Search Results

Search found 3993 results on 160 pages for 'broken pipe'.

Page 75/160 | < Previous Page | 71 72 73 74 75 76 77 78 79 80 81 82  | Next Page >

  • How to configure Linux to act as a Bluetooth RFCOMM SPP server?

    - by regulatre
    I'm writing a phone app for Android that connects to a bluetooth RFCOMM device in my car. My phone app talks AT commands with it. For development work, I often need to communicate with the device to try different commands and things. My neighbors are starting to think I'm weird because I sit in my car for hours on end with my laptop screen shining on my face, typing away like a script kiddie. I'd much rather configure one of my many Linux servers to act as a bluetooth RFCOMM device and allow me to connect to it (indoors, while I sit on my couch). I imagine I have to start with something like sdptool add SP But then what? I'm perfectly happy writing a perl app to handle the I/O, but I just don't know how to make the bluez stack accept connections and subsequently pipe that stream to a perl app.

    Read the article

  • Routing traffic to a specific NIC in Windows

    - by Stoicpoet
    I added a 10GB NIC to a SQL server which is connected over to a backend storage using ISCSI. I would like to force traffic going to a certain IP address/host to use the 10gb NIC, while all other traffic should continue to use the 1GB NIC. The 10gb nic is configured using a private network. So far I have added a entry in the host file to the host I want to go over the private network and when I ping the host, it does return the private IP, but I'm still finding traffic going to the 1gb pipe. How can I force all traffic to this host to use the 10gb interface? Would the best approach be a static route? 160.205.2.3 is the IP to the 1gb host, I actually want to the traffic to route over an interface assigned 172.31.3.2, which is also defined as Interface 22. That said, would this work? route add 160.205.2.3 mask 255.255.255.255 172.31.3.2 if 22

    Read the article

  • How to manage SOAP requests to a pool of VM each listening on a HTTP port with a priority value in these requests?

    - by sputnick
    I have a front SOAP web-server under Linux. It will have to communicate with Windows Servers VM listening each on a HTTP port, for a HTTP POST request. The chosen VM should return a report of the task to the SOAP client. In the SOAP requests, there's a special variable : the priority of the request (kind of SLA), and my question is coming right now : I think of using a ha software (nginx, HAProxy, HeartBeat...) that can manage priority in this point of view. Is it relevant or do you think I need to implement a queue by myself with some specific developments? Ex: I have a SOAP requests with low priority in the pipe : the weight priority for these VM should be decreased if I have high priority SOAP requests at the same time. Any clue will be really appreciated.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Under *nix, how can I find a string within a file within a directory ?

    - by roberto
    Hi all. I'm using ubuntu linux, and I use bash from with a terminal emulator every day for many tasks. I would like to know how to find a string or a substring within a file that is within a particular directory. If I was knew the file which contained my target substring, I would just cat the file and pipe it through grep, thus: cat file | grep mysubstring But in this case, the pesky substring could be anywhere within a known directory. How do I hunt down my substring ?

    Read the article

  • Improve efficiency when using parallel to read from compressed stream

    - by Yoga
    Is another question extended from the previous one [1] I have a compressed file and stream them to feed into a python program, e.g. bzcat data.bz2 | parallel --no-notice -j16 --pipe python parse.py > result.txt The parse.py can read from stdin continusuoly and print to stdout My ec2 instance is 16 cores but from the top command it is showing 3 to 4 load average only. From the ps, I am seeing a lot of stuffs like.. sh -c 'dd bs=1 count=1 of=/tmp/7D_YxccfY7.chr 2>/dev/null'; I know I can improve using the -a in.txtto improve performance, but with my case I am streaming from bz2 (I cannot exact it since I don't have enought disk space) How to improve the efficiency for my case? [1] Gnu parallel not utilizing all the CPU

    Read the article

  • How to avoid Remove-Item PowerShell errors "process cannot access the file"?

    - by Michael Freidgeim
    We are using TfsDeployer and PowerShell script to remove the folders ising Remove-Item before deployment of a new version. Sometimes the PS script failed with the error Remove-Item : Cannot remove item Services\bin: The process cannot access the file Services\bin' because it is being used by another proc Get-ChildItem -Path $Destination -Recurse | Remove-Item <<<< -force -recurse + CategoryInfo : WriteError: (C:\Program File..\Services\bin:DirectoryInfo) [Remove-Item], IOException FullyQualifiedErrorId : RemoveFileSystemItemIOError,Microsoft.PowerShell.Commands.RemoveItemCommand I’ve tried to follow the answer from PowerShell remove force to pipe get-childitem -recurse into remove-item. get-childitem * -include *.csv -recurse | remove-item ,but the error still happens periodically. We are using unlocker to manually kill locking application, (it’s usually w3wp), but I prefer to find automated solution. Another (not ideal) option is to-suppress-powershell-errors get-childitem -recurse -force -erroraction silentlycontinue Any suggestions are welcome.

