaa" } }, But in subdocument level its returns 0. {$match: {"$level_max_leaves.level": "ObjectIdString 1"} }, My expected result was, { "_id" : "ObjectIdString 1", "total" : 4, }

    Read the article

  • Match Anything Except a Sub-pattern

    - by Tim Lytle
    I'd like to accomplish what this (invalid I believe) regular expression tries to do: <p><a>([^(<\/a>)]+?)<\/a></p>uniquestring Essentially match anything except a closing anchor tag. Simple non-greedy doesn't help here because `uniquestring' may very well be after another distant closing anchor tag: <p><a>text I don't <tag>want</tag> to match</a></p>random data<p><a>text I do <tag>want to</tag> match</a></p>uniquestring more matches <p><a>of <tag>text I do</tag> want to match</a></p>uniquestring So I have more tag in between the anchor tags. And I'm using the presence of uniquestring to determine if I want to match the data. So a simple non-greedy ends up matching everything from the start of the data I don't want to the end of the data I do want. I know I'm edging close to the problems regular expressions (or at least my knowledge of them) aren't good at solving. I could just through the data at an HTML/XML parser, but it is just one simple(ish) search. Is there some easy way to do this that I'm just missing?

    Read the article

  • RegEx - character not before match

    - by danneth
    I understand the consepts of RegEx, but this is more or less the first time I've actually been trying to write some myself. As a part of a project, I'm attempting to parse out strings which match to a certain domain (actually an array of domains, but let's keep it simple). At first I started out with this: url.match('www.example.com') But I noticed I was also getting input like this: http://www.someothersite.com/page?ref=http://www.example.com These rows will ofcourse match for www.example.com but I wish to exclude them. So I was thinking along these lines: Only match rows that contain www.example.com, but not after a ? character. This is what I came up with: var reg = new RegExp("[^\\?]*" + url + "(\\.*)", "gi"); This does however not seem to work, any suggestions would be greatly appreciated as I fear I've used what little knowledge I yet possess in the matter.

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • Regex: Match any character (including whitespace) except a comma

    - by selecsosi
    I would like to match any character and any whitespace except comma with regex. Only matching any character except comma gives me: [^,]* but I also want to match any whitespace characters, tabs, space, newline, etc. anywhere in the string. For example, I would like to be able to match all of this up until the comma: "bla bla bla" "asdfasdfasdfasdfasdfasdf" "asdfasdfasdf", Is there a simple way to do this without knowing where the whitespace may be?

    Read the article

  • efficientcy effort: grep with a vectored pattern or match with a list of values

    - by Elad663
    I guess this is trivial, I apologize, I couldn't find how to do it. I am trying to abstain from a loop, so I am trying to vectorize the process: I need to do something like grep, but where the pattern is a vector. Another option is a match, where the value is not only the first location. For example data (which is not how the real data is, otherswise I would exploit it structure): COUNTRIES=c("Austria","Belgium","Denmark","France","Germany", "Ireland","Italy","Luxembourg","Netherlands", "Portugal","Sweden","Spain","Finland","United Kingdom") COUNTRIES_Target=rep(COUNTRIES,times=4066) COUNTRIES_Origin=rep(COUNTRIES,each=4066) Now, currently I got a loop that: var_pointer=list() for (i in 1:length(COUNTRIES_Origin)) { var_pointer[[i]]=which(COUNTRIES_Origin[i]==COUNTRS_Target) } The problem with match is that match(x=COUNTRIES_Origin,table=COUNTRIES_Target) returns a vector of the same length as COUNTRIES_Origin and the value is the first match, while I need all of them. The issue with grep is that grep(pattern=COUNTRIES_Origin,x=COUNTRIES_Target) is the given warning: Warning message: In grep(pattern = COUNTRIES_Origin, x = COUNTRIES_Target) : argument 'pattern' has length > 1 and only the first element will be used Any suggestions?

    Read the article

  • iTunes Keeps Crashing After Activating iTunes Match

    - by David
    This morning I activated iTunes Match. There were over 20,000 songs to scan and upload, so I walked away and came back to it this afternoon. Upon returning, I found that iTunes had crashed. Now any time I try to open iTunes, the window displays but within a second (seemingly as soon as it tries to access iTunes Match, but I have no way of confirming that) it crashes. So I effectively can't get iTunes to run. Has this happened for anybody else? Does anybody have any suggestions for fixing or even diagnosing this?

    Read the article

  • OpenBSD pf 'match in all scrub (no-df)' causes HTTPS to be unreachable on mobile network

    - by Frank ter V.
    First of all: excuse me for my poor usage of the English language. For several years I'm experiencing problems with the 'match in all scrub (no-df)' rule in pf. I can't find out what's happening here. I'll try to be clear and simple. The pf.conf has been extremely shortened for this forum posting. Here is my pf.conf: set skip on lo0 match in all scrub (no-df) block all block in quick from urpf-failed pass in on em0 proto tcp from any to 213.125.xxx.xxx port 80 synproxy state pass in on em0 proto tcp from any to 213.125.xxx.xxx port 443 synproxy state pass out on em0 from 213.125.xxx.xxx to any modulate state HTTP and HTTPS are working fine. Until the moment a customer in France (Wanadoo DSL) couldn't view HTTPS pages! I blamed his provider and did no investigation on that problem. But then... I bought an Android Samsung Galaxy SII (Vodafone) to monitor my servers. Hours after I walked out of the telephone store: no HTTPS-connections on my server! I thought my servers were down, drove back to the office very fast. But they were up. I discovered that disabling the rule match in all scrub (no-df) solves the problem. Android phone (Vodafone NL) and Wanadoo DSL FR are now OK on HTTPS. But now I don't have any scrubbing anymore. This is not what I want. Does anyone here understand what is going on? I don't. Enabling scrubbing causes HTTPS webpages not to be loaded on SOME ISP's, but not all. In systat, I strangely DO see a state created and packets received from those ISP's... Still confused. I'm using OpenBSD 5.1/amd64 and OpenBSD 5.0/i386. I have two ISP's at my office (one DSL and one cable). Affects both. This can be reproduced quite easily. I hope someone has experience with this problem. Greetings, Frank

    Read the article

  • Installing mysql-devel to match MySQL version

    - by markxi
    I'm running MySQL 5.1.52 on CentOS 4.6 and I'm trying to install mysql-devel to match my MySQL version. If I do yum install mysql-devel it wants to upgrade MySQL to 5.1.58, yet if I do yum search mysql-devel, in addition to finding 5.1.58, I get a match for: 5.1.52-jason.1 .. utterramblings .. Matched from: mysql-devel Why is yum trying to install an updated version and is there any way to get it to install the correct version without the need to upgrade MySQL? I'd appreciate any help.

    Read the article

< Previous Page | 3 4 5 6 7 8 9 10 11 12 13 14  | Next Page >