Search Results

Search found 5846 results on 234 pages for 'short circuiting'.

Page 93/234 | < Previous Page | 89 90 91 92 93 94 95 96 97 98 99 100  | Next Page >

  • Link two or more text boxes in Visio

    - by Dan
    I am working on creating a template in Visio 2007 (Professional). Each page should reflect a document number and a revision number (two text boxes). I would like to make the template such that entering or changing text in one of these boxes on one page will automatically update the equivalent text boxes on all other pages. Is there an easy way to link two (or more) text boxes to show the same data (mirror each other)? I've looked into creating a ShapeData set and then using the ShapeData field in place of each box, but this will require training others to access and adjust the ShapeData field. In short - I want the issue that was attempting to be solved in Changing Text in Visio Org Chart Shape Changes Multiple Shapes' Text .

    Read the article

  • VPN PPTPD with MPPE Support for Debian or Ubuntu

    - by user78395
    Having an unencrypted vpn connection from a windows client to linux is pretty easy by using pptpd. When I was looking for an solution for encrypted (per MPPE) connection, I found a lot of information about patching the kernel etc. - so it definitly works after some work. But all these information is pretty old (2005-2006). Is it the same solution nowadays? I am not asking for a complete instruction (only if it's short) - I am more asking for a link to the right solution.

    Read the article

  • HP Pavillion dv6 laptop - 15 beeps on startup and a black screen?

    - by dunc
    Usual story - girlfriend's step-brother's laptop is broken. I don't know a huge amount about what occurred before it broke, but I do know the following: When you try to turn the laptop on, it beeps 15 times exactly. The screen remains black. The LED on the Caps Lock key flashes continuously. If left on, the laptop never boots - as far as I can see. If left on, on a stable surface with decent ventilation for a relatively short period of time, the laptop (below keyboard, but not where the RAM/HDD are) gets very hot. I've tried doing what most websites appear to recommend for similar problems, which is to disconnect AC and battery then hold the power button down for a minute before reconnecting the AC and trying to turn the laptop on - no difference. EDIT I've also tried re-seating the RAM, to no avail. Any ideas? Thanks in advance,

    Read the article

  • How to force Windows XP to rename a file with a special character?

    - by codeLes
    I have a song that Windows can't play because there is a question mark in the name of the file. "Where Have All the Cowboys Gone?.ogg" // as an example So I try to rename it and Windows complains whether I try it in Explorer or from command prompt. Error I get when trying to copy, rename, or move is: The Filename, directory name, or volume label syntax is incorrect Is there a Windows way to force a rename in this case? Update I'll keep an eye on this question, but after 13 answers and many attempts (aside form 3rd party solutions) it seems that Windows can't do this (or at least my windows can't, no short names). So I'm accepting the answer which was my original solution anyway of using Linux. It would be nice to see Windows handle this somehow, so don't stop just because I've accepted this answer, the question still stands!

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Bringing my Dell XPS 13 ultrabook back to factory state

    - by TysHTTP
    I have a brand new Dell XPS 13 ultra book. After i picked it up at the store, i wiped the exising partitions which also contained the restore/rescue data, which you need to reinstall the factory version of Windows 8 that comes with this machine. I did this because we have a different MS partner edition of Windows which i prefer to run. After doing all this, i noticed that there was something wrong with machine. No real damage, but the specs are not completely as they should be. Turned out that a simple mistake while ordering. Now, long story short, the shop says that it has no problem with taking the product back, as long as it is in it's original state. And this is the problem i'm having, because i formatted the original partitions that contain that rescue option / windows 8 setup, i don't have a clue whether it's possible to get back to that original. Does anyone have an idea on how to get this fixed?

