Search Results

Search found 7034 results on 282 pages for 'inverse match'.

Page 9/282 | < Previous Page | 5 6 7 8 9 10 11 12 13 14 15 16  | Next Page >

  • PHP ssh2_fingerprint() does not match ssh-keygen -lf id_rsa.pub

    - by Justin
    I am using the lib ssh2 module with PHP and calling the function ssh2_fingerprint() to get the keys fingerprint. According to all resources on the internet, I can get the fingerprint of a public key by executing: ssh-keygen -lf id_rsa.pub Which outputs something like: 2048 d4:41:3b:45:00:49:4e:fc:2c:9d:3a:f7:e6:6e:bf:e7 id_rsa.pub (RSA) However, when I call ssh2_fingerprint($connection, SSH2_FINGERPRINT_HEX) in PHP with the same public key I get: dddddba52352e5ab95711c10fdd56f43 Shouldn't they match? What am I missing?

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • How to match against multiple value possiblities in Excel

    - by Henno
    I have list of person names in column A. I want to display "1" in column B for names which end with either "e" or "i" or "n". If there would be only one match to test against, I would write something like: =IF( MID(A1,FIND(" ",B1)-1,1) = "e", "1", "0") In PHP I would solve that like this: echo in_array( $names[$row_number], array('e', 'i', 'n') ) ? '1' : '0'; What formula should I use in column B in Excel?

    Read the article

  • perl like sed + match word and replace

    - by yael
    Is it possible to change the perl syntax (described down) to replace "a" string in the line that match "param1" as the following example: more test param1=a a param2=b b aa bb a b aa bb [root@localhost tmp]# perl -pe "s/\b$a\b/$b/g unless /^#/" test param1=asdfghj asdfghj (this line shuld not be chaged) param2=b b aa bb a b aa bb [root@localhost tmp]# The right output param1=asdfghj a param2=b b aa bb a b aa bb [root@localhost tmp]#