    Read the article

  • Searching Multiple Terms

    - by nevets1219
    I know that grep -E 'termA|termB' files allows me to search multiple files for termA OR termB. What I would like to do instead is search for termA AND termB. They do not have to be on the same line as long as the two terms exists within the same file. Essentially a "search within result" feature. I know I can pipe the results of one grep into another but that seems slow when going over many files. grep -l "termA" * | xargs grep -l "termB" | xargs grep -E -H -n --color "termA|termB" Hopefully the above isn't the only way to do this. It would be extra nice if this could work on Windows (have cygwin) and Linux. I don't mind installing a tool to perform this task.

    Read the article

  • Problem accessing MICROSOFT##SSEE database (Error: 18456, Severity: 14, State: 16.)

    - by Philipp Schmid
    After an unexpected server shutdown due to a power failure, I can no longer connect to the internal windows database MICROSOFT##SSEE which is hosting Central Admin for my SBS 2008 server. The log shows: Error: 18456, Severity: 14, State: 16. Login failed for user 'NT AUTHORITY\NETWORK SERVICE'. [CLIENT: <named pipe>] I've tried to connect using the SQL Management studio (connecting to .pipemssql$microsoft##sseesqlquery) but no luck. The SQL Server Configuration Manager doesn't show a entry for 'Protocols for MICROSOFT##SSEE' (but shows it for 2 other database hosted on the same SQL server 2005 Express edition. I have tried to restore the master.ldf and mastlog.log files from a backup, but the issue persists.

    Read the article

  • Enter response once prompt returns?

    - by mjb
    It's neither a secure idea nor one I'd recommend elsewhere, but I have a situation when occasionally it takes a while for my Ansible ad-hoc command to respond. I'd love to pipe or args or whatever is needed to push the required text into the prompt so I can walk away and know it will finish. Ex: $ ansible all -m shell -a "reboot" --ask-pass Password: blah blah blah it worked I'd love to send an argument or << or something to get the password in. Is that possible?

    Read the article

  • What does this error mean (Can't create TCP/IP socket (24))?

    - by user105196
    I have web server with OS RHEL 6.2 and Mysql 5.5.23 on another server and the web server can read from Mysql server without problem, but some time I got this error: [Sun Sep 23 06:13:07 2012] [error] [client XXXXX] DBI connect('XXXX:192.168.1.2:3306','XXX',...) failed: Can't create TCP/IP socket (24) at /var/www/html/file.pm line 199. my question : What does this error mean (Can't create TCP/IP socket (24))? is it OS error or Mysql error ? perl -v This is perl, v5.10.1 (*) built for x86_64-linux-thread-multi mysql -V mysql Ver 14.14 Distrib 5.5.23, for Linux (x86_64) using readline 5.1 su - mysql -s /bin/bash -c 'ulimit -a' core file size (blocks, -c) 0 data seg size (kbytes, -d) unlimited scheduling priority (-e) 0 file size (blocks, -f) unlimited pending signals (-i) 127220 max locked memory (kbytes, -l) 64 max memory size (kbytes, -m) unlimited open files (-n) 1024 pipe size (512 bytes, -p) 8 POSIX message queues (bytes, -q) 819200 real-time priority (-r) 0 stack size (kbytes, -s) 10240 cpu time (seconds, -t) unlimited max user processes (-u) 1024 virtual memory (kbytes, -v) unlimited file locks (-x) unlimited

    Read the article

  • No COM1 port on hyper-v

    - by MPX
    I just made a fresh Windows 8.1 install and am trying to set-up a VM for kernel debugging. Therefore, I need to create a serial link to debug the VM using windbg. Usually I just simply add a new COM port and use it as a named pipe. However, I can't find any way to add this hardware. There is nothing relevant on the "add hardware list". What do I need to install this port then? Thanks in advance!

    Read the article

  • Is there a way for me to test my [closed]

    - by Jimi
    I have a home network with a cheap-o little router with a development server and a few devices hooked up to it. I am finding that backups of my server are taking FOREVER (a week for 60gb) running backups renders my internet connection useless from any other box int he house. I have maxed out the pipe to my house from the ISP (10down, 3up), but is there a way for me to test and see if my router is bottlenecking anything? I feel like 60gb backups shouldn't take this long so any help would be great!

    Read the article

  • How to determine if my router is causing a bottleneck in uploads?

    - by Jimi
    I have a home network with a cheap-o little router with a development server and a few devices hooked up to it. I am finding that backups of my server are taking FOREVER (a week for 60gb) running backups renders my internet connection useless from any other box int he house. I have maxed out the pipe to my house from the ISP (10down, 3up), but is there a way for me to test and see if my router is bottlenecking anything? I feel like 60gb backups shouldn't take this long so any help would be great!