    Read the article

  • Upgrade Subversion 1.6 to 1.7 on CentOS? (can't find yum repository)

    - by user743919
    I want to upgrade my SVN Server from 1.6 to 1.7. Unfortunately I can't find anything on the internet how to do this with yum. I have checked rpmforge-extras but it has only svn 1.6 and not 1.7 I wanted to update with yum because this is the most secure way for me. I'm not an experienced Linux user. Is there a yum repository that contains 1.7 (subversion.x86_64 0:1.7.xxxxx.el5.rfx) I hope somebody can help me out? If there is non, perhaps a short explenation how to update with just step by step.

    Read the article

  • Will 5 Terabyte NAS drive be compatible with Windows XP SP3 32 bit?

    - by TrevorBoydSmith
    (NOTE: The operating system (in this case Windows XP SP3 32 bit) we are using is not a choice.) I am trying to setup a short term storage device. First, I found a large 5 Terabyte NAS drive that would IMO fulfill my storage requirements. Second, I also found that Windows XP seems to have a hard drive size limit (see 'Is there a limit to the size of a hard drive for Windows XP pre-SP1?'): XP should handle up to 2 TB per volume after the service packs are applied. You are correct. There was a 137gb limit on the orginal pre service pack windows xp. This was addressed/fixed in SP1. My question is, will my Windows XP SP3 32 bit machine see the 5 Terabyte NAS and be able to read/write properly to the NAS drive?

    Read the article

  • Apache web server: "proxying" a webapp from another server?

    - by Riddler
    Sorry for the lame terminology - I'm no way a sysadmin... So here's the deal. I have two Linux boxes in the same network, let's refer to those boxes by their IPs, a.b.c.d and e.f.g.h. Each box runs some webapp, normally available like http://a.b.c.d/ and http://e.f.g.h/. What I want to accomplish is this: with some Apache web server (which by the way lives on both boxes) configuration voodoo, the first app would be available via http://a.b.c.d/whatever1/, and the 2nd app would be available as http://a.b.c.d/whatever2/ - but would still reside on another server (e.f.g.h). Long story short - is it at all possible to do this with Apache configuration magic and without touching the webapps and their configuration? If so - how? :) Thanks in advance!

    Read the article

  • TrueCrypt - "Warning! Password locked: Fixed disk0" error message on boot

    - by Tibi
    TrueCrypt - "Warning! Password locked: Fixed disk0" error message on boot. When i start my laptop (Acer TravelMate 2410). after the starting memory check, the screen goes full black, and a message appears for about 3 seconds: Warning! Password locked: Fixed disk0 and after that, disappears, and next message comes out: Operating System Not Found and all stops here. Windows Xp was installed on it, before this came. TrueCrypt cd (witch was made during the process of full encryption) is not working, not in restoring MBR, no even in decrypting my drive - completely useless. Note: I detected some short of boot sector errors (i dont know the amount) on my drive before this happened. Please, i would greatfully thank every comment, or suggestion, because my computer is unusable now. The HDD is a Samsung HDD, 160Gb. Other preferences: Acer TravelMate 2410 Notebook, 2 Gb RAM, 1500 Mhz Intel Celeron M processor. Regards

    Read the article

  • Open application in background without losing current window focus. Fedora 17, Gnome 3

    - by Ishan
    I'm running a script in the background which loads an image with feh depending on which application is currently in focus. However, whenever the script opens the image, window focus is lost to feh. I was able to circumvent this by using xdotool to switch back to the application that was originally in focus, but this introduces a short annoying period of time where the focus is switched from feh to the application. My question is this: is there any way to launch feh in the background such that window focus is NOT lost? System: Fedora 17, Gnome 3, Bash Thanks a ton!

    Read the article

  • What's a good tool for collecting statistics on filesystem usage?

    - by Kamil Kisiel
    We have a number of filesystems for our computational cluster, with a lot of users that store a lot of really large files. We'd like to monitor the filesystem and help optimize their usage of it, as well as plan for expansion. In order to this, we need some way to monitor how these filesystems are used. Essentially I'd like to know all sorts of statistics about the files: Age Frequency of access Last accessed times Types Sizes Ideally this information would be available in aggregate form for any directory so that we could monitor it based on project or user. Short of writing something up myself in Python, I haven't been able to find any tools capable of performing these duties. Any recommendations?