    Read the article

  • XSL using apply templates and match instead of call template

    - by AdRock
    I am trying to make the transition from using call-template to using applay templates and match but i'm not getting any data displayed only what is between the volunteer tags. When i use call template it works fine but it was suggested that i use applay-templates and match and not it doesn't work Any ideas how to make this work? I can then applay it to all my stylesheets. <?xml version="1.0" encoding="ISO-8859-1"?> <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform"> <xsl:key name="volunteers-by-region" match="volunteer" use="region" /> <xsl:template name="hoo" match="/"> <html> <head> <title>Registered Volunteers</title> <link rel="stylesheet" type="text/css" href="volunteer.css" /> </head> <body> <h1>Registered Volunteers</h1> <h3>Ordered by the username ascending</h3> <h3>Grouped by the region</h3> <xsl:for-each select="folktask/member[user/account/userlevel='2']"> <xsl:for-each select="volunteer[count(. | key('volunteers-by-region', region)[1]) = 1]"> <xsl:sort select="region" /> <xsl:for-each select="key('volunteers-by-region', region)"> <xsl:sort select="folktask/member/user/personal/name" /> <div class="userdiv"> <xsl:apply-templates/> <!--<xsl:call-template name="member_userid"> <xsl:with-param name="myid" select="../user/@id" /> </xsl:call-template> <xsl:call-template name="member_name"> <xsl:with-param name="myname" select="../user/personal/name" /> </xsl:call-template>--> </div> </xsl:for-each> </xsl:for-each> </xsl:for-each> <xsl:if test="position()=last()"> <div class="count"><h2>Total number of volunteers: <xsl:value-of select="count(/folktask/member/user/account/userlevel[text()=2])"/></h2></div> </xsl:if> </body> </html> </xsl:template> <xsl:template match="folktask/member"> <xsl:apply-templates select="user/@id"/> <xsl:apply-templates select="user/personal/name"/> </xsl:template> <xsl:template match="user/@id"> <div class="heading bold"><h2>USER ID: <xsl:value-of select="." /></h2></div> </xsl:template> <xsl:template match="user/personal/name"> <div class="small bold">NAME:</div> <div class="large"><xsl:value-of select="." /></div> </xsl:template> </xsl:stylesheet> and my xml file <folktask xmlns:xs="http://www.w3.org/2001/XMLSchema-instance" xs:noNamespaceSchemaLocation="folktask.xsd"> <member> <user id="1"> <personal> <name>Abbie Hunt</name> <sex>Female</sex> <address1>108 Access Road</address1> <address2></address2> <city>Wells</city> <county>Somerset</county> <postcode>BA5 8GH</postcode> <telephone>01528927616</telephone> <mobile>07085252492</mobile> <email>[email protected]</email> </personal> <account> <username>AdRock</username> <password>269eb625e2f0cf6fae9a29434c12a89f</password> <userlevel>4</userlevel> <signupdate>2010-03-26T09:23:50</signupdate> </account> </user> <volunteer id="1"> <roles></roles> <region>South West</region> </volunteer> </member> <member> <user id="2"> <personal> <name>Aidan Harris</name> <sex>Male</sex> <address1>103 Aiken Street</address1> <address2></address2> <city>Chichester</city> <county>Sussex</county> <postcode>PO19 4DS</postcode> <telephone>01905149894</telephone> <mobile>07784467941</mobile> <email>[email protected]</email> </personal> <account> <username>AmbientExpert</username> <password>8e64214160e9dd14ae2a6d9f700004a6</password> <userlevel>2</userlevel> <signupdate>2010-03-26T09:23:50</signupdate> </account> </user> <volunteer id="2"> <roles>Van Driver</roles> <region>South Central</region> </volunteer> </member> <member> <user id="3"> <personal> <name>Skye Saunders</name> <sex>Female</sex> <address1>31 Anns Court</address1> <address2></address2> <city>Cirencester</city> <county>Gloucestershire</county> <postcode>GL7 1JG</postcode> <telephone>01958303514</telephone> <mobile>07260491667</mobile> <email>[email protected]</email> </personal> <account> <username>BigUndecided</username> <password>ea297847f80e046ca24a8621f4068594</password> <userlevel>2</userlevel> <signupdate>2010-03-26T09:23:50</signupdate> </account> </user> <volunteer id="3"> <roles>Scaffold Erector</roles> <region>South West</region> </volunteer> </member> </folktask>

    Read the article

  • Having trouble with match wildcards in array

    - by Senthil
    I've a master text file and exceptions file and I want to match all the words in exception file with master file and increase counter, but the trick is with wildcards. I'm able to do without wildcards with this: words = %w(aaa aab acc ccc AAA) stop = %q(/aa./) words.each do |x| if x.match(/aa./) puts "yes for #{x}" else puts "no for #{x}" end end = yes for aaa yes for aab no for acc no for ccc yes for AAA Also which would be the best way to go about this, using arrays or some other way. Edit: Sorry for the confusion. Yes stop has multiple wildcards and I want to match all words based on those wildcards. words = %w(aaa aab acc ccc AAA) stop = %q(aa* ac* ab*) Thanks

    Read the article

  • How to use regex to match ASTERISK in awk

    - by Ken Chen
    I'm stil pretty new to regular expression and just started learning to use awk. What I am trying to accomplish is writing a ksh script to read-in lines from text, and and for every lines that match the following: *RECORD 0000001 [some_serial_#] to replace $2 (i.e. 000001) with a different number. So essentially the script read in batch record dump, and replace the record number with date+record#, and write to separate file. So this is what I'm thinking the format should be: awk 'match($0,"/*FTR")!=0{$2="$DATE-n++"; print $0} match($0,"/*FTR")==0{print $0}' $BATCH > $OUTPUT but obviously "/*FTR" is not going to work, and I'm not sure if changing $2 and then write the whole line is the correct way to do this. So I am in need of some serious enlightenment.

    Read the article

  • Match d-M-Y with javascript regex how?