    Read the article

  • Delphi Speech recognition delphi

    - by XBasic3000
    I need create a programatic equivalent using delphi language... or could someone post a link on how to do grammars in peech recogniton using the delphi. sorry for my english... XML Grammar Sample(s): <GRAMMAR> <!-- Create a simple "hello world" rule --> <RULE NAME="HelloWorld" TOPLEVEL="ACTIVE"> <P>hello world</P> </RULE> <!-- Create a more advanced "hello world" rule that changes the display form. When the user says "hello world" the display text will be "Hiya there!" --> <RULE NAME="HelloWorld_Disp" TOPLEVEL="ACTIVE"> <P DISP="Hiya there!">hello world</P> </RULE> <!-- Create a rule that changes the pronunciation and the display form of the phrase. When the user says "eh" the display text will be "I don't understand?". Note the user didn't say "huh". The pronunciation for "what" is specific to this phrase tag and is not changed for the user or application lexicon, or even other instances of "what" in the grammar --> <RULE NAME="Question_Pron" TOPLEVEL="ACTIVE"> <P DISP="I don't understand" PRON="eh">what</P> </RULE> <!-- Create a rule demonstrating repetition --> <!-- the rule will only be recognized if the user says "hey diddle diddle" --> <RULE NAME="NurseryRhyme" TOPLEVEL="ACTIVE"> <P>hey</P> <P MIN="2" MAX="2">diddle</P> </RULE> <!-- Create a list with variable phrase weights --> <!-- If the user says similar phrases, the recognizer will use the weights to pick a match --> <RULE NAME="UseWeights" TOPLEVEL="ACTIVE"> <LIST> <!-- Note the higher likelihood that the user is expected to say "recognizer speech" --> <P WEIGHT=".95">recognize speech</P> <P WEIGHT=".05">wreck a nice beach</P> </LIST> </RULE> <!-- Create a phrase with an attached semantic property --> <!-- Speaking "one two three" will return three different unique semantic properties, with different names, and different values --> <RULE NAME="UseProps" TOPLEVEL="ACTIVE"> <!-- named property, without value --> <P PROPNAME="NOVALUE">one</P> <!-- named property, with numeric value --> <P PROPNAME="NUMBER" VAL="2">two</P> <!-- named property, with string value --> <P PROPNAME="STRING" VALSTR="three">three</P> </RULE> </GRAMMAR> **Programmatic Equivalent:** To add a phrase to a rule, SAPI provides an API called ISpGrammarBuilder::AddWordTransition. The application developer can add the sentences as follows: SPSTATEHANDLE hsHelloWorld; // Create new top-level rule called "HelloWorld" hr = cpRecoGrammar->GetRule(L"HelloWorld", NULL, SPRAF_TopLevel | SPRAF_Active, TRUE, &hsHelloWorld); // Check hr // Add the command words "hello world" // Note that the lexical delimiter is " ", a space character. // By using a space delimiter, the entire phrase can be added // in one method call hr = cpRecoGrammar->AddWordTransition(hsHelloWorld, NULL, L"hello world", L" ", SPWT_LEXICAL, NULL, NULL); // Check hr // Add the command words "hiya there" // Note that the lexical delimiter is "|", a pipe character. // By using a pipe delimiter, the entire phrase can be added // in one method call hr = cpRecoGrammar->AddWordTransition(hsHelloWorld, NULL, L"hiya|there", L"|", SPWT_LEXICAL, NULL, NULL); // Check hr // save/commit changes hr = cpRecoGrammar->Commit(NULL); // Check hr

    Read the article

  • Supporting Piping (A Useful Hello World)

    - by blastthisinferno
    I am trying to write a collection of simple C++ programs that follow the basic Unix philosophy by: Make each program do one thing well. Expect the output of every program to become the input to another, as yet unknown, program. I'm having an issue trying to get the output of one to be the input of the other, and getting the output of one be the input of a separate instance of itself. Very briefly, I have a program add which takes arguments and spits out the summation. I want to be able to pipe the output to another add instance. ./add 1 2 | ./add 3 4 That should yield 6 but currently yields 10. I've encountered two problems: The cin waits for user input from the console. I don't want this, and haven't been able to find a simple example showing a the use of standard input stream without querying the user in the console. If someone knows of an example please let me know. I can't figure out how to use standard input while supporting piping. Currently, it appears it does not work. If I issue the command ./add 1 2 | ./add 3 4 it results in 7. The relevant code is below: add.cpp snippet // ... COMMAND LINE PROCESSING ... std::vector<double> numbers = multi.getValue(); // using TCLAP for command line parsing if (numbers.size() > 0) { double sum = numbers[0]; double arg; for (int i=1; i < numbers.size(); i++) { arg = numbers[i]; sum += arg; } std::cout << sum << std::endl; } else { double input; // right now this is test code while I try and get standard input streaming working as expected while (std::cin) { std::cin >> input; std::cout << input << std::endl; } } // ... MORE IRRELEVANT CODE ... So, I guess my question(s) is does anyone see what is incorrect with this code in order to support piping standard input? Are there some well known (or hidden) resources that explain clearly how to implement an example application supporting the basic Unix philosophy? @Chris Lutz I've changed the code to what's below. The problem where cin still waits for user input on the console, and doesn't just take from the standard input passed from the pipe. Am I missing something trivial for handling this? I haven't tried Greg Hewgill's answer yet, but don't see how that would help since the issue is still with cin. // ... COMMAND LINE PROCESSING ... std::vector<double> numbers = multi.getValue(); // using TCLAP for command line parsing double sum = numbers[0]; double arg; for (int i=1; i < numbers.size(); i++) { arg = numbers[i]; sum += arg; } // right now this is test code while I try and get standard input streaming working as expected while (std::cin) { std::cin >> arg; std::cout << arg << std::endl; } std::cout << sum << std::endl; // ... MORE IRRELEVANT CODE ...

