Search Results

Search found 52807 results on 2113 pages for 'system tables'.

Page 97/2113 | < Previous Page | 93 94 95 96 97 98 99 100 101 102 103 104  | Next Page >

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Does OSB has any database dependency?

    - by Manoj Neelapu
    Major functionality of OSB is database independent. Most of the internal data-structures that re required by OSB are stored in-memory.Reporting functionality of OSB requires DB tables be accessible.http://download.oracle.com/docs/cd/E14571_01/doc.1111/e15017/before.htm#BABCJHDJ It should hover be noted that we can still run OSB with out creating any tables on database.In such cases the reporting functionality cannot be used where as other functions in OSB will work just as fine.We also see few errors in the log file indicating the absence of these tables which we can ignore.  If reporting function is required we will have to install few tables. http://download.oracle.com/docs/cd/E14571_01/doc.1111/e15017/before.htm#BABBBEHD indicates running RCU recommended. OSB reporting tables are bundled along with SOA schema in RCU. OSB requires two simple tables for reporting functionality and installing complete SOA schema is little far fetched. SOA schema contains lot of tables which OSB doesn't require at all. More over OSB tables are too simple to require a tool like an RCU.Solution to it would be to manually create those tables required for OSB. To make  life easier the definition of tables is available in dbscripts folder under OSB_HOME.eg. D:\Oracle\Middleware\osb\11gPS2\Oracle_OSB1\dbscripts. $OSB_HOME=D:\Oracle\Middleware\osb\11gPS2\Oracle_OSB1If you are not planning to use reporting feature in OSB, then we can also delete the JDBC data sources that comes along with standard OSB domain.WLST script to delete cgDataSources from OSB domain . OSB will work fine with out DB tables and JDBC Datasource.

    Read the article

  • SQL SERVER – 2012 – List All The Column With Specific Data Types in Database

    - by pinaldave
    5 years ago I wrote script SQL SERVER – 2005 – List All The Column With Specific Data Types, when I read it again, it is very much relevant and I liked it. This is one of the script which every developer would like to keep it handy. I have upgraded the script bit more. I have included few additional information which I believe I should have added from the beginning. It is difficult to visualize the final script when we are writing it first time. I use every script which I write on this blog, the matter of the fact, I write only those scripts here which I was using at that time. It is quite possible that as time passes by my needs are changing and I change my script. Here is the updated script of this subject. If there are any user data types, it will list the same as well. SELECT s.name AS 'schema', ts.name AS TableName, c.name AS column_name, c.column_id, SCHEMA_NAME(t.schema_id) AS DatatypeSchema, t.name AS Datatypename ,t.is_user_defined, t.is_assembly_type ,c.is_nullable, c.max_length, c.PRECISION, c.scale FROM sys.columns AS c INNER JOIN sys.types AS t ON c.user_type_id=t.user_type_id INNER JOIN sys.tables ts ON ts.OBJECT_ID = c.OBJECT_ID INNER JOIN sys.schemas s ON s.schema_id = t.schema_id ORDER BY s.name, ts.name, c.column_id I would be very interested to see your script which lists all the columns of the database with data types. If I am missing something in my script, I will modify it based on your comment. This way this page will be a good bookmark for the future for all of us. Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: PostADay, SQL, SQL Authority, SQL DMV, SQL Query, SQL Server, SQL System Table, SQL Tips and Tricks, T SQL, Technology

    Read the article

  • SQL SERVER – Validating Unique Columnname Across Whole Database

    - by pinaldave
    I sometimes come across very strange requirements and often I do not receive a proper explanation of the same. Here is the one of those examples. Asker: “Our business requirement is when we add new column we want it unique across current database.” Pinal: “Why do you have such requirement?” Asker: “Do you know the solution?” Pinal: “Sure I can come up with the answer but it will help me to come up with an optimal answer if I know the business need.” Asker: “Thanks – what will be the answer in that case.” Pinal: “Honestly I am just curious about the reason why you need your column name to be unique across database.” (Silence) Pinal: “Alright – here is the answer – I guess you do not want to tell me reason.” Option 1: Check if Column Exists in Current Database IF EXISTS (  SELECT * FROM sys.columns WHERE Name = N'NameofColumn') BEGIN SELECT 'Column Exists' -- add other logic END ELSE BEGIN SELECT 'Column Does NOT Exists' -- add other logic END Option 2: Check if Column Exists in Current Database in Specific Table IF EXISTS (  SELECT * FROM sys.columns WHERE Name = N'NameofColumn' AND OBJECT_ID = OBJECT_ID(N'tableName')) BEGIN SELECT 'Column Exists' -- add other logic END ELSE BEGIN SELECT 'Column Does NOT Exists' -- add other logic END I guess user did not want to share the reason why he had a unique requirement of having column name unique across databases. Here is my question back to you – have you faced a similar situation ever where you needed unique column name across a database. If not, can you guess what could be the reason for this kind of requirement?  Additional Reference: SQL SERVER – Query to Find Column From All Tables of Database Reference: Pinal Dave (http://blog.SQLAuthority.com) Filed under: PostADay, SQL, SQL Authority, SQL Query, SQL Server, SQL System Table, SQL Tips and Tricks, T SQL, Technology