    - by bakerjr
    Hi, my date formatting in PHP is d-M-Y and I'm trying to match the dates with a javascript regex: s.match(new RegExp(/^(\d{1,2})(\-)(\w{3})(\-)(\d{4})$/)) To be used with the jQuery plugin, tablesorter. The problem is it's not working and I'm wondering why not. I tried removing the dashes in my date() formatting (d M Y) and tried the ff and it worked: s.match(new RegExp(/^\d{1,2}[ ]\w{3}[ ]\d{4}$/)); My question is what is the correct regex if I'm using dashes on PHP's date() i.e. d-M-Y? Thanks!

    Read the article

  • regex to match postgresql bytea

    - by filiprem
    In PostgreSQL, there is a BLOB datatype called bytea. It's just an array of bytes. bytea literals are output in the following way: '\\037\\213\\010\\010\\005`Us\\000\\0001.fp3\'\\223\\222%' See PostgreSQL docs for full definition of the format. I'm trying to construct a Perl regular expression which will match any such string. It should also match standard ANSI SQL string literals, like 'Joe', 'Joe''s Mom', 'Fish Called ''Wendy''' It should also match backslash-escaped variant: 'Joe\'s Mom', . First aproach (shown below) works only for some bytea representations. s{ ' # Opening apostrophe (?: # Start group [^\\\'] # Anything but a backslash or an apostrophe | # or \\ . # Backslash and anything | # or \'\' # Double apostrophe )* # End of group ' # Closing apostrophe }{LITERAL_REPLACED}xgo; For other (longer ones, with many escaped apostrophes, Perl gives such warning: Complex regular subexpression recursion limit (32766) exceeded at ./sqa.pl line 33, < line 1. So I am looking for a better (but still regex-based) solution, it probably requires some regex alchemy (avoiding backreferences and all).

    Read the article

  • Strange behavior: Dynamic expressions with RegExp Object in RegExp.match (Javascript)

    - by NeDark
    I have detect a strange behavior in regexps created with the RegExp object: With this code: var exp1 = /./; var exp2 = new RegExp('.'); ? var test1 = exp1.test('large\n\ntext..etc.'); var test2 = exp2.test('large\n\ntext..etc.'); ? var match1 = 'large\n\ntext..etc.'.match(exp1); var match2 = 'large\n\ntext..etc.'.match(exp2); ...the result is: test1 = true test2 = true ? match1 = 'l' (first match) match2 = null With the regexp maked with the regexp object from a string it finds nothing... Why does this happends? Thanks!!

    Read the article

  • How to regex match text with different endings?

    - by Mint
    This is what I have at the moment. <h2>header</h2>\n +<p>(.*)<br />|</p> ^ that is a tab space, didn't know if there was a better way to represent one or more (it seems to work) Im trying to match the 'bla bla.' text, but my current regex doesn't quite work, it will match most of the line, but I want it to match the first <h2>Information</h2> <p>bla bla.<br /><br /><a href="http://www.google.com">google</a><br /> or <h2>Information</h2> <p>bla bla.</p> other code... Oh and my php code: preg_match('#h2>header</h2>\n +<p>(.*)<br />|</p>#', $result, $postMessage);

    Read the article

  • Regex: How to match a unix datestamp?

    - by Jono
    I'd like to be able to match this entire line (to highlight this sort of thing in vim): Fri Mar 18 14:10:23 ICT 2011. I'm trying to do it by finding a line that contains ICT 20 (first two digits of the year of the year), like this: syntax match myDate /^*ICT 20*$/, but I can't get it working. I'm very new to regex. Basically what I want to say: find a line that contains "ICT 20" and can have anything on either side of it, and match that whole line. Is there an easy way to do this?

    Read the article

  • Fastest PHP Routine To Match Words

    - by Volomike
    What is the fastest way in PHP to take a keyword list and match it to a search result (like an array of titles) for all words? For instance, if my keyword phrase is "great leather shoes", then the following titles would be a match... Get Some Really Great Leather Shoes Leather Shoes Are Great Great Day! Those Are Some Cool Leather Shoes! Shoes, Made of Leather, Can Be Great ...while these would not be a match: Leather Shoes on Sale Today! You'll Love These Leather Shoes Greatly Great Shoes Don't Come Cheap I imagine there's some trick with array functions or a RegEx (Regular Expression) to achieve this rapidly.

