Search Results

Search found 21350 results on 854 pages for 'url parsing'.

Page 762/854 | < Previous Page | 758 759 760 761 762 763 764 765 766 767 768 769  | Next Page >

  • Spring MVC 3 - How come @ResponseBody method renders a JSTLView?

    - by Ken Chen
    I have mapped one of my method in one Controller to return JSON object by @ResponseBody. @RequestMapping("/{module}/get/{docId}") public @ResponseBody Map<String, ? extends Object> get(@PathVariable String module, @PathVariable String docId) { Criteria criteria = new Criteria("_id", docId); return genericDAO.getUniqueEntity(module, true, criteria); } However, it redirects me to the JSTLView instead. Say, if the {module} is product and {docId} is 2, then in the console I found: DispatcherServlet with name 'xxx' processing POST request for [/xxx/product/get/2] Rendering view [org.springframework.web.servlet.view.JstlView: name 'product/get/2'; URL [/WEB-INF/views/jsp/product/get/2.jsp]] in DispatcherServlet with name 'xxx' How can that be happened? In the same Controller, I have another method similar to this but it's running fine: @RequestMapping("/{module}/list") public @ResponseBody Map<String, ? extends Object> list(@PathVariable String module, @RequestParam MultiValueMap<String, String> params, @RequestParam(value = "page", required = false) Integer pageNumber, @RequestParam(value = "rows", required = false) Integer recordPerPage) { ... return genericDAO.list(module, criterias, orders, pageNumber, recordPerPage); } Above do returns correctly providing me a list of objects I required. Anyone to help me solve the mystery?

    Read the article

  • leaflet/JSONobject. Marker onclick show only last record

    - by user2780898
    that my code <div id='map'></div> <div id="info"></div> [...] var markers1 = new L.MarkerClusterGroup( { showCoverageOnHover: true } ); $.ajax({ type: "GET", url: "db.php", success: function (result) { var JSONobject = JSON.parse(result); var jnCount = JSONobject.length; for (var i = 0; i < jnCount; i++) { var marker = new L.Marker(new L.LatLng(JSONobject[i]["lat"],JSONobject[i]["lng"]),{ icon: myIcon1 }); var id = JSONobject[i]["id"]; var list = "<dl>" + "<dt><b>CITTA':</b> " + JSONobject[i]["citta_"] + "</dt>"; marker.on('click', function() { {document.getElementById('info').innerHTML = list;} }); markers1.addLayer(marker); } map.addLayer(markers1); } }); Marker onclick shows only the last record! I think problem is in loop but I don't understand how fix it. Any idea? Thanks Nicola

    Read the article

  • Displaying Plist data into UItableview

    - by Christien
    I have a plist with Dictionary and numbers of strings per dictionary.show into the url below.and this list of items is in thousands in the plist. I need to display these plist data into the UItableview . How to do this? My Code: - (void)viewWillAppear:(BOOL)animated { // get paths from root direcory NSArray *documentPaths = NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES); NSString *documentsDirectory = [documentPaths objectAtIndex:0]; NSString *documentPlistPath = [documentsDirectory stringByAppendingPathComponent:@"p.plist"]; NSDictionary *dict = [NSDictionary dictionaryWithContentsOfFile:documentPlistPath]; valueArray = [dict objectForKey:@"title"]; self.mySections=[valueArray copy]; NSLog(@"value array %@",self.mySections); } - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { return [self.mySections count]; } -(NSString *)tableView:(UITableView *)tableView titleForHeaderInSection:(NSInteger)section { NSString *key = [[self.mySections objectAtIndex:section]objectForKey:@"pass"]; return [NSString stringWithFormat:@"%@", key]; } - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { return 5; } - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[UITableViewCell alloc] initWithStyle:UITableViewCellStyleValue1 reuseIdentifier:CellIdentifier]; } // Configure the cell... NSUInteger section = [indexPath section]; NSUInteger row = [indexPath row]; cell.textLabel.text = [[self.mySections objectAtIndex:row] objectForKey:@"title"]; cell.detailTextLabel.text=[[self.mySections objectAtIndex:section] objectForKey:[allKeys objectAtIndex:1]]; return cell; } Error is 2012-12-17 16:21:07.372 Project[2076:11603] * Terminating app due to uncaught exception 'NSRangeException', reason: '-[__NSCFArray objectAtIndex:]: index (4) beyond bounds (4)' * First throw call stack: (0x1703052 0x1523d0a 0x16aba78 0x16ab9e9 0x16fcc60 0x1d03a 0x391e0f 0x392589 0x37ddfd 0x38c851 0x337301 0x1704e72 0x277592d 0x277f827 0x2705fa7 0x2707ea6 0x2707580 0x16d79ce 0x166e670 0x163a4f6 0x1639db4 0x1639ccb 0x1505879 0x150593e 0x2f8a9b 0x2158 0x20b5) terminate called throwing an exceptionkill

    Read the article

  • Special technology needed for browser based chat?