    Read the article

  • No-Weld Multi-Monitor Stand Crafted From Sturdy Metal Framing

    - by Jason Fitzpatrick
    As far as DIY stands for multiple monitors go, this design has to be the sturdiest and least difficult to construct model we’ve seen in some time. Read on to see how one DIYer cleverly crafted a solid metal triple monitor stand with no welding involved. Tinker and gamer Opteced wanted a new stand for his Eyefinity setup but wasn’t in a hurry to spend a pile of cash on a custom stand. His DIY solution is just as sturdy as a commercial metal stand but is made out of inexpensive hardware store parts–the main supports and base are made from Unistrut, a simple metal framing material. Unlike many DIY stands made from metal rods and piping, this build doesn’t require any sort of welding or custom pipe threading. In fact, the metal struts are so over engineered for the task of holding up flat-panel monitors he was able to simply partially saw through them and bend them to the shape he wanted. Hit up the link below for additional pictures of the build. Unistrut Monitor Stand [via Hack A Day] 8 Deadly Commands You Should Never Run on Linux 14 Special Google Searches That Show Instant Answers How To Create a Customized Windows 7 Installation Disc With Integrated Updates

    Read the article

  • Errors Code: /var/cache/apt/archives/linux-image-3.8.0-19-generic_3.8.0-19.30~precise1_amd64.deb

    - by user286682
    $ sudo apt-get dist-upgrade Reading package lists... Done Building dependency tree Reading state information... Done Calculating upgrade... Done The following packages will be upgraded: linux-image-3.8.0-19-generic 1 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 6 not fully installed or removed. Need to get 0 B/47.8 MB of archives. After this operation, 142 MB of additional disk space will be used. Do you want to continue [Y/n]? y (Reading database ... 164064 files and directories currently installed.) Preparing to replace linux-image-3.8.0-19-generic 3.8.0-19.29 (using .../linux-image-3.8.0-19-generic_3.8.0-19.30~precise1_amd64.deb) ... Done. Unpacking replacement linux-image-3.8.0-19-generic ... dpkg: error processing /var/cache/apt/archives/linux-image-3.8.0-19-generic_3.8.0-19.30~precise1_amd64.deb (--unpack): trying to overwrite '/lib/modules/3.8.0-19-generic/kernel/arch/x86/kvm/kvm-intel.ko', which is also in package linux-image-extra-3.8.0-19-generic 3.8.0-19.29 dpkg-deb: error: subprocess paste was killed by signal (Broken pipe) Examining /etc/kernel/postrm.d . run-parts: executing /etc/kernel/postrm.d/initramfs-tools 3.8.0-19-generic /boot/vmlinuz-3.8.0-19-generic run-parts: executing /etc/kernel/postrm.d/zz-update-grub 3.8.0-19-generic /boot/vmlinuz-3.8.0-19-generic Errors were encountered while processing: /var/cache/apt/archives/linux-image-3.8.0-19-generic_3.8.0-19.30~precise1_amd64.deb E: Sub-process /usr/bin/dpkg returned an error code (1) How can I get this update to work?

    Read the article

  • Sesame OData Browser updated

    - by Fabrice Marguerie
    Since the first preview of Sesame was published, I've been working on improving it with new features.Today, I've published an update that provides the following: Support for hyperlinks (URLs and email addresses) Improved support for the OData format. More OData producers are supported, including Netflix and vanGuide, for example. Fixed display of images (images used to appear mixed up) Support for image URLs Image zoom (try to hover over pictures in Netflix' Titles or MIX10's Speakers) Support for complex types (test this with Netflix' Titles and the OData Test Service's Suppliers) Partial open types support Partial feed customization support (Products.Name and Products.Description are now displayed for http://services.odata.org/OData/OData.svc for example) Partial HTML support Query number is now unique by connection and not globally Support for query continuation (paging) - See the "Load more" button Partial support for <FunctionImport> (see Movies, Series, Seasons, Discs and Episodes with Netflix) Version number is now displayed More links to examples (coming from http://www.odata.org/producers) provided in the connection dialog You can try all this at the same place as before. Choose Netflix in the connection dialog to see most of the new features in action and to get a richer experience. There is a lot more in the pipe. Enough to keep me busy for a few more weeks :-)

