Search Results

Search found 5895 results on 236 pages for 'cake pattern'.

Page 90/236 | < Previous Page | 86 87 88 89 90 91 92 93 94 95 96 97  | Next Page >

  • handle when callback to a dealloced delegate?

    - by athanhcong
    Hi all, I implemented the delegate-callback pattern between two classes without retaining the delegate. But in some cases, the delegate is dealloced. (My case is that I have a ViewController is the delegate object, and when the user press back button to pop that ViewController out of the NavigationController stack) Then the callback method get BAD_EXE: if (self.delegate != nil && [self.delegate respondsToSelector:selector]) { [self.delegate performSelector:selector withObject:self withObject:returnObject]; } I know the delegate-callback pattern is implemented in a lot of application. What is your solution for this?

    Read the article

  • javascript string exec strange behavior

    - by Michael
    have funciton in my object which is called regularly. parse : function(html) { var regexp = /...some pattern.../ var match = regexp.exec(html); while (match != null) { ... match = regexp.exec(html); } ... var r = /...pattern.../g; var m = r.exec(html); } with unchanged html the m returns null each other call. let's say parse(html);// ok parse(html);// m is null!!! parse(html);// ok parse(html);// m is null!!! // ...and so on... is there any index or somrthing that has to be reset on html ... I'm really confused. Why match always returns proper result?

    Read the article

  • How to combine designable components with dependency injection

    - by Wim Coenen
    When creating a designable .NET component, you are required to provide a default constructor. From the IComponent documentation: To be a component, a class must implement the IComponent interface and provide a basic constructor that requires no parameters or a single parameter of type IContainer. This makes it impossible to do dependency injection via constructor arguments. (Extra constructors could be provided, but the designer would ignore them.) Some alternatives we're considering: Service Locator Don't use dependency injection, instead use the service locator pattern to acquire dependencies. This seems to be what IComponent.Site.GetService is for. I guess we could create a reusable ISite implementation (ConfigurableServiceLocator?) which can be configured with the necessary dependencies. But how does this work in a designer context? Dependency Injection via properties Inject dependencies via properties. Provide default instances if they are necessary to show the component in a designer. Document which properties need to be injected. Inject dependencies with an Initialize method This is much like injection via properties but it keeps the list of dependencies that need to be injected in one place. This way the list of required dependencies is documented implicitly, and the compiler will assists you with errors when the list changes. Any idea what the best practice is here? How do you do it? edit: I have removed "(e.g. a WinForms UserControl)" since I intended the question to be about components in general. Components are all about inversion of control (see section 8.3.1 of the UMLv2 specification) so I don't think that "you shouldn't inject any services" is a good answer. edit 2: It took some playing with WPF and the MVVM pattern to finally "get" Mark's answer. I see now that visual controls are indeed a special case. As for using non-visual components on designer surfaces, I think the .NET component model is fundamentally incompatible with dependency injection. It appears to be designed around the service locator pattern instead. Maybe this will start to change with the infrastructure that was added in .NET 4.0 in the System.ComponentModel.Composition namespace.

    Read the article

  • spring 3 mvc requestmapping dynamic param problem

    - by Faisal khan
    I have the following code which works fine with http://localhost:8080/HelloWorldSpring3/forms/helloworld but i want to have url have some thing like this http://localhost:8080/HelloWorldSpring3/forms/helloworld/locname_here/locid_here I found that adding this @RequestMapping("/helloworld/**") will work but when i try to access http://localhost:8080/HelloWorldSpring3/forms/helloworld/locname_here/locid_here it is not found. Web.xml entry as follows <servlet-mapping> <servlet-name>dispatcher</servlet-name> <url-pattern>/forms/*</url-pattern> </servlet-mapping> Mapping bean entry @RequestMapping("/helloworld/**") public ModelAndView helloWord(){ String message = "Hello World, Spring 3.0!"; return new ModelAndView("helloworld", "message",message); }