    - by orokusaki
    On this post, I read about the usage of XMPP. Is this sort of thing necessary, and more importantly, my main question expanded: Can a chat server and client be built efficiently using only standard HTTP and browser technologies (such as PHP and JS, or RoR and JS, etc)? Or, is it best to stick with old protocols like XMPP find a way to integrate them with my application? I looked into CampFire via LiveHTTPHeaders and Firebug for about 5 minutes, and it appears to use Ajax to send a request which is never answered until another chat happens. Is this just CampFire opening a new thread on the server to listen for an update and then returning a response to the request when the thread hears an update? I noticed that they're requesting on a specific port (8043 if memory serves me) which makes me think that they're doing something more complex than just what I mentioned. Also, the URL requested started with /tcp/ which I found interesting. Note: I don't expect to ever have more than 150 users live-chatting in all the rooms combined at the same time. I understand that if I was building a hosted pay for chat service like CampFire with thousands of concurrent users, it would behoove me to invest time in researching special technologies vs trying to reinvent the wheel in a simple way in my app. Also, if you're going to do it with server polling, how often would you personally poll to maximize response without slamming the server?

    Read the article

  • 401 Unauthorized returned on GET request (https) with correct credentials

    - by Johnny Grass
    I am trying to login to my web app using HttpWebRequest but I keep getting the following error: System.Net.WebException: The remote server returned an error: (401) Unauthorized. Fiddler has the following output: Result Protocol Host URL 200 HTTP CONNECT mysite.com:443 302 HTTPS mysite.com /auth 401 HTTP mysite.com /auth This is what I'm doing: // to ignore SSL certificate errors public bool AcceptAllCertifications(object sender, System.Security.Cryptography.X509Certificates.X509Certificate certification, System.Security.Cryptography.X509Certificates.X509Chain chain, System.Net.Security.SslPolicyErrors sslPolicyErrors) { return true; } try { // request Uri uri = new Uri("https://mysite.com/auth"); HttpWebRequest request = (HttpWebRequest)WebRequest.Create(uri) as HttpWebRequest; request.Accept = "application/xml"; // authentication string user = "user"; string pwd = "secret"; string auth = "Basic " + Convert.ToBase64String(System.Text.Encoding.Default.GetBytes(user + ":" + pwd)); request.Headers.Add("Authorization", auth); ServicePointManager.ServerCertificateValidationCallback = new System.Net.Security.RemoteCertificateValidationCallback(AcceptAllCertifications); // response. HttpWebResponse response = (HttpWebResponse)request.GetResponse(); // Display Stream dataStream = response.GetResponseStream(); StreamReader reader = new StreamReader(dataStream); string responseFromServer = reader.ReadToEnd(); Console.WriteLine(responseFromServer); // Cleanup reader.Close(); dataStream.Close(); response.Close(); } catch (WebException webEx) { Console.Write(webEx.ToString()); } I am able to log in to the same site with no problem using ASIHTTPRequest in a Mac app like this: NSURL *login_url = [NSURL URLWithString:@"https://mysite.com/auth"]; ASIHTTPRequest *request = [ASIHTTPRequest requestWithURL:login_url]; [request setDelegate:self]; [request setUsername:name]; [request setPassword:pwd]; [request setRequestMethod:@"GET"]; [request addRequestHeader:@"Accept" value:@"application/xml"]; [request startAsynchronous];

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How can I mix SVG and HTML into a page?

    - by John Duff
    I've been using the jQuery.svg plugin to do some SVG rendering and it works perfectly but I also want to have the server render some SVG into the page and I can't get that to work. How do I add some SVG like below into the page so that Firefox will render it? <svg xmlns="http://www.w3.org/2000/svg" version="1.1" preserveAspectRatio="none" viewBox="0 0 100 100"> <linearGradient id="background_gradient_black" x1="0%" y1="10" x2="0%" y2="90" gradientUnits="userSpaceOnUse"> <stop offset="0%" stop-color="#000" stop-opacity="1" /> <stop offset="45%" stop-color="#444" stop-opacity="1" /> <stop offset="55%" stop-color="#444" stop-opacity="1" /> <stop offset="100%" stop-color="#000" stop-opacity="1" /> </linearGradient> <rect x="0" y="0" width="100" height="100" fill="url(#background_gradient_black)"" /> </svg> Do I need a meta tag saying that there is SVG content in the page or define the SVG namespace somehow?

    Read the article

  • Using a php://memory wrapper causes errors...

    - by HorusKol
    I'm trying to extend the PHP mailer class from Worx by adding a method which allows me to add attachments using string data rather than path to the file. I came up with something like this: public function addAttachmentString($string, $name='', $encoding = 'base64', $type = 'application/octet-stream') { $path = 'php://memory/' . md5(microtime()); $file = fopen($path, 'w'); fwrite($file, $string); fclose($file); $this->AddAttachment($path, $name, $encoding, $type); } However, all I get is a PHP warning: PHP Warning: fopen() [<a href='function.fopen'>function.fopen</a>]: Invalid php:// URL specified There aren't any decent examples with the original documentation, but I've found a couple around the internet (including one here on SO), and my usage appears correct according to them. Has anyone had any success with using this? My alternative is to create a temporary file and clean up - but that will mean having to write to disc, and this function will be used as part of a large batch process and I want to avoid slow disc operations (old server) where possible. This is only a short file but has different information for each person the script emails.

    Read the article

  • How-to display a .gif as background image?

    - by Vito De Tullio
    Hi! I have a javascript "loading" function like this: function splashScreen() { var div = document.createElement('div'); div.appendChild(document.createTextNode("some text")); div.setAttribute("style", "position: fixed; " + "width: 100%; height: 100%; " + "left: 0; top: 0; " + "z-index: 1000; " + "background: #fff url('img/loading.gif') no-repeat center; " + "font-size: x-large; " + "text-align: center; " + "line-height: 3em; " + "opacity: 0.75; " + "filter: alpha(opacity=75); "); document.getElementsByTagName('body')[0].appendChild(div); return true; } I use this function in the form action (onsubmit="return splashScreen()") to show a "rotating logo" while the next page load... The problem is in that "img/loading.gif" and safari (on winXP): in ff and ie I have no problems, and I clearly see the animated gif. In safari I can't see it. If I change the image with a (obviously static) png the image appears... Am I doing something wrong? What's the problem with safari?