    Read the article

  • GPLv2 - Multiple AI chess engines to bypass GPL

    - by Dogbert
    I have gone through a number of GPL-related questions, the most recent being this one: http://stackoverflow.com/questions/3248823/legal-question-about-the-gpl-license-net-dlls/3249001#3249001 I'm trying to see how this would work, so bear with me. I have a simple GUI interface for a game of Chess. It essentially can send/receive commands to/from an external chess engine (ie: Tong, Fruit, etc). The application/GUI is similar in nature to XBoard ( http://www.gnu.org/software/xboard/ ), but was independently designed. After going through a number of threads on this topic, it seems that the FSF considers dynamically linking against a GPLv2 library as a derivative work, and that by doing so, the GPLv2 extends to my proprietary code, and I must release the source to my entire project. Other legal precedents indicate the opposite, and that dynamic linking doesn't cause the "viral" effect of the GPL to propagate to my proprietary code. Since there is no official consensus that can give a "hard-and-fast" answer to the dynamic linking question, would this be an acceptable alternative: I build my chess GUI so that it sends/receives the chess engine AI logic as text commands from an external interface library that I write The interface library I wrote itself is then released under the GPL The interface library is only used to communicate via a generic text pipe to external command-line chess engines The chess engine itself would be built as a command-line utility rather than as a library of any sort, and just sends strings in the Universal Chess Interface of Chess Engine Communication Protocol ( http://en.wikipedia.org/wiki/Chess_Engine_Communication_Protocol ) format. The one "gotcha" is that the interface library should not be specific to one single GPL'ed chess engine, otherwise the entire GUI would be "entirely dependent" on it. So, I just make my interface library so that it is able to connect to any command-line chess engine that uses a specific format, rather than just one unique engine. I could then include pre-built command-line-app versions of any of the chess engines I'm using. Would that sort of approach allow me to do the following: NOT release the source for my UI Release the source of the interface library I built (if necessary) Use one or more chess engines and bundle them as external command-line utilities that ship with a binary version of my UI Thank you.

    Read the article

  • Windows Azure Myths

    - by BuckWoody
    Windows Azure is part of the Microsoft "stack" - the suite of software and services we offer. Because we have so many products in almost every part of technology, it's hard to know everything about all parts of what we do - even for those of us who work here. So it's no surprise that some folks are not as familiar with Windows and SQL Azure as they are, say Windows Server or XBox. As I chat with folks about a solution for a business or organization need, I put Windows Azure into the mix. I always start off with "What do you already know about Windows Azure?" so that I don't bore folks with information they already have. I some cases they've checked out the product ahead of time and have specific questions, in others they aren't as familiar, and in still others there is a fair amount of mis-information. Sometimes that's because of a marketing failure, sometimes it's hearsay, and somtetimes it's active misinformation. I thought I might lay out a few of these misconceptions. As always - do your fact-checking! Never take anyone's word alone (including mine) as gospel. Make sure you educate yourself on your options. Your company or your clients depend on you to have the right information on IT, so make sure you live up to that. Myth 1: Nobody uses Windows Azure It's true that we don't give out numbers on the amount of clients on Windows and SQL Azure. But lots of folks are here - companies you may have heard of like Boeing, NASA, Fujitsu, The City of London, Nuedesic, and many others. I deal with firms small and large that use Windows Azure for mission-critical applications, sometimes totally on Windows and/or SQL Azure, sometimes in conjunction with an on-premises system, sometimes for only a specific component in Windows Azure like storage. The interesting thing is that many sites you visit have a Windows Azure component, or are running on Windows Azure. They just don't announce it. Just like the other cloud providers, the companies have asked to be completely branded themselves - they don't want you to be aware or care that they are on Windows Azure. Sometimes that's for security, other times it's for different reasons. It's just like the web sites you visit. For the most part, they don't advertise which OS or Web Server they use. It really just shouldn't matter. The point is that they just use what works to solve a given problem. Check out a few public case studies here: https://www.windowsazure.com/en-us/home/case-studies/ Myth 2: It's only for Microsoft stuff - can't use Open Source This is the one I face the most, and am the most dismayed by. We work just fine with many open source products, including Java, NodeJS, PHP, Ruby, Python, Hadoop, and many other languages and applications. You can quickly deploy a Wordpress, Umbraco and other "kits". We have software development kits (SDK's) for iPhones, iPads, Android, Windows phones and more. We have an SDK to work with FaceBook and other social networks. In short, we play well with others. More on the languages and runtimes we support here: https://www.windowsazure.com/en-us/develop/overview/ More on the SDK's here: http://www.wadewegner.com/2011/05/windows-azure-toolkit-for-ios/, http://www.wadewegner.com/2011/08/windows-azure-toolkits-for-devices-now-with-android/, http://azuretoolkit.codeplex.com/ Myth 3: Microsoft expects me to switch everything to "the cloud" No, we don't. That would be disasterous, unless the only things you run in your company uses works perfectly in Azure. Use Windows Azure  - or any cloud for that matter - where it works. Whenever I talk to companies, I focus on two things: Something that is broken and needs to be re-architected Something you want to do that is new If something is broken, and you need new tools to scale, extend, add capacity dynamically and so on, then you can consider using Windows or SQL Azure. It can help solve problems that you have, or it may include a component you don't want to write or architect yourself. Sometimes you want to do something new, like extend your company's offerings to mobile phones, to the web, or to a social network. More info on where it works here: http://blogs.msdn.com/b/buckwoody/archive/2011/01/18/windows-azure-and-sql-azure-use-cases.aspx Myth 4: I have to write code to use Windows and SQL Azure If Windows Azure is a PaaS - a Platform as a Service - then don't you have to write code to use it? Nope. Windows and SQL Azure are made up of various components. Some of those components allow you to write and deploy code (like Compute) and others don't. We have lots of customers using Windows Azure storage as a backup, to securely share files instead of using DropBox, to distribute videos or code or firmware, and more. Others use our High Performance Computing (HPC) offering to rent a supercomputer when they need one. You can even throw workloads at that using Excel! In addition there are lots of other components in Windows Azure you can use, from the Windows Azure Media Services to others. More here: https://www.windowsazure.com/en-us/home/scenarios/saas/ Myth 5: Windows Azure is just another form of "vendor lock-in" Windows Azure uses .NET, OSS languages and standard interfaces for the code. Sure, you're not going to take the code line-for-line and run it on a mainframe, but it's standard code that you write, and can port to something else. And the data is yours - you can bring it back whever you want. It's either in text or binary form, that you have complete control over. There are no licenses - you can "pay as you go", and when you're done, you can leave the service and take all your code, data and IP with you.   So go out there, read up, try it. Use it where it works. And don't believe everything you hear - sometimes the Internet doesn't get it all correct. :)