    Read the article

  • Migrate servers without losing any data / time-limited MySQL dump?

    - by inac
    Is there a way to migrate from an old dedicated server to a new one without losing any data in-between - and with no downtime? In the past, I've had to lose MySQL data between the time when the new server goes up (i.e., all files transferred, system up and ready), and when I take the old server down (data still transferred to old until new one takes over). There is also a short period where both are down for DNS, etc., to refresh. Is there a way for MySQL/root to easily transfer all data that was updated/inserted between a certain time frame?

    Read the article

  • Error code 2503 - Cannot install software on Windows 7 (64Bit)

    - by SixfootJames
    A short while ago, I had my hard drive die on me and at the same time my 1Tb backup drive! I took it back to the guy I bought the PC from and although the backup drive could not be recovered, he managed to get my machine working again by making a minor change in the BIOS which then got it out of that continuous loop it found itself in after multiple BSOD episodes. Everything seems to be working fine but yesterday when I tried to save something from Google Chrome, I got and insufficient permission problem and when I try to install software, I get an error of 2503. I have already followed the suggestions here but none of this worked for me. Any suggestions would be appreciated. EDIT: This started happening after I tried running a number of tests to get the machine working, including a previous restore point.

    Read the article

  • Optimize Windows file access over network

    - by Djizeus
    At my company I frequently need to access shared files over a Windows network. These files are located on the other side of the planet, so I guess the file share goes through some kind of VPN over Internet, but I don't control this and it is supposed to be "transparent" for me. However it is extremely slow. Displaying the content of a directory in the file explorer takes about 10s. Even if over the Internet, I did not expect that retrieving a list of file names would be that long. Are there any settings to optimize this from my Windows XP workstation, or is it mostly related to the way the network is configured? The only thing I have found so far is to cache all file names, while by default only short file names are cached (http://support.microsoft.com/kb/843418).

    Read the article

  • Why can't email clients create rules for moving dates like "yesterday"?

    - by Morgan
    I've never seen an email client that I could easily create a rule to do something like "Move messages from yesterday to a folder?" Is there some esoteric reason why this would be difficult? I know I can easily create rules around specific dates, but that isn't the same thing by a long shot; am I missing something? In Outlook 2010 I can create search folders that do sort of this type of thing, but you can't create rules around a search folder... seems like either I am missing something major, or this is terribly short-sided.

    Read the article

  • Fusion 3, Windows 7, frequent blue screens

    - by kenny6127
    Is anyone else seeing this problem? A solution would be great (hey, it's Windows, it's gonna blue screen, just gotta deal with it), but it's also nice to know if it's something specific to my configuration, or if a lot of folks are having the same issue. Here's the details: * MacBook Pro 15" unibody, 4 GB, 2.4 GHz, 10.5.8 * Fusion 3.0.1 * Windows 7 Pro, 32-bit (clean install, not migrated from Boot Camp or anything) Blue screens happen nearly every time the MBP cover is closed for a short period of time (< 3 minutes). If the cover is closed for a half hour or longer, the VM is fine. I'm guessing it might be related to sleep, but that's hard to tell, and the Windows crash dump logs are pretty useless. Thanks!

    Read the article

  • Will installing an Ultra ATA cable backwards affect performance?

    - by GMMan
    I've recently purchased a hard drive upgrade for my Xbox 320GB WD Caviar Blue WD3200AAJB and StarTech.com Ultra ATA/66/100/133 cable IDE66 yes I'm crazy When it came to installing the cable, it was too short (my fault), and there wasn't enough space between the master and slave ends to reach both the DVD drive and the hard drive. The only thing I could do was install the cable backwards and twisting it quite a bit to make it fit. The upgrade works, but reading the manual for the hard drive I replaced (10GB Seagate U Series 5), apparently there is a specific way you have to connect the cable. I don't have that option, so the question comes down to, will my drive performance be at Ultra ATA levels, or is it still performing at original ATA speeds? Is there any way I can test this (benchmarking software for Xbox)?