    Read the article

  • Home_path issue with RoR testing locally on mobile device

    - by Amir
    When I use <%= link_to image_tag("foo.png"), home_path %> and display it on my localhost on my iPhone, it's broken. When I inspect on with firebug, the src of the image is http://localhost:3000/images/foo.png thus causing it to break on my iPhone. When I use <img src="/images/foo.png" /> it displays fine on my iPhone. I am pointing to the IP address of my PC running the server of my rails app in Safari. It's loading the text but all the css, JavaScript, and images are missing unless the path is absolute with using the rails default helpers. Is there a way to correct this path issue locally so it's absolute like /images/foo.png instead of http://localhost:3000/images/foo.png. Update CSS file paths are also affected. Instead of just making the path /stylesheets/foo.css, it's http://localhost:3000/stylesheets/foo.css. Update: Solution It's the Facebook plugin changing the asset host to the callback url of my facebook app settings which is currently set to http://localhost:3000/

    Read the article

  • Objective-C and NSURL: where am I supposed to declare receivedData?

    - by jthomas
    I have a two classes, a controller called "AppController" and a class called "URLDelegate" that encapsulates the sample NSURL code from Apple's URL Loading System Programming Guide. The guide repeatedly mentions declaring the receivedData instance variable "elsewhere." I assume this means outside of the URLDelagate class, because if I declare it in the URLDelegate class, my controller class can't "see" the data that has been downloaded. I know that data is received, because in my connectionDidFinishLoading function, I have NSLog display the results: NSLog(@"Succeeded! Received %d bytes of data",[receivedData length]); receivedText=[[NSString alloc] initWithData:receivedData encoding: NSASCIIStringEncoding]; NSLog(@"receivedText=%@",receivedText); So I'm a bit stumped with the following questions: Where should I declare receivedData? My controller class? A third class? Can I just declare it like any normal NSMutableData variable? How do I give my URLDelegate class "access" to this variable? E.g., if I declare receivedData in my AppController class, wouldn't I have to instantiate AppController within URLDelegate? But how would this possible if it's the AppController class which is instantiating the URLDelegate class in the first place? Especially with regard to the last question, I feel like I must be overlooking something blindingly obvious and fundamental. If anyone could point me in the right direction, I would really appreciate it. Thank you!

    Read the article

  • Does Android AsyncTaskQueue or similar exist?

    - by Ben L.
    I read somewhere (and have observed) that starting threads is slow. I always assumed that AsyncTask created and reused a single thread because it required being started inside the UI thread. The following (anonymized) code is called from a ListAdapter's getView method to load images asynchronously. It works well until the user moves the list quickly, and then it becomes "janky". final File imageFile = new File(getCacheDir().getPath() + "/img/" + p.image); image.setVisibility(View.GONE); view.findViewById(R.id.imageLoading).setVisibility(View.VISIBLE); (new AsyncTask<Void, Void, Bitmap>() { @Override protected Bitmap doInBackground(Void... params) { try { Bitmap image; if (!imageFile.exists() || imageFile.length() == 0) { image = BitmapFactory.decodeStream(new URL( "http://example.com/images/" + p.image).openStream()); image.compress(Bitmap.CompressFormat.JPEG, 85, new FileOutputStream(imageFile)); image.recycle(); } image = BitmapFactory.decodeFile(imageFile.getPath(), bitmapOptions); return image; } catch (MalformedURLException ex) { // TODO Auto-generated catch block ex.printStackTrace(); return null; } catch (IOException ex) { // TODO Auto-generated catch block ex.printStackTrace(); return null; } } @Override protected void onPostExecute(Bitmap image) { if (view.getTag() != p) // The view was recycled. return; view.findViewById(R.id.imageLoading).setVisibility( View.GONE); view.findViewById(R.id.image) .setVisibility(View.VISIBLE); ((ImageView) view.findViewById(R.id.image)) .setImageBitmap(image); } }).execute(); I'm thinking that a queue-based method would work better, but I'm wondering if there is one or if I should attempt to create my own implementation.

    Read the article

  • Form With Quantity doesn't seem to submit

    - by Karl Entwistle
    Hey guys, I've been trying to understand the documentation and find an example, but I'm at a loss. This is just a submit form within the cart for updating the quantity. However, the updated quantity is not getting saved to the database -- it always makes the quantity 0. Please help. Form <% for line_item in @cart.line_items %> <% form_for :lineitems, :url => {:controller => "line_items", :action => "cart_update", :id => "#{line_item.product_id}"} do |l| %> <%= l.text_field :quantity, :size => '3', :value => line_item.quantity %> <%= l.submit 'cart_update' %> <% end %> Route map.connect 'line_item_update', :controller => 'line_items', :action => 'cart_update' Controller def cart_update @product = Product.find(params[:id]) item = LineItem.find_or_create_by_cart_id(:cart_id => current_cart.id, :product_id => @product.id, :quantity => 0, :unit_price => @product.price) item.quantity = (params[:quantity]).to_i item.save redirect_to :controller => 'products' end