    Read the article

  • Shockwave Flash crashes with Chromium and Firefox

    - by Stephan
    Since updating to Ubuntu 13.10, Shockwave Flash does not work in Chromium or Firefox. Both show a "Shockwave Flash has crashed" dialog. Chromium 29.0.1547.65 After loading a page with a Flash video, I get this warning on the console twice: NVIDIA: could not open the device file /dev/nvidia0 (Operation not permitted). When I try to play the video, it crashes and I receive these disorted error messages: (exe:14868): Gdk-WARNING **: XID collision, trouble ahead [xcb] Extra reply data still left in queue [xcb] This is most likely caused by a broken X extension library [xcb] Aborting, sorry about that. owser --type=plugin --plugin-path=/usr/lib/flashplugin-installer/libflashplayer.so --lang=de --channel=14560.18.20766867: ../../src/xcb_io.c:576: _XReply: Assertion `!xcb_xlib_extra_reply_data_left' failed. Firefox 25.0 With Firefox, I get these errors: ###!!! ABORT: Request 154.24: BadValue (integer parameter out of range for operation); 3 requests ago: file /build/buildd/firefox-25.0+build3/toolkit/xre/nsX11ErrorHandler.cpp, line 157 WARNING: pipe error (110): Connection reset by peer: file /build/buildd/firefox-25.0+build3/ipc/chromium/src/chrome/common/ipc_channel_posix.cc, line 437 ###!!! [Parent][RPCChannel] Error: Channel error: cannot send/recv What I tried so far Reinstalling flashplugin-installer Changing permissions of /dev/nvidia0 It seems that Flash Aid is no longer available. GPU acceleration is working fine, e.g. for Portal. Does anyone know how to fix this?

    Read the article

  • Can Ubuntu-One be installed on Ubuntu 10.04?

    - by crivello
    I have installed ubuntu-one by the several ways on a 10.04-TLS, it appears on my System Preference Ubuntu One. however, Clicking one it , nothing happens. On a terminal, the command : ~$ ubuntuone-launch doe not working too, and the following command ~$ ubuntuone-preferences leads to an error message, given below, that made me crazy. Does somebody has an idea one a solution to solve that ? Many thanks. \jcc Traceback (most recent call last): File "/usr/bin/ubuntuone-preferences", line 63, in <module> from desktopcouch.replication_services import ubuntuone as dcouch File "/usr/lib/python2.6/dist-packages/desktopcouch/__init__.py", line 20, in <module> from desktopcouch.start_local_couchdb import process_is_couchdb, read_pidfile File "/usr/lib/python2.6/dist-packages/desktopcouch/start_local_couchdb.py", line 38, in <module> from desktopcouch import local_files File "/usr/lib/python2.6/dist-packages/desktopcouch/local_files.py", line 300, in <module> xdg_base_dirs.save_config_path("desktop-couch")) File "/usr/lib/python2.6/dist-packages/desktopcouch/local_files.py", line 235, in __init__ self.couch_exec_command = [COUCH_EXE, self.couch_chain_ini_files(), File "/usr/lib/python2.6/dist-packages/desktopcouch/local_files.py", line 274, in couch_chain_ini_files stdout=subprocess.PIPE) File "/usr/lib/python2.6/subprocess.py", line 633, in __init__errread, errwrite) File "/usr/lib/python2.6/subprocess.py", line 1139, in _execute_child raise child_exception OSError: [Errno 13] Permission denied