    Read the article

  • Execute a SQlite command with Entity Framework

    - by Filimindji
    Hi everybody, I use a SQLite database and Entity Framework (with .net framework 3.5). I'm trying to execute a simple SQL non query command to create a new table in this datase. My Entity Framework already contains the object model for this table : I just want to generate the corresponding table using a command. (By the way, there is maybe a better way to do this. Any ideas someone :) My problem is that I'm not able to execute any command, even the simple commands. Here is my code : EntityConnection entityConnection = new EntityConnection(entitiesConnectionString); Entities db = new Entities(entityConnection); DbCommand command = db.Connection.CreateCommand(); command.CommandText ="CREATE TABLE MyTable (Id int NOT NULL, OtherTable_Id nchar(40) REFERENCES OtherTable (Id) On Delete CASCADE On Update NO ACTION, SomeData nvarchar(1024) NOT NULL, Primary Key(Id) );"; command.ExecuteNonQuery(); I got this error : System.Data.EntitySqlException: The query syntax is not valid., near identifier 'TABLE', line 1, column 8. at System.Data.Common.EntitySql.CqlParser.yyerror(String s) at System.Data.Common.EntitySql.CqlParser.yyparse() at System.Data.Common.EntitySql.CqlParser.Parse(String query) at System.Data.Common.EntitySql.CqlQuery.Parse(String query, ParserOptions parserOptions) at System.Data.Common.EntitySql.CqlQuery.Compile(String query, Perspective perspective, ParserOptions parserOptions, Dictionary`2 parameters, Dictionary`2 variables, Boolean validateTree) at System.Data.EntityClient.EntityCommand.MakeCommandTree() at System.Data.EntityClient.EntityCommand.CreateCommandDefinition() at System.Data.EntityClient.EntityCommand.TryGetEntityCommandDefinitionFromQueryCache(EntityCommandDefinition& entityCommandDefinition) at System.Data.EntityClient.EntityCommand.GetCommandDefinition() at System.Data.EntityClient.EntityCommand.InnerPrepare() at System.Data.EntityClient.EntityCommand.ExecuteReader(CommandBehavior behavior) at System.Data.EntityClient.EntityCommand.ExecuteScalar[T_Result](Func`2 resultSelector) It's seem to be a syntax error, but I can't figure where is the problem and how to resolve it. The entityConnection is ok because I can use any entities generated with EF. I tried with another simple command, but it throw another exception : DbCommand command = db.Connection.CreateCommand(); command.CommandText = "SELECT COUNT(Id) From OtherTable;"; int result = (int)command.ExecuteScalar(); And I got this error, witch is not the same, but may help : System.Data.EntitySqlException: 'Groupe' could not be resolved in the current scope or context. Make sure that all referenced variables are in scope, that required schemas are loaded, and that namespaces are referenced correctly., near simple identifier, line 1, column 23. at System.Data.Common.EntitySql.CqlErrorHelper.ReportIdentifierError(Expr expr, SemanticResolver sr) at System.Data.Common.EntitySql.SemanticAnalyzer.ConvertIdentifier(Expr expr, SemanticResolver sr) at System.Data.Common.EntitySql.SemanticAnalyzer.Convert(Expr astExpr, SemanticResolver sr) at System.Data.Common.EntitySql.SemanticAnalyzer.ProcessAliasedFromClauseItem(AliasExpr aliasedExpr, SemanticResolver sr) at System.Data.Common.EntitySql.SemanticAnalyzer.ProcessFromClauseItem(FromClauseItem fromClauseItem, SemanticResolver sr) at System.Data.Common.EntitySql.SemanticAnalyzer.ProcessFromClause(FromClause fromClause, SemanticResolver sr) at System.Data.Common.EntitySql.SemanticAnalyzer.ConvertQuery(Expr expr, SemanticResolver sr) at System.Data.Common.EntitySql.SemanticAnalyzer.Convert(Expr astExpr, SemanticResolver sr) at System.Data.Common.EntitySql.SemanticAnalyzer.ConvertRootExpression(Expr astExpr, SemanticResolver sr) at System.Data.Common.EntitySql.SemanticAnalyzer.ConvertGeneralExpression(Expr astExpr, SemanticResolver sr) at System.Data.Common.EntitySql.CqlQuery.AnalyzeSemantics(Expr astExpr, Perspective perspective, ParserOptions parserOptions, Dictionary`2 parameters, Dictionary`2 variables) at System.Data.Common.EntitySql.CqlQuery.Compile(String query, Perspective perspective, ParserOptions parserOptions, Dictionary`2 parameters, Dictionary`2 variables, Boolean validateTree) at System.Data.EntityClient.EntityCommand.MakeCommandTree() at System.Data.EntityClient.EntityCommand.CreateCommandDefinition() at System.Data.EntityClient.EntityCommand.TryGetEntityCommandDefinitionFromQueryCache(EntityCommandDefinition& entityCommandDefinition) at System.Data.EntityClient.EntityCommand.GetCommandDefinition() at System.Data.EntityClient.EntityCommand.InnerPrepare() at System.Data.EntityClient.EntityCommand.ExecuteReader(CommandBehavior behavior) at System.Data.EntityClient.EntityCommand.ExecuteScalar[T_Result](Func`2 resultSelector)