    Read the article

  • ASP.NET MVC Authorize by Subdomain

    - by Jimmo
    I have what seems like a common issue with SaaS applications, but have not seen this question on here anywhere. I am using ASP.NET MVC with Forms Authentication. I have implemented a custom membership provider to handle logic, but have one issue (perhaps the issue is in my mental picture of the system). As with many SaaS apps, customers create accounts and use the app in a way that looks like they are the only ones present (they only see their items, users, etc.). In reality, there are generic controllers and views presenting data depending on the customer represented in the URL. When calling something like the MembershipProvider.ValidateUser, I have access to the user's customer affiliation in the User object - what I don't have is the context of the request to compare whether it is a data request for the same customer as the user. As an example, One company called ABC goes to abc.mysite.com Another company called XYZ goes to xyz.mysite.com When an ABC user calls http://abc.mysite.com/product/edit/12 I have an [Authorize] attribute on the Edit method in the ProductController to make sure he is signed in and has sufficient permission to do so. If that same ABC user tried to access http://xyz.mysite.com/product/edit/12 I would not want to validate him in the context of that call. In the ValidateUser of the MembershipProvider, I have the information about the user, but not about the request. I can tell that the user is from ABC, but I cannot tell that the request is for XYZ at that point in the code. How should I resolve this?

    Read the article

  • Using ember-resource with couchdb - how can i save my documents?

    - by Thomas Herrmann
    I am implementing an application using ember.js and couchdb. I choose ember-resource as database access layer because it nicely supports nested JSON documents. Since couchdb uses the attribute _rev for optimistic locking in every document, this attribute has to be updated in my application after saving the data to the couchdb. My idea to implement this is to reload the data right after saving to the database and get the new _rev back with the rest of the document. Here is my code for this: // Since we use CouchDB, we have to make sure that we invalidate and re-fetch // every document right after saving it. CouchDB uses an optimistic locking // scheme based on the attribute "_rev" in the documents, so we reload it in // order to have the correct _rev value. didSave: function() { this._super.apply(this, arguments); this.forceReload(); }, // reload resource after save is done, expire to make reload really do something forceReload: function() { this.expire(); // Everything OK up to this location Ember.run.next(this, function() { this.fetch() // Sub-Document is reset here, and *not* refetched! .fail(function(error) { App.displayError(error); }) .done(function() { App.log("App.Resource.forceReload fetch done, got revision " + self.get('_rev')); }); }); } This works for most cases, but if i have a nested model, the sub-model is replaced with the old version of the data just before the fetch is executed! Interestingly enough, the correct (updated) data is stored in the database and the wrong (old) data is in the memory model after the fetch, although the _rev attribut is correct (as well as all attributes of the main object). Here is a part of my object definition: App.TaskDefinition = App.Resource.define({ url: App.dbPrefix + 'courseware', schema: { id: String, _rev: String, type: String, name: String, comment: String, task: { type: 'App.Task', nested: true } } }); App.Task = App.Resource.define({ schema: { id: String, title: String, description: String, startImmediate: Boolean, holdOnComment: Boolean, ..... // other attributes and sub-objects } }); Any ideas where the problem might be? Thank's a lot for any suggestion! Kind regards, Thomas

    Read the article

  • No unique bean of type [javax.persistence.EntityManagerFactory] is defined: expected single bean but found 0