    Read the article

  • Windows Azure Myths

    - by BuckWoody
    Windows Azure is part of the Microsoft "stack" - the suite of software and services we offer. Because we have so many products in almost every part of technology, it's hard to know everything about all parts of what we do - even for those of us who work here. So it's no surprise that some folks are not as familiar with Windows and SQL Azure as they are, say Windows Server or XBox. As I chat with folks about a solution for a business or organization need, I put Windows Azure into the mix. I always start off with "What do you already know about Windows Azure?" so that I don't bore folks with information they already have. I some cases they've checked out the product ahead of time and have specific questions, in others they aren't as familiar, and in still others there is a fair amount of mis-information. Sometimes that's because of a marketing failure, sometimes it's hearsay, and somtetimes it's active misinformation. I thought I might lay out a few of these misconceptions. As always - do your fact-checking! Never take anyone's word alone (including mine) as gospel. Make sure you educate yourself on your options. Your company or your clients depend on you to have the right information on IT, so make sure you live up to that. Myth 1: Nobody uses Windows Azure It's true that we don't give out numbers on the amount of clients on Windows and SQL Azure. But lots of folks are here - companies you may have heard of like Boeing, NASA, Fujitsu, The City of London, Nuedesic, and many others. I deal with firms small and large that use Windows Azure for mission-critical applications, sometimes totally on Windows and/or SQL Azure, sometimes in conjunction with an on-premises system, sometimes for only a specific component in Windows Azure like storage. The interesting thing is that many sites you visit have a Windows Azure component, or are running on Windows Azure. They just don't announce it. Just like the other cloud providers, the companies have asked to be completely branded themselves - they don't want you to be aware or care that they are on Windows Azure. Sometimes that's for security, other times it's for different reasons. It's just like the web sites you visit. For the most part, they don't advertise which OS or Web Server they use. It really just shouldn't matter. The point is that they just use what works to solve a given problem. Check out a few public case studies here: https://www.windowsazure.com/en-us/home/case-studies/ Myth 2: It's only for Microsoft stuff - can't use Open Source This is the one I face the most, and am the most dismayed by. We work just fine with many open source products, including Java, NodeJS, PHP, Ruby, Python, Hadoop, and many other languages and applications. You can quickly deploy a Wordpress, Umbraco and other "kits". We have software development kits (SDK's) for iPhones, iPads, Android, Windows phones and more. We have an SDK to work with FaceBook and other social networks. In short, we play well with others. More on the languages and runtimes we support here: https://www.windowsazure.com/en-us/develop/overview/ More on the SDK's here: http://www.wadewegner.com/2011/05/windows-azure-toolkit-for-ios/, http://www.wadewegner.com/2011/08/windows-azure-toolkits-for-devices-now-with-android/, http://azuretoolkit.codeplex.com/ Myth 3: Microsoft expects me to switch everything to "the cloud" No, we don't. That would be disasterous, unless the only things you run in your company uses works perfectly in Azure. Use Windows Azure  - or any cloud for that matter - where it works. Whenever I talk to companies, I focus on two things: Something that is broken and needs to be re-architected Something you want to do that is new If something is broken, and you need new tools to scale, extend, add capacity dynamically and so on, then you can consider using Windows or SQL Azure. It can help solve problems that you have, or it may include a component you don't want to write or architect yourself. Sometimes you want to do something new, like extend your company's offerings to mobile phones, to the web, or to a social network. More info on where it works here: http://blogs.msdn.com/b/buckwoody/archive/2011/01/18/windows-azure-and-sql-azure-use-cases.aspx Myth 4: I have to write code to use Windows and SQL Azure If Windows Azure is a PaaS - a Platform as a Service - then don't you have to write code to use it? Nope. Windows and SQL Azure are made up of various components. Some of those components allow you to write and deploy code (like Compute) and others don't. We have lots of customers using Windows Azure storage as a backup, to securely share files instead of using DropBox, to distribute videos or code or firmware, and more. Others use our High Performance Computing (HPC) offering to rent a supercomputer when they need one. You can even throw workloads at that using Excel! In addition there are lots of other components in Windows Azure you can use, from the Windows Azure Media Services to others. More here: https://www.windowsazure.com/en-us/home/scenarios/saas/ Myth 5: Windows Azure is just another form of "vendor lock-in" Windows Azure uses .NET, OSS languages and standard interfaces for the code. Sure, you're not going to take the code line-for-line and run it on a mainframe, but it's standard code that you write, and can port to something else. And the data is yours - you can bring it back whever you want. It's either in text or binary form, that you have complete control over. There are no licenses - you can "pay as you go", and when you're done, you can leave the service and take all your code, data and IP with you.   So go out there, read up, try it. Use it where it works. And don't believe everything you hear - sometimes the Internet doesn't get it all correct. :)