    Read the article

  • local match kickoff time

    - by Usagi Dreamy
    I'm working on a sports website and need to convert the server's match start time to local match start time. After much googling, I figured the fastest and most accurate way is to get the GMT offset value in JavaScript. The trouble is, I can't pass the GMT offset value to PHP. I've tried using both the PHP session and cookie variables, but both are always empty. The website doesn't require a user account, so there isn't any stored GMT value in the database. I'm trying to auto-detect each user's local timezone every time he/she visits the website, and then calculate the local match start time based on the timezone offset. Can someone please advise me? Thanks.

    Read the article

  • Regex to match pattern with subdomain in java gives issues

    - by Ramesh
    I am trying to match the sub domain of an url using http://([a-z0-9]*.)?example.com/.* which works perfectly for these cases. http://example.com/index.html http://test.example.com/index.html http://test1.example.com/index.html http://www.example.com/122/index.html But the problem is it matches for this URL too. http://www.test.com/?q=http://example.com/index.html if an URL with another domain has the URL in path it matches.Can any one tell me how to match for current domain only. getting the host will work but i need to match full URL.

    Read the article

  • Regex to *not* match any characters

    - by Erick
    I know it is quite some weird goal here but for a quick and dirty fix for one of our system we do need to not filter any input and let the corruption go into the system. My current regex for this is "\^.*" The problem with that is that it does not match characters as planned ... but for one match it does work. The string that make it not work is ^@jj (basically anything that has ^ ... ). What would be the best way to not match any characters now ? I was thinking of removing the \  but only doing this will transform the "not" into a "start with" ...

    Read the article

  • regex to match specific html tags

    - by Rco8786
    I need to match html tags(the whole tag), based on the tag name. For script tags I have this: <script.+src=.+(\.js|\.axd).+(</script>|>) It correctly matches both tags in the following html: <script src="Scripts/JScript1.js" type="text/javascript" /> <script type="text/javascript" src="Scripts/JScript2.js" /> However, when I do link tags with the following: <link.+href=.+(\.css).+(</link>|>) It matches all of this at once(eg it returns one match containing both items): <link href="Stylesheets/StyleSheet1.css" rel="Stylesheet" type="text/css" /> <link href="Stylesheets/StyleSheet2.css" rel="Stylesheet" type="text/css" /> What am I missing here? The regexes are essentially identical except for the text to match to? Also, I know that regex is not a great tool for HTML parsing...I will probably end up using the HtmlAgilityPack in the end, but this is driving me nuts and I want an answer if only for my own mental health!