    - by user659580
    Can someone tell me what's wrong with my config? I'm overly frustrated and I've been loosing my hair on this. Any pointer will be welcome. Thanks Persistence.xml <?xml version="1.0" encoding="UTF-8"?> <persistence version="2.0" xmlns="http://java.sun.com/xml/ns/persistence" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/persistence http://java.sun.com/xml/ns/persistence/persistence_2_0.xsd"> <persistence-unit name="myPersistenceUnit" transaction-type="JTA"> <provider>org.eclipse.persistence.jpa.PersistenceProvider</provider> <jta-data-source>jdbc/oracle</jta-data-source> <class>com.myproject.domain.UserAccount</class> <properties> <property name="eclipselink.logging.level" value="FINE"/> <property name="eclipselink.jdbc.batch-writing" value="JDBC" /> <property name="eclipselink.target-database" value="Oracle10g"/> <property name="eclipselink.cache.type.default" value="NONE"/> <!--Integrate EclipseLink with JTA in Glassfish--> <property name="eclipselink.target-server" value="SunAS9"/> <property name="eclipselink.cache.size.default" value="0"/> <property name="eclipselink.cache.shared.default" value="false"/> </properties> </persistence-unit> </persistence> Web.xml <?xml version="1.0" encoding="UTF-8"?> <web-app xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:web="http://java.sun.com/xml/ns/javaee/web-app_2_5.xsd" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd" id="WebApp_ID" version="3.0"> <display-name>MyProject</display-name> <persistence-unit-ref> <persistence-unit-ref-name>persistence/myPersistenceUnit</persistence-unit-ref-name> <persistence-unit-name>myPersistenceUnit</persistence-unit-name> </persistence-unit-ref> <servlet> <servlet-name>mvc-dispatcher</servlet-name> <servlet-class>org.springframework.web.servlet.DispatcherServlet</servlet-class> <load-on-startup>1</load-on-startup> </servlet> <servlet-mapping> <servlet-name>mvc-dispatcher</servlet-name> <url-pattern>*.htm</url-pattern> </servlet-mapping> <context-param> <param-name>contextConfigLocation</param-name> <param-value>/WEB-INF/mvc-dispatcher-servlet.xml</param-value> </context-param> <context-param> <param-name>contextConfigLocation</param-name> <param-value>classpath:applicationContext.xml</param-value> </context-param> <listener> <listener-class>org.springframework.web.context.ContextLoaderListener</listener-class> </listener> </web-app> applicationContext.xml <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:p="http://www.springframework.org/schema/p" xmlns:aop="http://www.springframework.org/schema/aop" xmlns:tx="http://www.springframework.org/schema/tx" xmlns:context="http://www.springframework.org/schema/context" xmlns:mvc="http://www.springframework.org/schema/mvc" xmlns:jee="http://www.springframework.org/schema/jee" xsi:schemaLocation="http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans.xsd http://www.springframework.org/schema/aop http://www.springframework.org/schema/aop/spring-aop.xsd http://www.springframework.org/schema/tx http://www.springframework.org/schema/tx/spring-tx.xsd http://www.springframework.org/schema/context http://www.springframework.org/schema/context/spring-context.xsd http://www.springframework.org/schema/mvc http://www.springframework.org/schema/mvc/spring-mvc-3.0.xsd http://www.springframework.org/schema/jee http://www.springframework.org/schema/jee/spring-jee.xsd" default-autowire="byName"> <tx:annotation-driven/> <tx:jta-transaction-manager/> <jee:jndi-lookup id="entityManagerFactory" jndi-name="persistence/myPersistenceUnit"/> <bean class="org.springframework.beans.factory.annotation.RequiredAnnotationBeanPostProcessor"/> <bean class="org.springframework.dao.annotation.PersistenceExceptionTranslationPostProcessor"/> <!-- enables interpretation of the @PersistenceUnit/@PersistenceContext annotations providing convenient access to EntityManagerFactory/EntityManager --> <bean class="org.springframework.orm.jpa.support.PersistenceAnnotationBeanPostProcessor"/> </beans> mvc-dispatcher-servlet.xml <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:p="http://www.springframework.org/schema/p" xmlns:context="http://www.springframework.org/schema/context" xmlns:mvc="http://www.springframework.org/schema/mvc" xmlns:tx="http://www.springframework.org/schema/tx" xsi:schemaLocation="http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-3.0.xsd http://www.springframework.org/schema/context http://www.springframework.org/schema/context/spring-context-3.0.xsd http://www.springframework.org/schema/mvc http://www.springframework.org/schema/mvc/spring-mvc-3.0.xsd http://www.springframework.org/schema/tx http://www.springframework.org/schema/tx/spring-tx.xsd"> <!-- DispatcherServlet Context: defines this servlet's request-processing infrastructure --> <tx:annotation-driven /> <tx:jta-transaction-manager /> <context:component-scan base-package="com.myProject" /> <context:annotation-config /> <!-- Enables the Spring MVC @Controller programming model --> <mvc:annotation-driven /> <mvc:default-servlet-handler /> <bean class="org.springframework.web.servlet.mvc.annotation.DefaultAnnotationHandlerMapping" /> <bean class="org.springframework.web.servlet.mvc.annotation.AnnotationMethodHandlerAdapter" /> <!-- Location Tiles config --> <bean id="tilesConfigurer" class="org.springframework.web.servlet.view.tiles2.TilesConfigurer"> <property name="definitions"> <list> <value>/WEB-INF/tiles-defs.xml</value> </list> </property> </bean> <!-- Resolves views selected for rendering by Tiles --> <bean id="tilesViewResolver" class="org.springframework.web.servlet.view.UrlBasedViewResolver" p:viewClass="org.springframework.web.servlet.view.tiles2.TilesView" /> <!