    Read the article

  • I would like to pipe output of find into input list of scp, how?

    - by user13184
    I'm a novice linux user and I am trying to send a long list of files from one computer to another. The argument list is too long, so I am using find. I am having trouble setting up the expression, though. Can someone help? Here is what I would normally type for a short argument list. scp ./* phogan@computer/directory... Here's I think this might translate into with find. scp find . -name "*" phogan@computer/directory... Maybe I could use piping? Any suggestions would help. Thanks in advance.

    Read the article

  • Ubuntu Lucid (10.04) subpixel font rendering crashes Xorg

    - by user36066
    Hi everyone... I really don't know how to solve this on my own so I thought giving this site a chance. After upgrading to Lucid I ran into some problems. With some experimenting I came to a conclusion that if I enable subpixel smoothing on fonts the moment I start any other application not native to GTK+ (wine, openoffice, wxWidgets, ...) my X server crashes the same moment. At first this seemed like something went wrong during installation. To cut the long story short, after 3 clean installations and whole bunch of experimenting the same thing happens all over again. Strange thing is... if I configure any other font smoothing besides subpixel, everything works like it should. Any thoughs?

    Read the article

  • How to rotate attached monitor to notebook of Sony's Z-series?

    - by user67175
    Is it possible that Sony is selling a top of the line, hugely expensive computer that does not have the basic ability to rotate an attached monitor? Is it possible that the Z-series simply can't do this? The Windows control panel is missing the normal option for "rotation", as is the Nvidia control panel for "orientation" , no additional rotation software works. Sony sales says they do not know the answer to this. Sony technical supports says that the problem lies with Nvidia, Nvidia technical supports says the problem lies with Sony. Any advice for a fix for this short of returning the computer would be greatly appreciated. Also wondering if this problem is common to computers running Windows 7?

    Read the article

  • Stream computer screen to TV via network instead of a USB wireless link

    - by user24559
    I want to stream my computer screen (not just video or a limited amount of content) to my TV via the network. I know there are wireless devices that use USB to tranfer the screen to the TV. However, these are limited to a short distance. What I want to do is stream the data via the network so I can be anywhere within the network and have the data shown on the tv. I am looking for video and sound to transfer. I want the entire computer screen to transfer just like when you connect the computer to the tv via VGA or HDMI and the sound out using the 3.5mm plug. I have been unable to find a unit that allows for the entire computer screen to transfer via the network. I just find the ability to stream video. I am using Windows 7 Ultimate with a quad processor and 16 GB of memory so I have the power to handle the transfer. My tv is hdtv.

    Read the article

  • How do i route TCP connections via TOR? [on hold]