    Read the article

  • Couldn't match expected type - Haskell Code

    - by wvyar
    I'm trying to learn Haskell, but the small bit of sample code I tried to write is running into a fairly large amount of "Couldn't match expected type" errors. Can anyone give me some guidance as to what I'm doing wrong/how I should go about this? These are the errors, but I'm not really sure how I should be writing my code. toDoSchedulerSimple.hs:6:14: Couldn't match expected type `[t0]' with actual type `IO String' In the return type of a call of `readFile' In a stmt of a 'do' block: f <- readFile inFile In the expression: do { f <- readFile inFile; lines f } toDoSchedulerSimple.hs:27:9: Couldn't match expected type `[a0]' with actual type `IO ()' In the return type of a call of `putStr' In a stmt of a 'do' block: putStr "Enter task name: " In the expression: do { putStr "Enter task name: "; task <- getLine; return inFileArray : task } toDoSchedulerSimple.hs:34:9: Couldn't match expected type `IO ()' with actual type `[a0]' In a stmt of a 'do' block: putStrLn "Your task is: " ++ (inFileArray !! i) In the expression: do { i <- randomRIO (0, (length inFileArray - 1)); putStrLn "Your task is: " ++ (inFileArray !! i) } In an equation for `getTask': getTask inFileArray = do { i <- randomRIO (0, (length inFileArray - 1)); putStrLn "Your task is: " ++ (inFileArray !! i) } toDoSchedulerSimple.hs:41:9: Couldn't match expected type `[a0]' with actual type `IO ()' In the return type of a call of `putStr' In a stmt of a 'do' block: putStr "Enter the task you would like to end: " In the expression: do { putStr "Enter the task you would like to end: "; task <- getLine; filter (endTaskCheck task) inFileArray } toDoSchedulerSimple.hs:60:53: Couldn't match expected type `IO ()' with actual type `[String] -> IO ()' In a stmt of a 'do' block: schedulerSimpleMain In the expression: do { (getTask inFileArray); schedulerSimpleMain } In a case alternative: "get-task" -> do { (getTask inFileArray); schedulerSimpleMain } This is the code itself. I think it's fairly straightforward, but the idea is to run a loop, take input, and perform actions based off of it by calling other functions. import System.Random (randomRIO) import Data.List (lines) initializeFile :: [char] -> [String] initializeFile inFile = do f <- readFile inFile let parsedFile = lines f return parsedFile displayHelp :: IO() displayHelp = do putStrLn "Welcome to To Do Scheduler Simple, written in Haskell." putStrLn "Here are some commands you might find useful:" putStrLn " 'help' : Display this menu." putStrLn " 'quit' : Exit the program." putStrLn " 'new-task' : Create a new task." putStrLn " 'get-task' : Randomly select a task." putStrLn " 'end-task' : Mark a task as finished." putStrLn " 'view-tasks' : View all of your tasks." quit :: IO() quit = do putStrLn "We're very sad to see you go...:(" putStrLn "Come back soon!" createTask :: [String] -> [String] createTask inFileArray = do putStr "Enter task name: " task <- getLine return inFileArray:task getTask :: [String] -> IO() getTask inFileArray = do i <- randomRIO (0, (length inFileArray - 1)) putStrLn "Your task is: " ++ (inFileArray !! i) endTaskCheck :: String -> String -> Bool endTaskCheck str1 str2 = str1 /= str2 endTask :: [String] -> [String] endTask inFileArray = do putStr "Enter the task you would like to end: " task <- getLine return filter (endTaskCheck task) inFileArray viewTasks :: [String] -> IO() viewTasks inFileArray = case inFileArray of [] -> do putStrLn "\nEnd of tasks." _ -> do putStrLn (head inFileArray) viewTasks (tail inFileArray) schedulerSimpleMain :: [String] -> IO() schedulerSimpleMain inFileArray = do putStr "SchedulerSimple> " input <- getLine case input of "help" -> displayHelp "quit" -> quit "new-task" -> schedulerSimpleMain (createTask inFileArray) "get-task" -> do (getTask inFileArray); schedulerSimpleMain "end-task" -> schedulerSimpleMain (endTask inFileArray) "view-tasks" -> do (viewTasks inFileArray); schedulerSimpleMain _ -> do putStrLn "Invalid input."; schedulerSimpleMain main :: IO() main = do putStr "What is the name of the schedule? " sName <- getLine schedulerSimpleMain (initializeFile sName) Thanks, and apologies if this isn't the correct place to be asking such a question.

    Read the article

  • Using varible in re.match in python

    - by screwuphead
    I am trying to create an array of things to match in a description line. So I cant ignore them later on in my script. Below is a sample script that I have been working on, on the side. Basically I am trying to take a bunch of strings and match it against a bunch of other strings. AKA: asdf or asfs or wrtw in string = true continue with script if not print this. import re ignorelist = ['^test', '(.*)set'] def guess(a): for ignore in ignorelist: if re.match(ignore, a): return('LOSE!') else: return('WIN!') a = raw_input('Take a guess: ') print guess(a) Thanks

    Read the article

  • regular expression match does not work

    - by Carlos_Liu
    I have a string ABCD:10,20,,40;1/1;1/2,1/3,1/4 I want to split the string into the following parts: ABCD -- splited by : 10,20,,40 -- splited by ; 1/1 1/2,1/3,1/4 Why the following regular expression does not work for me ? string txt = @"ABCD:10,20,,40;1/1;1/2,1/3,1/4"; Regex reg = new Regex(@"\b(?<test>\w+):(?<com>\w+);(?<p1>\w+);(?<p2>\w+)"); Match match = reg.Match(txt);