    Read the article

  • Curing the Database-Application mismatch

    - by Phil Factor
    If an application requires access to a database, then you have to be able to deploy it so as to be version-compatible with the database, in phase. If you can deploy both together, then the application and database must normally be deployed at the same version in which they, together, passed integration and functional testing.  When a single database supports more than one application, then the problem gets more interesting. I’ll need to be more precise here. It is actually the application-interface definition of the database that needs to be in a compatible ‘version’.  Most databases that get into production have no separate application-interface; in other words they are ‘close-coupled’.  For this vast majority, the whole database is the application-interface, and applications are free to wander through the bowels of the database scot-free.  If you’ve spurned the perceived wisdom of application architects to have a defined application-interface within the database that is based on views and stored procedures, any version-mismatch will be as sensitive as a kitten.  A team that creates an application that makes direct access to base tables in a database will have to put a lot of energy into keeping Database and Application in sync, to say nothing of having to tackle issues such as security and audit. It is not the obvious route to development nirvana. I’ve been in countless tense meetings with application developers who initially bridle instinctively at the apparent restrictions of being ‘banned’ from the base tables or routines of a database.  There is no good technical reason for needing that sort of access that I’ve ever come across.  Everything that the application wants can be delivered via a set of views and procedures, and with far less pain for all concerned: This is the application-interface.  If more than zero developers are creating a database-driven application, then the project will benefit from the loose-coupling that an application interface brings. What is important here is that the database development role is separated from the application development role, even if it is the same developer performing both roles. The idea of an application-interface with a database is as old as I can remember. The big corporate or government databases generally supported several applications, and there was little option. When a new application wanted access to an existing corporate database, the developers, and myself as technical architect, would have to meet with hatchet-faced DBAs and production staff to work out an interface. Sure, they would talk up the effort involved for budgetary reasons, but it was routine work, because it decoupled the database from its supporting applications. We’d be given our own stored procedures. One of them, I still remember, had ninety-two parameters. All database access was encapsulated in one application-module. If you have a stable defined application-interface with the database (Yes, one for each application usually) you need to keep the external definitions of the components of this interface in version control, linked with the application source,  and carefully track and negotiate any changes between database developers and application developers.  Essentially, the application development team owns the interface definition, and the onus is on the Database developers to implement it and maintain it, in conformance.  Internally, the database can then make all sorts of changes and refactoring, as long as source control is maintained.  If the application interface passes all the comprehensive integration and functional tests for the particular version they were designed for, nothing is broken. Your performance-testing can ‘hang’ on the same interface, since databases are judged on the performance of the application, not an ‘internal’ database process. The database developers have responsibility for maintaining the application-interface, but not its definition,  as they refactor the database. This is easily tested on a daily basis since the tests are normally automated. In this setting, the deployment can proceed if the more stable application-interface, rather than the continuously-changing database, passes all tests for the version of the application. Normally, if all goes well, a database with a well-designed application interface can evolve gracefully without changing the external appearance of the interface, and this is confirmed by integration tests that check the interface, and which hopefully don’t need to be altered at all often.  If the application is rapidly changing its ‘domain model’  in the light of an increased understanding of the application domain, then it can change the interface definitions and the database developers need only implement the interface rather than refactor the underlying database.  The test team will also have to redo the functional and integration tests which are, of course ‘written to’ the definition.  The Database developers will find it easier if these tests are done before their re-wiring  job to implement the new interface. If, at the other extreme, an application receives no further development work but survives unchanged, the database can continue to change and develop to keep pace with the requirements of the other applications it supports, and needs only to take care that the application interface is never broken. Testing is easy since your automated scripts to test the interface do not need to change. The database developers will, of course, maintain their own source control for the database, and will be likely to maintain versions for all major releases. However, this will not need to be shared with the applications that the database servers. On the other hand, the definition of the application interfaces should be within the application source. Changes in it have to be subject to change-control procedures, as they will require a chain of tests. Once you allow, instead of an application-interface, an intimate relationship between application and database, we are in the realms of impedance mismatch, over and above the obvious security problems.  Part of this impedance problem is a difference in development practices. Whereas the application has to be regularly built and integrated, this isn’t necessarily the case with the database.  An RDBMS is inherently multi-user and self-integrating. If the developers work together on the database, then a subsequent integration of the database on a staging server doesn’t often bring nasty surprises. A separate database-integration process is only needed if the database is deliberately built in a way that mimics the application development process, but which hampers the normal database-development techniques.  This process is like demanding a official walking with a red flag in front of a motor car.  In order to closely coordinate databases with applications, entire databases have to be ‘versioned’, so that an application version can be matched with a database version to produce a working build without errors.  There is no natural process to ‘version’ databases.  Each development project will have to define a system for maintaining the version level. A curious paradox occurs in development when there is no formal application-interface. When the strains and cracks happen, the extra meetings, bureaucracy, and activity required to maintain accurate deployments looks to IT management like work. They see activity, and it looks good. Work means progress.  Management then smile on the design choices made. In IT, good design work doesn’t necessarily look good, and vice versa.

    Read the article

< Previous Page | 71 72 73 74 75 76 77 78 79 80 81 82  | Next Page >