    Read the article

  • Sharing beans from contextListener -- dispatcher servlet

    - by Ernest
    Hello! ok, i have another question now. I have a bunch of beans loaded succesfully in applicationContext.xml, which loads from web.xml: contextConfigLocation applicationContext.xml org.springframework.web.context.ContextLoaderListener Here are is the bean defined in applicationContext.xml that i want to share: it loads other beans (DAOs) which are initialized with hibernet. I need to acces catalogFacadeTarget from the dispatcherServlet, declared in web.xml: dispatcher org.springframework.web.servlet.DispatcherServlet 1 <servlet-mapping> <servlet-name>dispatcher</servlet-name> <url-pattern>*.htm</url-pattern> </servlet-mapping> and configured dispatcher-servlet.xml like this: welcome There! in the property called catalogFacadeImpl. If you need the entire applicationCOntext.xml, web.xml, and dispatcher-servlet.xml please let me know. From what i read, i should be able to share beans if i declared them in the contextConfigLocation configuration file. Thank you very much in advance.

    Read the article

  • Unit Testing functions within repository interfaces - ASP.net MVC3 & Moq

    - by RawryLions
    I'm getting into writing unit testing and have implemented a nice repository pattern/moq to allow me to test my functions without using "real" data. So far so good.. However.. In my repository interface for "Posts" IPostRepository I have a function: Post getPostByID(int id); I want to be able to test this from my Test class but cannot work out how. So far I am using this pattern for my tests: [SetUp] public void Setup() { mock = new Mock<IPostRepository>(); } [Test] public void someTest() { populate(10); //This populates the mock with 10 fake entries //do test here } In my function "someTest" I want to be able to call/test the function GetPostById. I can find the function with mock.object.getpostbyid but the "object" is null. Any help would be appreciated :) iPostRepository: public interface IPostRepository { IQueryable<Post> Posts {get;} void SavePost(Post post); Post getPostByID(int id); }

    Read the article

  • Sorting based on existing elements in xslt

    - by Teelo
    Hi , I want to sort in xslt based on existing set of pattern . Let me explain with the code: <Types> <Type> <Names> <Name>Ryan</Name> </Names> <Address>2344</Address> </Type> <Type> <Names> </Name>Timber</Name> </Names> <Address>1234</Address> </Type> <Type> <Names> </Name>Bryan</Name> </Names> <Address>34</Address> </Type> </Types> Right now I m just calling it and getting it like (all hyperlinks) Ryan Timber Bryan Now I don't want sorting on name but I have existing pattern how I want it to get displayed.Like Timber Bryan Ryan (Also I don't want to lose the url attached to my names earlier while doing this) I was thinking of putting earlier value in some array and sort based on the other array where I will store my existing pattern. But I am not sure how to achieve that.. My xslt looks like this now(there can be duplicate names also) <xsl:for-each select="/Types/Type/Names/Name/text()[generate-id()=generate-id(key('Name',.)[1])]"> <xsl:call-template name="typename"> </xsl:call-template> </xsl:for-each> <xsl:template name="typename"> <li> <a href="somelogicforurl"> <xsl:value-of select="."/> </a> </li> </xsl:template> I am using xsl 1.0

    Read the article

  • PHP regex help -- reverse search?

    - by Ian Silber
    So, I have a regex that searches for HTML tags and modifies them slightly. It's working great, but I need to do something special with the last closing HTML tag I find. Not sure of the best way to do this. I'm thinking some sort of reverse reg ex, but haven't found a way to do that. Here's my code so far: $html = "<div id="test"><p style="hello_world">This is a test.</p></div>"; $pattern = array('/<([A-Z][A-Z0-9]*)(\b[^>]*)>/i'); $replace = array('<tag>'); $html = preg_replace($pattern,$replace,$html); // Outputs: <tag><tag>This is a test</p></div> I'd like to replace the last occurance of "" with something special, say for example, "". Any ideas?