    Read the article

  • [Flex 4 and .Net] Retrieving tables from SQL database

    - by mG
    Hi everyone, As the title says, I want to retrieve tables of data from a SQL database, using Flex 4 and .Net WebService. I'm new to both Flex and DotNet. Please tell me a proper way to do it. This is what I've done so far: Retrieving an array of string: (this works) .Net: [WebMethod] public String[] getTestArray() { String[] arStr = { "AAA", "BBB", "CCC", "DDD" }; return arStr; } Flex 4: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" minWidth="955" minHeight="600"> <fx:Script> <![CDATA[ import mx.collections.ArrayCollection; import mx.controls.Alert; import mx.rpc.events.ResultEvent; [Bindable] private var ac:ArrayCollection = new ArrayCollection(); protected function btn_clickHandler(event:MouseEvent):void { ws.getTestArray(); } protected function ws_resultHandler(event:ResultEvent):void { ac = event.result as ArrayCollection; Alert.show(ac.toString()); } ]]> </fx:Script> <fx:Declarations> <s:WebService id="ws" wsdl="http://localhost:50582/Service1.asmx?WSDL" result="ws_resultHandler(event)"/> </fx:Declarations> <s:Button x="10" y="30" label="Button" id="btn" click="btn_clickHandler(event)"/> </s:Application> Retrieving a DataTable: (this does not work) DotNet: [WebMethod] public DataTable getUsers() { DataTable dt = new DataTable("Users"); SqlConnection conn = new SqlConnection("server = 192.168.1.50; database = MyDatabase; user id = sa; password = 1234; integrated security = false"); SqlDataAdapter da = new SqlDataAdapter("select vFName, vLName, vEmail from Users", conn); da.Fill(dt); return dt; } Flex 4: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" minWidth="955" minHeight="600"> <fx:Script> <![CDATA[ import mx.collections.ArrayCollection; import mx.controls.Alert; import mx.rpc.events.ResultEvent; [Bindable] private var ac:ArrayCollection = new ArrayCollection(); protected function btn_clickHandler(event:MouseEvent):void { ws.getUsers(); } protected function ws_resultHandler(event:ResultEvent):void { ac = event.result as ArrayCollection; Alert.show(ac.toString()); } ]]> </fx:Script> <fx:Declarations> <s:WebService id="ws" wsdl="http://localhost:50582/Service1.asmx?WSDL" result="ws_resultHandler(event)"/> </fx:Declarations> <s:Button x="10" y="30" label="Button" id="btn" click="btn_clickHandler(event)"/> </s:Application>

    Read the article

  • Comparing 2 tables column values and copying the next column content to the second table