-- Resolves views selected for rendering by @Controllers to .jsp resources in the /WEB-INF/views directory --> <bean id="viewResolver" class="org.springframework.web.servlet.view.InternalResourceViewResolver"> <property name="prefix"> <value>/WEB-INF/pages/</value> </property> <property name="suffix"> <value>.jsp</value> </property> </bean> <bean id="messageSource" class="org.springframework.context.support.ReloadableResourceBundleMessageSource"> <property name="basename" value="/WEB-INF/messages" /> <property name="cacheSeconds" value="0"/> </bean> <bean id="validator" class="org.springframework.validation.beanvalidation.LocalValidatorFactoryBean" /> </beans> UserAccountDAO.java @Repository public class UserAccountDAO implements IUserAccountDAO { private EntityManager entityManager; @PersistenceContext public void setEntityManager(EntityManager entityManager) { this.entityManager = entityManager; } @Override @Transactional(readOnly = true, propagation = Propagation.REQUIRED) public UserAccount checkLogin(String userName, String pwd) { //* Find the user in the DB Query queryUserAccount = entityManager.createQuery("select u from UserAccount u where (u.username = :userName) and (u.password = :pwd)"); ....... } } loginController.java @Controller @SessionAttributes({"userAccount"}) public class LoginLogOutController { private static final Logger logger = LoggerFactory.getLogger(UserAccount.class); @Resource private UserAccountDAO userDAO; @RequestMapping(value="/loginForm.htm", method = RequestMethod.GET) public String showloginForm(Map model) { logger.debug("Get login form"); UserAccount userAccount = new UserAccount(); model.put("userAccount", userAccount); return "loginform"; } ... Error Stack INFO: 13:52:21,657 ERROR ContextLoader:220 - Context initialization failed org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'loginController': Injection of resource dependencies failed; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'userAccountDAO': Injection of persistence dependencies failed; nested exception is org.springframework.beans.factory.NoSuchBeanDefinitionException: No unique bean of type [javax.persistence.EntityManagerFactory] is defined: expected single bean but found 0 at org.springframework.context.annotation.CommonAnnotationBeanPostProcessor.postProcessPropertyValues(CommonAnnotationBeanPostProcessor.java:300) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.populateBean(AbstractAutowireCapableBeanFactory.java:1074) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:517) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:291) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:222) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:288) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:190) at org.springframework.beans.factory.support.DefaultListableBeanFactory.preInstantiateSingletons(DefaultListableBeanFactory.java:580) at org.springframework.context.support.AbstractApplicationContext.finishBeanFactoryInitialization(AbstractApplicationContext.java:895) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:425) at org.springframework.web.context.ContextLoader.createWebApplicationContext(ContextLoader.java:276) at org.springframework.web.context.ContextLoader.initWebApplicationContext(ContextLoader.java:197) at org.springframework.web.context.ContextLoaderListener.contextInitialized(ContextLoaderListener.java:47) at org.apache.catalina.core.StandardContext.contextListenerStart(StandardContext.java:4664) at com.sun.enterprise.web.WebModule.contextListenerStart(WebModule.java:535) at org.apache.catalina.core.StandardContext.start(StandardContext.java:5266) at com.sun.enterprise.web.WebModule.start(WebModule.java:499) at org.apache.catalina.core.ContainerBase.addChildInternal(ContainerBase.java:928) at org.apache.catalina.core.ContainerBase.addChild(ContainerBase.java:912) at org.apache.catalina.core.StandardHost.addChild(StandardHost.java:694) at com.sun.enterprise.web.WebContainer.loadWebModule(WebContainer.java:1947) at com.sun.enterprise.web.WebContainer.loadWebModule(WebContainer.java:1619) at com.sun.enterprise.web.WebApplication.start(WebApplication.java:90) at org.glassfish.internal.data.EngineRef.start(EngineRef.java:126) at org.glassfish.internal.data.ModuleInfo.start(ModuleInfo.java:241) at org.glassfish.internal.data.ApplicationInfo.start(ApplicationInfo.java:236) at com.sun.enterprise.v3.server.ApplicationLifecycle.deploy(ApplicationLifecycle.java:339) at com.sun.enterprise.v3.server.ApplicationLifecycle.deploy(ApplicationLifecycle.java:183) at org.glassfish.deployment.admin.DeployCommand.execute(DeployCommand.java:272) at com.sun.enterprise.v3.admin.CommandRunnerImpl$1.execute(CommandRunnerImpl.java:305) at com.sun.enterprise.v3.admin.CommandRunnerImpl.doCommand(CommandRunnerImpl.java:320) at com.sun.enterprise.v3.admin.CommandRunnerImpl.doCommand(CommandRunnerImpl.java:1176) at com.sun.enterprise.v3.admin.CommandRunnerImpl.access$900(CommandRunnerImpl.java:83) at com.sun.enterprise.v3.admin.CommandRunnerImpl$ExecutionContext.execute(CommandRunnerImpl.java:1235) at com.sun.enterprise.v3.admin.CommandRunnerImpl$ExecutionContext.execute(CommandRunnerImpl.java:1224) at com.sun.enterprise.v3.admin.AdminAdapter.doCommand(AdminAdapter.java:365) at com.sun.enterprise.v3.admin.AdminAdapter.service(AdminAdapter.java:204) at com.sun.grizzly.tcp.http11.GrizzlyAdapter.service(GrizzlyAdapter.java:166) at com.sun.enterprise.v3.server.HK2Dispatcher.dispath(HK2Dispatcher.java:100) at com.sun.enterprise.v3.services.impl.ContainerMapper.service(ContainerMapper.java:245) at com.sun.grizzly.http.ProcessorTask.invokeAdapter(ProcessorTask.java:791) at com.sun.grizzly.http.ProcessorTask.doProcess(ProcessorTask.java:693) at com.sun.grizzly.http.ProcessorTask.process(ProcessorTask.java:954) at com.sun.grizzly.http.DefaultProtocolFilter.execute(DefaultProtocolFilter.java:170) at com.sun.grizzly.DefaultProtocolChain.executeProtocolFilter(DefaultProtocolChain.java:135) at com.sun.grizzly.DefaultProtocolChain.execute(DefaultProtocolChain.java:102) at com.sun.grizzly.DefaultProtocolChain.execute(DefaultProtocolChain.java:88) at com.sun.grizzly.http.HttpProtocolChain.execute(HttpProtocolChain.java:76) at com.sun.grizzly.ProtocolChainContextTask.doCall(ProtocolChainContextTask.java:53) at com.sun.grizzly.SelectionKeyContextTask.call(SelectionKeyContextTask.java:57) at com.sun.grizzly.ContextTask.run(ContextTask.java:69) at com.sun.grizzly.util.AbstractThreadPool$Worker.doWork(AbstractThreadPool.java:330) at com.sun.grizzly.util.AbstractThreadPool$Worker.run(AbstractThreadPool.java:309) at java.lang.Thread.run(Thread.java:732)