    Read the article

  • PDF text search and split library

    - by Horace Ho
    I am look for a server side PDF library (or command line tool) which can: split a multi-page PDF file into individual PDF files, based on a search result of the PDF file content Examples: Search "Page ???" pattern in text and split the big PDF into 001.pdf, 002,pdf, ... ???.pdf A server program will scan the PDF, look for the search pattern, save the page(s) which match the patten, and save the file in the disk. It will be nice with integration with PHP / Ruby. Command line tool is also acceptable. It will be a server side (linux or win32) batch processing tool. GUI/login is not supported. i18n support will be nice but no required. Thanks~

    Read the article

  • Method hiding with interfaces

    - by fearofawhackplanet
    interface IFoo { int MyReadOnlyVar { get; } } class Foo : IFoo { int MyReadOnlyVar { get; set; } } public IFoo GetFoo() { return new Foo { MyReadOnlyVar = 1 }; } Is the above an acceptable way of implementing a readonly/immutable object? The immutability of IFoo can be broken with a temporary cast to Foo. In general (non-critical) cases, is hiding functionality through interfaces a common pattern? Or is it considered lazy coding? Or even an anti-pattern?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to display a DateTime with chosen date parts, but in the order of the FormatProvider?

    - by Stephane
    I want to display the date in the order that the culture provides, but with the elements I want only. The DateTime.Tostring() method has a list of patterns that are very useful but I would like a very small change in it. The CultureInfo used in the following the following code are chosen as example, I don't want to rely on a specific list of CultureInfo, if possible var now = DateTime.Now; string nowString = now.ToString("m", CultureInfo.GetCultureInfo("en-us")); Console.WriteLine(nowString); nowString = now.ToString("m", CultureInfo.GetCultureInfo("fr-FR")); Console.WriteLine(nowString); displays : April 12 12 avril I would like a pattern that display the abbreviation of the month and the day, but that keeps the correct order from the specified CultureInfo. using the pattern "MMM dd" will always display the month's abbreviation first, followed by the day, breaking the french order for example. Any way to achieve that without too much custom code?

    Read the article

  • Python: using a regular expression to match one line of HTML

    - by skylarking
    This simple Python method I put together just checks to see if Tomcat is running on one of our servers. import urllib2 import re import sys def tomcat_check(): tomcat_status = urllib2.urlopen('http://10.1.1.20:7880') results = tomcat_status.read() pattern = re.compile('<body>Tomcat is running...</body>',re.M|re.DOTALL) q = pattern.search(results) if q == []: notify_us() else: print ("Tomcat appears to be running") sys.exit() If this line is not found : <body>Tomcat is running...</body> It calls : notify_us() Which uses SMTP to send an email message to myself and another admin that Tomcat is no longer runnning on the server... I have not used the re module in Python before...so I am assuming there is a better way to do this... I am also open to a more graceful solution with Beautiful Soup ... but haven't used that either.. Just trying to keep this as simple as possible...

    Read the article

  • In C, how do you capture a group with regex?

    - by Sylvain
    Hi, I'm trying to extract a string from another using regex. I'm using the POSIX regex functions (regcomp, regexec ...), and I fail at capturing a group ... For instance, let the pattern be something as simple as "MAIL FROM:<(.*)>" (with REG_EXTENDED cflags) I want to capture everything between '<' and '' My problem is that regmatch_t gives me the boundaries of the whole pattern (MAIL FROM:<...) instead of just what's between the parenthesis ... What am I missing ? Thanks in advance,

    Read the article

  • Using free function as pseudo-constructors to exploit template parameter deduction

    - by Poita_
    Is it a common pattern/idiom to use free functions as pseudo-constructors to avoid having to explicitly specify template parameters? For example, everyone knows about std::make_pair, which uses its parameters to deduce the pair types: template <class A, class B> std::pair<A, B> make_pair(A a, B b) { return std::pair<A, B>(a, b); } // This allows you to call make_pair(1, 2), // instead of having to type pair<int, int>(1, 2) // as you can't get type deduction from the constructor. I find myself using this quite often, so I was just wondering if many other people use it, and if there is a name for this pattern?