    - by Sullan
    Hi All.. I am comparing between two tables first column each. If there is find a match i am copying the text from the adjacent cell of the first table to the second table. I am able to compare strings and get the value, but finding it difficult to print it in the second table. I am getting the value in the var "replaceText", but how to print it in the second table ?? Please help... Sample code is as follows.. <script type="text/javascript"> jQuery.noConflict(); jQuery(document).ready(function(){ jQuery('.itemname').each(function(){ var itemName = jQuery(this).text(); jQuery('.comparerow').each(function() { var compareRow = jQuery(this).text(); if (itemName == compareRow) { var replaceText = jQuery(this).next('td').text(); alert(replaceText); } }); }); }); </script> HTML is as follows <table width="100%"><thead> <tr> <th align="left" >Name</th><th>Description</th></tr></thead> <tbody> <tr> <td class="comparerow">IX0001</td> <td class="desc">Desc 1 </td> </tr> <tr> <td class="comparerow">IX0002</td> <td class="desc" >Desc 2 </td> </tr> <tr> <td class="comparerow">IX0003</td> <td class="desc">Desc 3 </td> </tr> <tr> <td class="comparerow">IX0004</td> <td class="desc">Desc 4 </td> </tr> </tbody> </table> <br /> <table width="100%"> <tr> <th>Name</th><th>Description</th> </tr> <tr > <td class="itemname">IX0001</td><td></td> </tr> <tr> <td class="itemname">IX0002</td><td></td> </tr> <tr> <td class="itemname">IX0003</td><td></td> </tr> </table>

    Read the article

  • RSACryptoServiceProvider CryptographicException System Cannot Find the File Specified under ASP.NET

    - by Will Hughes
    I have an application which is making use of the RSACryptoServiceProvider to decrypt some data using a known private key (stored in a variable). When the IIS Application Pool is configured to use Network Service, everything runs fine. However, when we configure the IIS Application Pool to run the code under a different Identity, we get the following: System.Security.Cryptography.CryptographicException: The system cannot find the file specified. at System.Security.Cryptography.Utils.CreateProvHandle(CspParameters parameters, Boolean randomKeyContainer) at System.Security.Cryptography.RSACryptoServiceProvider.ImportParameters(RSAParameters parameters) at System.Security.Cryptography.RSA.FromXmlString(String xmlString) The code is something like this: byte[] input; byte[] output; string private_key_xml; var provider = new System.Cryptography.RSACryptoServiceProvider(this.m_key.Key_Size); provider.FromXmlString(private_key_xml); // Fails Here when Application Pool Identity != Network Service ouput = provider.Decrypt(input, false); // False = Use PKCS#1 v1.5 Padding There are resources which attempt to answer it by stating that you should give the user read access to the machine key store - however there is no definitive answer to solve this issue. Environment: IIS 6.0, Windows Server 2003 R2, .NET 3.5 SP1

    Read the article

  • Start/Stop Window Service from ASP.NET page

    - by kaushalparik27
    Last week, I needed to complete one task on which I am going to blog about in this entry. The task is "Create a control panel like webpage to control (Start/Stop) Window Services which are part of my solution installed on computer where the main application is hosted". Here are the important points to accomplish:[1] You need to add System.ServiceProcess reference in your application. This namespace holds ServiceController Class to access the window service.[2] You need to check the status of the window services before you explicitly start or stop it.[3] By default, IIS application runs under ASP.NET account which doesn't have access rights permission to window service. So, Very Important part of the solution is: Impersonation. You need to impersonate the application/part of the code with the User Credentials which is having proper rights and permission to access the window service. If you try to access window service it will generate "access denied" error.The alternatives are: You can either impersonate whole application by adding Identity tag in web.cofig as:        <identity impersonate="true" userName="" password=""/>This tag will be under System.Web section. the "userName" and "password" will be the credentials of the user which is having rights to access the window service. But, this would not be a wise and good solution; because you may not impersonate whole website like this just to have access window service (which is going to be a small part of code).Second alternative is: Only impersonate part of code where you need to access the window service to start or stop it. I opted this one. But, to be fair; I am really unaware of the code part for impersonation. So, I just googled it and injected the code in my solution in a separate class file named as "Impersonate" with required static methods. In Impersonate class; impersonateValidUser() is the method to impersonate a part of code and undoImpersonation() is the method to undo the impersonation. Below is one example:  You need to provide domain name (which is "." if you are working on your home computer), username and password of appropriate user to impersonate.[4] Here, it is very important to note that: You need to have to store the Access Credentials (username and password) which you are going to user for impersonation; to some secured and encrypted format. I have used Machinekey Encryption to store the value encrypted value inside database.[5] So now; The real part is to start or stop a window service. You are almost done; because ServiceController class has simple Start() and Stop() methods to start or stop a window service. A ServiceController class has parametrized constructor that takes name of the service as parameter.Code to Start the window service: Code to Stop the window service: Isn't that too easy! ServiceController made it easy :) I have attached a working example with this post here to start/stop "SQLBrowser" service where you need to provide proper credentials who have permission to access to window service.  hope it would helps./.