    Read the article

  • Regex: Match opening/closing chars with spaces

    - by Israfel
    I'm trying to complete a regular expression that will pull out matches based on their opening and closing characters, the closest I've gotten is ^(\[\[)[a-zA-Z.-_]+(\]\]) Which will match a string such as "[[word1]]" and bring me back all the matches if there is more than one, The problem is I want it to pick up matchs where there may be a space in so for example "[[word1 word2]]", now this will work if I add a space into my pattern above however this pops up a problem that it will only get one match for my entire string so for example if I have a string "Hi [[Title]] [[Name]] [[surname]], How are you" then the match will be "[[Title]] [[Name]] [[surname]]" rather than 3 matches "[[Title]]", "[[Name]]", "[[surname]]". I'm sure I'm just a char or two away in the Regex but I'm stuck, How can I make it return the 3 matches. Thanks

    Read the article

  • ImgBurn fails to burn data CD-R disk due to "Layouts do not match" error

    - by 0xAether
    I have a reoccurring problem with the program ImgBurn. Whenever I try and burn anything to a CD-R using ImgBurn it burns just fine, except for when I go and verify the disk. It tells me that the "Layouts do not match". Windows 7 shows the disk as completely blank. Although, I see on the bottom of the disk it has been written to. I can burn ISO files to DVD-R's just fine. This only seems to happen with CD-R's. The CD-R's I'm using are Memorex Cool Colors 52x CD-R's. I have looked on Google, and it seems like I'm not the only one this happens to. Unfortunately, no one is able to provide an explanation. I have included the log file from the last CD I just burnt. If you need anything else to better diagnose this problem, I will gladly provide it. ; //****************************************\\ ; ImgBurn Version 2.5.7.0 - Log ; Monday, 19 November 2012, 16:11:57 ; \\****************************************// ; ; I 16:04:55 ImgBurn Version 2.5.7.0 started! I 16:04:55 Microsoft Windows 7 Ultimate x64 Edition (6.1, Build 7601 : Service Pack 1) I 16:04:55 Total Physical Memory: 4,156,380 KB - Available: 3,317,144 KB I 16:04:55 Initialising SPTI... I 16:04:55 Searching for SCSI / ATAPI devices... I 16:04:56 -> Drive 1 - Info: Optiarc DVD RW AD-7560S SH03 (D:) (SATA) I 16:04:56 Found 1 DVD±RW/RAM! I 16:05:37 Operation Started! I 16:05:37 Source File: C:\Users\Aaron\Desktop\VMware Workstation 9.iso I 16:05:37 Source File Sectors: 223,057 (MODE1/2048) I 16:05:37 Source File Size: 456,820,736 bytes I 16:05:37 Source File Volume Identifier: VMwareWorksta9 I 16:05:37 Source File Volume Set Identifier: 20121119_2102 I 16:05:37 Source File File System(s): ISO9660, Joliet I 16:05:37 Destination Device: [1:0:0] Optiarc DVD RW AD-7560S SH03 (D:) (SATA) I 16:05:37 Destination Media Type: CD-R (Disc ID: 97m17s06f, Moser Baer India) I 16:05:37 Destination Media Supported Write Speeds: 10x, 16x, 20x, 24x I 16:05:37 Destination Media Sectors: 359,847 I 16:05:37 Write Mode: CD I 16:05:37 Write Type: SAO I 16:05:37 Write Speed: 6x I 16:05:37 Lock Volume: Yes I 16:05:37 Test Mode: No I 16:05:37 OPC: No I 16:05:37 BURN-Proof: Enabled W 16:05:37 Write Speed Miscompare! - MODE SENSE: 1,764 KB/s (10x), GET PERFORMANCE: 11,080 KB/s (63x) W 16:05:37 Write Speed Miscompare! - MODE SENSE: 1,764 KB/s (10x), GET PERFORMANCE: 11,080 KB/s (63x) W 16:05:37 Write Speed Miscompare! - MODE SENSE: 1,764 KB/s (10x), GET PERFORMANCE: 11,080 KB/s (63x) W 16:05:37 Write Speed Miscompare! - MODE SENSE: 1,764 KB/s (10x), GET PERFORMANCE: 11,080 KB/s (63x) W 16:05:37 Write Speed Miscompare! - MODE SENSE: 1,764 KB/s (10x), GET PERFORMANCE: 11,080 KB/s (63x) W 16:05:37 Write Speed Miscompare! - Wanted: 1,058 KB/s (6x), Got: 1,764 KB/s (10x) / 11,080 KB/s (63x) W 16:05:37 The drive only supports writing these discs at 10x, 16x, 20x, 24x. I 16:05:38 Filling Buffer... (80 MB) I 16:05:40 Writing LeadIn... I 16:06:07 Writing Session 1 of 1... (1 Track, LBA: 0 - 223056) I 16:06:07 Writing Track 1 of 1... (MODE1/2048, LBA: 0 - 223056) I 16:11:00 Synchronising Cache... I 16:11:18 Exporting Graph Data... I 16:11:18 Graph Data File: C:\Users\Aaron\AppData\Roaming\ImgBurn\Graph Data Files\Optiarc_DVD_RW_AD-7560S_SH03_MONDAY-NOVEMBER-19-2012_4-05_PM_97m17s06f_6x.ibg I 16:11:18 Export Successfully Completed! I 16:11:18 Operation Successfully Completed! - Duration: 00:05:41 I 16:11:18 Average Write Rate: 1,522 KB/s (10.1x) - Maximum Write Rate: 1,544 KB/s (10.3x) I 16:11:18 Cycling Tray before Verify... W 16:11:23 Waiting for device to become ready... I 16:11:47 Device Ready! E 16:11:47 CompareImageFileLayouts Failed! - Session Count Not Equal (1/0) E 16:11:47 Verify Failed! - Reason: Layouts do not match. I 16:11:57 Close Request Acknowledged I 16:11:57 Closing Down... I 16:11:57 Shutting down SPTI... I 16:11:57 ImgBurn closed!