    - by acidzombie24
    I was reading about torchat which is essentially an anonymous chat program. It sounded cool so i wanted to experiment with making my own. First i wrote a test to grab a webpage using Http. Sicne .NET doesnt support SOCKS4A/SOCKS5 i used privoxy and my app worked. Then i switch to a TCP echo test and privoxy doesnt support TCP so i searched and installed 6+ proxy apps (freecap, socat, freeproxy, delegate are the ones i can remember from the top of my head, i also played with putty bc i know it supports tunnels and SOCK5) but i couldnt successfully get any of them to work let alone get it running with my http test that privoxy easily and painlessly did. What may i use to get TCP connections going through TOR? I spent more then 2 hours without success. I don't know if i am looking for a relay, tunnel, forwarder, proxy or a proxychain which all came up in my search. I use the config below for .NET. I need TCP working but i am first testing with http since i know i had it working using privoxy. What apps and configs do i use to get TCP going through tor? <?xml version="1.0" encoding="utf-8" ?> <configuration> <system.net> <defaultProxy enabled="true"> <proxy bypassonlocal="True" proxyaddress="http://127.0.0.1:8118"/> </defaultProxy> <settings> <httpWebRequest useUnsafeHeaderParsing="true"/> </settings> </system.net> </configuration> -edit- Thanks to Bernd i have a solution. Here is the code i ended up writing. It isn't amazing but its fair. static NetworkStream ConnectSocksProxy(string proxyDomain, short proxyPort, string host, short hostPort, TcpClient tc) { tc.Connect(proxyDomain, proxyPort); if (System.Text.RegularExpressions.Regex.IsMatch(host, @"[\:/\\]")) throw new Exception("Invalid Host name. Use FQDN such as www.google.com. Do not have http, a port or / in it"); NetworkStream ns = tc.GetStream(); var HostNameBuf = new ASCIIEncoding().GetBytes(host); var HostPortBuf = BitConverter.GetBytes(IPAddress.HostToNetworkOrder(hostPort)); if (true) //5 { var bufout = new byte[128]; var buflen = 0; ns.Write(new byte[] { 5, 1, 0 }, 0, 3); buflen = ns.Read(bufout, 0, bufout.Length); if (buflen != 2 || bufout[0] != 5 || bufout[1] != 0) throw new Exception(); var buf = new byte[] { 5, 1, 0, 3, (byte)HostNameBuf.Length }; var mem = new MemoryStream(); mem.Write(buf, 0, buf.Length); mem.Write(HostNameBuf, 0, HostNameBuf.Length); mem.Write(new byte[] { HostPortBuf[0], HostPortBuf[1] }, 0, 2); var memarr = mem.ToArray(); ns.Write(memarr, 0, memarr.Length); buflen = ns.Read(bufout, 0, bufout.Length); if (bufout[0] != 5 || bufout[1] != 0) throw new Exception(); } else //4a { var bufout = new byte[128]; var buflen = 0; var mem = new MemoryStream(); mem.WriteByte(4); mem.WriteByte(1); mem.Write(HostPortBuf, 0, 2); mem.Write(BitConverter.GetBytes(IPAddress.HostToNetworkOrder(1)), 0, 4); mem.WriteByte(0); mem.Write(HostNameBuf, 0, HostNameBuf.Length); mem.WriteByte(0); var memarr = mem.ToArray(); ns.Write(memarr, 0, memarr.Length); buflen = ns.Read(bufout, 0, bufout.Length); if (buflen != 8 || bufout[0] != 0 || bufout[1] != 90) throw new Exception(); } return ns; } Usage using (TcpClient client = new TcpClient()) using (var ns = ConnectSocksProxy("127.0.0.1", 9050, "website.com", 80, client)) {...}

    Read the article

  • Access boot menu from windows 7

    - by repsak
    I busted my keyboard on my laptop, and now my computer rarely starts since it doesnt ignore this problem when booting. So what i want to do, is to disable my keyboard from the boot menu. But I cant access the boot menu since my keyboard doesnt work. I have an addtional keybaord via USB but that one doesnt work before windows is booted. So in short, what I want is to access my laptops boot menu now when im on windows via cmd, but im not sure how to do it.

    Read the article

  • Access boot menu from windows 7

    - by repsak
    I busted my keyboard on my laptop, and now my computer rarely starts since it doesnt ignore this problem when booting. So what i want to do, is to disable my keyboard from the boot menu. But I cant access the boot menu since my keyboard doesnt work. I have an addtional keybaord via USB but that one doesnt work before windows is booted. So in short, what I want is to access my laptops boot menu now when im on windows via cmd, but im not sure how to do it.

    Read the article

< Previous Page | 89 90 91 92 93 94 95 96 97 98 99 100  | Next Page >