    Read the article

  • System.Windows.Ria.Controls and POCO

    - by jvcoach23
    I'm trying to figure out how to use POCO for silverlight use. I found an article that appears it will step me through the basics. However, it has in it a reference to the System.Windows.Ria.Controls. i don't have that on my machine.. i found System.Windows.Ria but not one that has teh control on it. I just downloaded teh RIA beta today and installed it.. so should have the latest and greatest. Anyway.. Here is the link to the article... link text and here is the code in the xaml they refer to. <UserControl x:Class="Try1Silverlight.MainPage" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:d="http://schemas.microsoft.com/expression/blend/2008" xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006" xmlns:data="clr-namespace:System.Windows.Controls;assembly=System.Windows.Controls.Data" xmlns:riaControls="clr-namespace:System.Windows.Controls;assembly=System.Windows.Ria.Controls" xmlns:domain="clr-namespace:Try1Silverlight.Web" mc:Ignorable="d" d:DesignWidth="640" d:DesignHeight="480" <data:DataGrid x:Name="CustomerList" ItemsSource="{Binding Data, ElementName=CustomerSource}"> </data:DataGrid> What have i done wrong that the Ria.Control is not there. thanks shannon

    Read the article

  • Banshee encountered a Fatal Error (sqlite error 11: database disk image is malformed)

    - by Nik
    I am running ubuntu 10.10 Maverick Meerkat, and recently I am helping in testing out indicator-weather using the unstable buids. However there was a bug which caused my system to freeze suddenly (due to indicator-weather not ubuntu) and the only way to recover is to do a hard reset of the system. This happened a couple of times. And when i tried to open banshee after a couple of such resets I get the following fatal error which forces me to quit banshee. The screenshot is not clear enough to read the error, so I am posting it below, An unhandled exception was thrown: Sqlite error 11: database disk image is malformed (SQL: BEGIN TRANSACTION; DELETE FROM CoreSmartPlaylistEntries WHERE SmartPlaylistID IN (SELECT SmartPlaylistID FROM CoreSmartPlaylists WHERE IsTemporary = 1); DELETE FROM CoreSmartPlaylists WHERE IsTemporary = 1; COMMIT TRANSACTION) at Hyena.Data.Sqlite.Connection.CheckError (Int32 errorCode, System.String sql) [0x00000] in <filename unknown>:0 at Hyena.Data.Sqlite.Connection.Execute (System.String sql) [0x00000] in <filename unknown>:0 at Hyena.Data.Sqlite.HyenaSqliteCommand.Execute (Hyena.Data.Sqlite.HyenaSqliteConnection hconnection, Hyena.Data.Sqlite.Connection connection) [0x00000] in <filename unknown>:0 Exception has been thrown by the target of an invocation. at System.Reflection.MonoCMethod.Invoke (System.Object obj, BindingFlags invokeAttr, System.Reflection.Binder binder, System.Object[] parameters, System.Globalization.CultureInfo culture) [0x00000] in <filename unknown>:0 at System.Reflection.MonoCMethod.Invoke (BindingFlags invokeAttr, System.Reflection.Binder binder, System.Object[] parameters, System.Globalization.CultureInfo culture) [0x00000] in <filename unknown>:0 at System.Reflection.ConstructorInfo.Invoke (System.Object[] parameters) [0x00000] in <filename unknown>:0 at System.Activator.CreateInstance (System.Type type, Boolean nonPublic) [0x00000] in <filename unknown>:0 at System.Activator.CreateInstance (System.Type type) [0x00000] in <filename unknown>:0 at Banshee.Gui.GtkBaseClient.Startup () [0x00000] in <filename unknown>:0 at Hyena.Gui.CleanRoomStartup.Startup (Hyena.Gui.StartupInvocationHandler startup) [0x00000] in <filename unknown>:0 .NET Version: 2.0.50727.1433 OS Version: Unix 2.6.35.27 Assembly Version Information: gkeyfile-sharp (1.0.0.0) Banshee.AudioCd (1.9.0.0) Banshee.MiniMode (1.9.0.0) Banshee.CoverArt (1.9.0.0) indicate-sharp (0.4.1.0) notify-sharp (0.4.0.0) Banshee.SoundMenu (1.9.0.0) Banshee.Mpris (1.9.0.0) Migo (1.9.0.0) Banshee.Podcasting (1.9.0.0) Banshee.Dap (1.9.0.0) Banshee.LibraryWatcher (1.9.0.0) Banshee.MultimediaKeys (1.9.0.0) Banshee.Bpm (1.9.0.0) Banshee.YouTube (1.9.0.0) Banshee.WebBrowser (1.9.0.0) Banshee.Wikipedia (1.9.0.0) pango-sharp (2.12.0.0) Banshee.Fixup (1.9.0.0) Banshee.Widgets (1.9.0.0) gio-sharp (2.14.0.0) gudev-sharp (1.0.0.0) Banshee.Gio (1.9.0.0) Banshee.GStreamer (1.9.0.0) System.Configuration (2.0.0.0) NDesk.DBus.GLib (1.0.0.0) gconf-sharp (2.24.0.0) Banshee.Gnome (1.9.0.0) Banshee.NowPlaying (1.9.0.0) Mono.Cairo (2.0.0.0) System.Xml (2.0.0.0) Banshee.Core (1.9.0.0) Hyena.Data.Sqlite (1.9.0.0) System.Core (3.5.0.0) gdk-sharp (2.12.0.0) Mono.Addins (0.4.0.0) atk-sharp (2.12.0.0) Hyena.Gui (1.9.0.0) gtk-sharp (2.12.0.0) Banshee.ThickClient (1.9.0.0) Nereid (1.9.0.0) NDesk.DBus.Proxies (0.0.0.0) Mono.Posix (2.0.0.0) NDesk.DBus (1.0.0.0) glib-sharp (2.12.0.0) Hyena (1.9.0.0) System (2.0.0.0) Banshee.Services (1.9.0.0) Banshee (1.9.0.0) mscorlib (2.0.0.0) Platform Information: Linux 2.6.35-27-generic i686 unknown GNU/Linux Disribution Information: [/etc/lsb-release] DISTRIB_ID=Ubuntu DISTRIB_RELEASE=10.10 DISTRIB_CODENAME=maverick DISTRIB_DESCRIPTION="Ubuntu 10.10" [/etc/debian_version] squeeze/sid Just to make it clear, this happened only after the hard resets and not before. I used to use banshee everyday and it worked perfectly. Can anyone help me fix this?