    Read the article

  • Regex to check if exact string exists including #

    - by Jayrox
    New question As suggested by Asaph in previous question: Regex to check if exact string exists I am looking for a way to check if an exact string match exists in another string using Regex or any better method suggested. I understand that you tell regex to match a space or any other non-word character at the beginning or end of a string. However, I don't know exactly how to set it up. Search String: #t String 1: Hello World, Nice to see you! #t String 2: Hello World, Nice to see you! String 3: #T Hello World, Nice to see you! I would like to use the search string and compare it to String 1, String 2 and String 3 and only get a positive match from String 1 and String 3 but not from String 2. Requirements: Search String may be at any character position in the Subject. There may or may not be a white-space character before or after it. I do not want it to match if it is part of another string; such as part of a word. For the sake of this question: I think I would do this using this pattern: /\b\#t\b/gi However, this is not returning the results as I would have expected. I am able to find the exact matches for normal strings (strings where # isn't present) using: /\b{$search_string}\b/gi Additional info: this will be used in PHP 5

    Read the article

  • Regex to check if exact string exists

    - by Jayrox
    I am looking for a way to check if an exact string match exists in another string using Regex or any better method suggested. I understand that you tell regex to match a space or any other non-word character at the beginning or end of a string. However, I don't know exactly how to set it up. Search String: t String 1: Hello World, Nice to see you! t String 2: Hello World, Nice to see you! String 3: T Hello World, Nice to see you! I would like to use the search string and compare it to String 1, String 2 and String 3 and only get a positive match from String 1 and String 3 but not from String 2. Requirements: Search String may be at any character position in the Subject. There may or may not be a white-space character before or after it. I do not want it to match if it is part of another string; such as part of a word. For the sake of this question: I think I would do this using this pattern: /\bt\b/gi /\b{$search_string}\b/gi Does this look right? Can it be made better? Any situations where this pattern wouldn't work? Additional info: this will be used in PHP 5

    Read the article

< Previous Page | 5 6 7 8 9 10 11 12 13 14 15 16  | Next Page >