    Read the article

  • Java Time Zone When Parsing DateFormat

    - by shipmaster
    I had code that parses date as follows: String ALT_DATE_TIME_FORMAT = "yyyy-MM-dd'T'HH:mm:ss.SSSZ"; SimpleDateFormat sdf = new SimpleDateFormat( ALT_DATE_TIME_FORMAT); Date date = sdf.parse(requiredTimeStamp); And it was working fine, suddenly, this stopped working. It turns out an admin made some config changes on the server and the date is currently being returned as "2010-12-27T10:50:44.000-08:00" which is not parse-able by the above pattern. I have two questions: The first would be what pattern would parse the date being returned by the JVM in the format above (specifically, just '-08:00' as the time zone)? And second, where exactly would one change such settings on a linux RHEL 5 server so that we are aware of such changes in the future?

    Read the article

  • WPF - Handling events from user control in View Model

    - by Vitaly
    I’m building a WPF application using MVVM pattern (both are new technologies for me). I use user controls for simple bits of reusable functionality that doesn’t contain business logic, and MVVM pattern to build application logic. Suppose a view contains my user control that fires events, and I want to add an event handler to that event. That event handler should be in the view model of the view, because it contains business logic. The question is – view and the view model are connected only by binding; how do I connect an event handler using binding? Is it even possible (I suspect not)? If not – how should I handle events from a control in the view model? Maybe I should use commands or INotifyPropertyChanged?

    Read the article

  • Better exception for non-exhaustive patterns in case

    - by toofarsideways
    Is there a way to get GHCi to produce better exception messages when it finds at runtime that a call has produced value that does not match the function's pattern matching? It currently gives the line numbers of the function which produced the non-exhaustive pattern match which though helpful at times does require a round of debugging which at times I feel is doing the same set of things over and over. So before I tried to put together a solution I wanted to see if something else exists. An exception message that in addition to giving the line numbers shows what kind of call it attempted to make? Is this even possible?

    Read the article

  • Find Methods in a c# File programmatically

    - by sajad
    Hi Friends, I want to write a code to search for method defination and methods called in a c# file. So obviously my pattern should search for text like 1.public void xyz(blahtype blahvalue); 2.string construct = SearchData(blahvalue); Has anyone done similar to this, is Regex helpful in this case. if yes provide me the pattern. Any other workarounds. I dont know reflection(will it help in my case) Thanks, you guys gave it a try, i did not know this wud be so complex. All i wanted to do was suppose i have method like this public method1(int val) { method2(); method3(); } void method2(int val2) { method4() } i wanted to construct a string as Method1:Method2:method4 and Method1:Method3.... I guess its really complex

    Read the article

  • How to Command Query Responsibility Segregation (CQRS) with ASP.NET MVC?

    - by Jeffrey
    I have been reading about Command Query Responsibility Segregation (CQRS). I sort of wonder how would this work with ASP.NET MVC? I get the idea of CQRS conceptually it sounds nice and sure does introduce some complexities (event and messaging pattern) compared to the "normal/common" approach . Also the idea of CQRS sort of against the use of ORM in some ways. I am trying to think how I could use this pattern in the coming projects so if anyone has experience in combining CQRS with ASP.NET MVC and NHibernate please give some concrete examples to help me better understand CQRS and use with ASP.NET MVC. Thanks!

    Read the article

  • linq-to-sql "an attempt has been made to attach or add an entity that is not new"?

    - by Curtis White
    I've been getting several errors: cannot add an entity with a key that is already in use An attempt has been made to attach or add an entity that is not new, perhaps having been loaded from another datacontext In case 1, this stems from trying to set the key for an entity versus the entity. In case 2, I'm not attaching an entity but I am doing this: MyParent.Child = EntityFromOtherDataContext; I've been using using the pattern of wrap everything with a using datacontext. In my case, I am using this in a web forms scenario, and obviously moving the datacontext object to a class wide member variables solves this. My questions are thus 2 fold: How can I get rid of these errors and not have to structure my program in an odd way or pass the datacontext around while keeping the local-wrap pattern? I assume I could make another hit to the database but that seems very inefficient. Would most people recommend that moving the datacontext to the class wide scope is desirable for web pages?

    Read the article

  • Overwhelmed by design patterns... where to begin?