    Read the article

  • Saving js file with c# commands...

    - by ile
    <head runat="server"> <title><asp:ContentPlaceHolder ID="TitleContent" runat="server" /></title> <link href="../../Content/css/layout.css" rel="stylesheet" type="text/css" /> <script type="text/javascript" src="/Areas/CMS/Content/js/jquery-1.3.2.min.js"></script> <script type="text/javascript" src="/Areas/CMS/Content/js/jquery.jeditable.js"></script> <script type="text/javascript" src="/Areas/CMS/Content/js/jeditable.js"></script> <script type="text/javascript"> $(document).ready(function() { $(".naslov_vijesti").editable('<%=Url.Action("UpdateSettings","Article") %>', { submit: 'ok', submitdata: {field: "Title"}, cancel: 'cancel', cssclass: 'editable', width: '99%', placeholder: 'emtpy', indicator: "<img src='../../Content/img/indicator.gif'/>" }); }); </script> </head> This is head tag of site.master file. I would like to remove this multiline part from head and place it in jeditable.js file, which is now empty. If I do copy/paste, then <% %> part won't be executed. In PHP I would save js file as jeditable.js.php and server would compile code that is in <?php ?> tag. Any ideas how to solve this problem? Thanks in advance, Ile

    Read the article

  • On-Demand thumbnail creation with django and nginx

    - by sharjeel
    I want to generate thumbnails of images on the fly. My site is built with django and deployed using nginx which serves all the static content and communicates with django/apache using reverse proxy. Right now, for every image in my site, I generate all required sizes of thumbnails on-hand and deliver them when required. The problem is that whenever I change the size of a thumbnail, I have to regenerate all of them (and they are tons). However now I'd like to generate the thumbnail the first time it is accessed and later on nginx would deliver the same file over n over. If I delete that thumbnail file because of lesser accesses, it should get generated automatically the next time. Thumbnails in my case also have watermarks which require some computation logic of my application so a webserver thumbnail module might not work very well. The size of the thumbnail can be embedded in the URL. So http://www.example.com/thumbnail/abc_320x240.jpg gets the 320x240 size of the thumbnail. The approach I'm looking right now is to let nginx lookup the file and if it doesn't exist, forward the query to my django application which would create the thumbnail and send either the response or a redirect string. However I'm not sure about the concurrency issues and any other issues which might pop up later. What is the appropriate way to achieve this?

    Read the article

  • Rss Feed Java MVC

    - by GigaPr
    Hi, i would like to create some RSS Feeds for my website. I managed to crate the XML file but How do i display it in a nice format like http://newsrss.bbc.co.uk/rss/newsonline_uk_edition/front_page/rss.xml and how do i crate the little icon in the url box? by the way my XML file looks like <?xml version='1.0' encoding='UTF-8'?> <rss version="2.0"> <channel> <title>title</title> <description>desciption</description> <link>LINK</link> <dateCreated>2010-05-31 00:00:00.0</dateCreated> <language>Italian</language> <item> <title>pojpoj</title> <description>pojpojpoj</description> <link>ojpojpoj</link> <dateCreated>2010-06-03 00:00:00.0</dateCreated> <pubDate>2010-06-03 00:00:00.0</pubDate> </item> <item> <title>dfojp</title> <description>pojpojpoj</description> <link>pojpoj</link> <dateCreated>2010-06-03 00:00:00.0</dateCreated> <pubDate>2010-06-03 00:00:00.0</pubDate> </item> </channel> </rss> Thanks

    Read the article

  • CSS Layout-- Make table cell contents appear in row below and set height of parent row/cell

    - by Laramie
    I am modifying a skin for the CKEdit component so that the toolbar is hidden unless clicked. To do so, I moved the toolbar collapser to the row below it using position: relative and top:18px. My goal is to have the parent tr of the anchor element a height of 2px, but keep the anchor at 11px. Is this possible? I cannot alter the DOM, just the styles. Here's my reduced code <style type="text/css"> table { width: 80px;} td { border: solid 1px #ccc; } .header { background-color: #99f; /* This is being ignored */ height:2px; } .below { float: right; position: relative; top: 18px; /*If I shrink, the BG image goes Away*/ height: 11px; width: 11px; background-image: url('http://ckeditor.com/apps/ckeditor/3.3/skins/kama/images/sprites.png'); background-position: 4px -1387px; border: 1px outset #D3D3D3; } .hidden { display:none; } </style> <table> <tr><td class="header"><a class="below"><span class="hidden">#</span></a></td></tr> <tr><td>next row</td></tr> </table>

    Read the article

  • LI Background Images (.PNG) not appeared in IE6

    - by Balkar
    Hi I am using the following CSS but it never shows background images in IE6. But if I remove the filter .. AlphaLoader command, then it shows with grey background. Here is my CSS Code .fg-block1 ul, .fg-block3 ul { list-style:none; } .fg-block1 ul li, .fg-block3 ul li { padding-left:28px; background:url(images/bullet-2.png) no-repeat left top; font-family:Verdana, Arial, Helvetica, sans-serif; font-size:11px; border-bottom:1px dotted #fff; text-align:left; background-position:1px 0; line-height:16px; padding-bottom:5px; margin-bottom:5px; } .fg-block3 ul li { border-bottom:none; } .fg-block1 ul li a, .fg-block3 ul li a { color:#fff; text-decoration:none; } .fg-block1 ul li a:hover, .fg-block3 ul li a:hover { color:#fff; text-decoration:underline; }

    Read the article

  • Formatting Parameters for Ajax POST request to Rails Controller - for jQuery-UI sortable list

    - by Hung Luu
    I'm using the jQuery-UI Sortable Connected Lists. I'm saving the order of the connected lists to a Rails server. My approach is to grab the list ID, column ID and index position of each list item. I want to then wrap this into an object that can be passed as a parameter back to the Rails Controller to be saved into the database. So ideally i'm looking to format the parameter like this: Parameters: {"Activity"=>[{id:1,column:2,position:1},{id:2,column:2,position:2} ,...]} How do I properly format my parameters to be passed in this Ajax POST request? Right now, with the approach below, I'm passing on Parameters: {"undefined"=>""} This is my current jQuery code (Coffeescript) which doesn't work: jQuery -> $('[id*="day"]').sortable( connectWith: ".day" placeholder: "ui-state-highlight" update: (event, ui) -> neworder = new Array() $('[id*="day"] > li').each -> column = $(this).attr("id") index = ui.item.index() + 1 id = $("#" + column + " li:nth-child(" + index + ") ").attr('id') passObject={} passObject.id = id passObject.column = column passObject.index = index neworder.push(passObject) alert neworder $.ajax url: "sort" type: "POST" data: neworder ).disableSelection() My apologies because this seems like a really amateur question but I'm just getting started with programming jQuery and Javascript.

    Read the article

  • need advice on Zend framework Application architecture, or say approach dealing with modules

    - by simple
    Let me start with the things that I did and how am I using some things to get results I have set up modular structure as: application/ /configs /layouts /models /modules /users /profile /frontend /backend /controllers /views .... I write a plugin that does addes changes with FrontController-setModuleControllerDirectoryName() FrontController-addModuleDirectory() and It is all good I have a changed all the directories according weather admin page is requested in the url or not (it is some thing like /admin/some/some) Let's say I have a single layout for anything that is related to Profile viewing , in this case the "Profile" module. The Profile layout is divided into three parts In the layout I was pulling out the Profile/PhotoController 's index action with a action() $this->action('index', 'photo', 'profile'); Then I have faced few issues 1. Can get passed Params inside the Photo Controller when calling ( profile/profile/index); 2. found out that helper Action() is evil cause it starts another dispatching loop =) --- and now I am thinking that my approach on plugging in controllers modules into layout also evil =). anyhow how Should I deal with plugging in some controllers (another module controllers) into the layout ?

    Read the article

  • Pass checkbox values with Jquery to PHP and display result in div

    - by user1343955
    I want to filter realtime results with jQuery (just like on this site http://shop.www.hi.nl/hi/mcsmambo.p?M5NextUrl=RSRCH). So when someones checks a checkbox the results should update realtime (in a div). Now I'm a newbie with jQuery and I've tried lots of examples but I can't get it to work. Here's my code, could anyone tell what I'm doing wrong? Thank you very much! HTML <div id="c_b"> Kleur:<br /> <input type="checkbox" name="kleur[1]" value="Blauw"> Blauw <br /> <input type="checkbox" name="kleur[2]" value="Wit"> Wit <br /> <input type="checkbox" name="kleur[3]" value="Zwart"> Zwart <br /> <br /> Operating System:<br /> <input type="checkbox" name="os[1]" value="Android"> Android <br /> <input type="checkbox" name="os[2]" value="Apple iOS"> Apple iOS <br /> </div> <div id="myResponse">Here should be the result</div> jQuery function updateTextArea() { var allVals = []; $('#c_b :checked').each(function() { allVals.push($(this).val()); }); var dataString = $(allVals).serialize(); $.ajax({ type:'POST', url:'/wp-content/themes/u-design/filteropties.php', data: dataString, success: function(data){ $('#myResponse').html(data); } }); } $(document).ready(function() { $('#c_b input').click(updateTextArea); updateTextArea(); }); PHP //Just to see if the var passing works echo var_export($_POST);

    Read the article

  • Django: DatabaseLockError exception with Djapian

    - by jul
    Hi, I've got the exception shown below when executing indexer.update(). I have no idea about what to do: it used to work and now index database seems "locked". Anybody can help? Thanks Environment: Request Method: POST Request URL: http://piem.org:8000/restaurant/add/ Django Version: 1.1.1 Python Version: 2.5.2 Installed Applications: ['django.contrib.auth', 'django.contrib.contenttypes', 'django.contrib.sessions', 'django.contrib.comments', 'django.contrib.sites', 'django.contrib.admin', 'registration', 'djapian', 'resto', 'multilingual'] Installed Middleware: ('django.middleware.common.CommonMiddleware', 'django.contrib.sessions.middleware.SessionMiddleware', 'django.contrib.auth.middleware.AuthenticationMiddleware', 'django.middleware.locale.LocaleMiddleware', 'multilingual.middleware.DefaultLanguageMiddleware') Traceback: File "/var/lib/python-support/python2.5/django/core/handlers/base.py" in get_response 92. response = callback(request, *callback_args, **callback_kwargs) File "/home/jul/atable/../atable/resto/views.py" in addRestaurant 639. Restaurant.indexer.update() File "/home/jul/python-modules/Djapian-2.3.1-py2.5.egg/djapian/indexer.py" in update 181. database = self._db.open(write=True) File "/home/jul/python-modules/Djapian-2.3.1-py2.5.egg/djapian/database.py" in open 20. xapian.DB_CREATE_OR_OPEN, File "/usr/lib/python2.5/site-packages/xapian.py" in __init__ 2804. _xapian.WritableDatabase_swiginit(self,_xapian.new_WritableDatabase(*args)) Exception Type: DatabaseLockError at /restaurant/add/ Exception Value: Unable to acquire database write lock on /home/jul/atable /djapian_spaces/resto/restaurant/resto.index.restaurantindexer: already locked

    Read the article

< Previous Page | 758 759 760 761 762 763 764 765 766 767 768 769  | Next Page >