    - by Pete
    I am writing a simple prototype code to demonstrate & profile I/O schemes (HDF4, HDF5, HDF5 using parallel IO, NetCDF, etc.) for a physics code. Since focus is on IO, the rest of the program is very simple: class Grid { public: floatArray x,y,z; }; class MyModel { public: MyModel(const int &nip1, const int &njp1, const int &nkp1, const int &numProcs); Grid grid; map<string, floatArray> plasmaVariables; }; Where floatArray is a simple class that lets me define arbitrary dimensioned arrays and do mathematical operations on them (i.e. x+y is point-wise addition). Of course, I could use better encapsulation (write accessors/setters, etc.), but that's not the concept I'm struggling with. For the I/O routines, I am envisioning applying simple inheritance: Abstract I/O class defines read & write functions to fill in the "myModel" object HDF4 derived class HDF5 HDF5 using parallel IO NetCDF etc... The code should read data in any of these formats, then write out to any of these formats. In the past, I would add an AbstractIO member to myModel and create/destroy this object depending on which I/O scheme I want. In this way, I could do something like: myModelObj.ioObj->read('input.hdf') myModelObj.ioObj->write('output.hdf') I have a bit of OOP experience but very little on the Design Patterns front, so I recently acquired the Gang of Four book "Design Patterns: Elements of Reusable Object-Oriented Software". OOP designers: Which pattern(s) would you recommend I use to integrate I/O with the myModel object? I am interested in answering this for two reasons: To learn more about design patterns in general Apply what I learn to help refactor an large old crufty/legacy physics code to be more human-readable & extensible. I am leaning towards applying the Decerator pattern to myModel, so I can attach the I/O responsibilities dynamically to myModel (i.e. whether to use HDF4, HDF5, etc.). However, I don't feel very confident that this is the best pattern to apply. Reading the Gang of Four book cover-to-cover before I start coding feels like a good way to develop an unhealthy caffeine addiction. What patterns do you recommend?

    Read the article

  • Need some clarification with Patterns (DAO x Gateway)

    - by Marcos Placona
    Me and my colleagues got into this discussion early this morning, and our opinions started to clash a bit, so I decided to get some impartial advice here. One of my colleagues reckons that the DAO should return an object (populated bean). I think it's completely fine when you're returning a recordset with only one line, but think it's overkill if you have to return 10 lines, and create 10 separate objects. I on the other see that the difference between DAO and Gateway pattern is that the gateway pattern will allow you to return a recordset to your business class, which will therefore deal with the recordset data and do whatever it needs to do. My questions here are: Which assumptions are correct? What should the return type be for a DAO (i.e. getContact() - for one record) Should getContacts() (for multiple records) even be on the DAO, if so, what's it's returntype? We seem to be having some sort of confusion about DAO and Gateway Patterns. Should they be used together? Thanks in advance

    Read the article

  • "Circuit breaker" for net.msmq?

    - by Alex
    Hi, The Circuit Breaker pattern, from the book Release It!, protects a service from requests while it is failing (or recovering). The net.msmq binding used with transactions give us nice retry and poison message capabilities. But I am missing the implementation of such a "Circuit breaker" pattern. A service is put under even heavier load by retries while it is already in a failure condition (like DB connectivity issues causing loads of blocked threads etc.). Anyone knows about a behavior extension or similar that explicitly closes the service host when defined failure thresholds have been exceeded? Cheers, Alex

    Read the article

  • How do negated patterns work in .gitignore?

    - by chrisperkins
    I am attempting to use a .gitignore file with negated patterns (lines starting with !), but it's not working the way I expect. As a minimal example, I have the folllowing directory structure: C:/gittest -- .gitignore -- aaa/ -- bbb/ -- file.txt -- ccc/ -- otherfile.txt and in my gitignore file, I have this: aaa/ !aaa/ccc/ My understanding (based on this: http://ftp.sunet.se/pub//Linux/kernel.org/software/scm/git/docs/gitignore.html) is that the file aaa/ccc/otherfile.txt should not be ignored, but in fact git is ignoring everything under aaa. Am I misunderstanding this sentence: "An optional prefix ! which negates the pattern; any matching file excluded by a previous pattern will become included again."? BTW, this is on Windows with msysgit 1.7.0.2.

    Read the article

< Previous Page | 86 87 88 89 90 91 92 93 94 95 96 97  | Next Page >