    Read the article

  • Users in database server or database tables

    - by Batcat
    Hi all, I came across an interesting issue about client server application design. We have this browser based management application where it has many users using the system. So obvisously within that application we have an user management module within it. I have always thought having an user table in the database to keep all the login details was good enough. However, a senior developer said user management should be done in the database server layer if not then is poorly designed. What he meant was, if a user wants to use the application then a user should be created in the user table AND in the database server as a user account as well. So if I have 50 users using my applications, then I should have 50 database server user logins. I personally think having just one user account in the database server for this database was enough. Just grant this user with the allowed privileges to operate all the necessary operation need by the application. The users that are interacting with the application should have their user accounts created and managed within the database table as they are more related to the application layer. I don't see and agree there is need to create a database server user account for every user created for the application in the user table. A single database server user should be enough to handle all the query sent by the application. Really hope to hear some suggestions / opinions and whether I'm missing something? performance or security issues? Thank you very much.

    Read the article

  • System.out.println() does not operate in Akka actor

    - by faisal abdulai
    I am kind of baffled by this encointer. I am working an akka project that was created as a maven projecct and imported into eclipse using the mvn eclipse:eclipse command. the akka actor has the system println method just to make it easy to do read the functions and methods invoked. However any time I run the akka system, the println command does not print any thing to the eclipse console but I do not get any error messages. does any one have any idea about this. below is a code snippet. public class MasterActor extends UntypedActor { /** * */ ActorSystem system = ActorSystem.create("container"); ActorRef worker1; //public MasterActor(){} @Override public void onReceive(Object message) throws Exception { System.out.println(" Master Actor 5"); if(message instanceof GesturePoints) { //GesturePoints gp = (GesturePoints) message; System.out.println(" Master Actor 1"); try { worker1.tell(message, getSelf()); System.out.println(" Master Actor 2"); } catch (Exception e) { getSender().tell(new akka.actor.Status.Failure(e), getSelf()); throw e; } } else{ unhandled(message);} } public void preStart() { worker1 = getContext().actorFor("akka://[email protected]:2553/user/workerActor"); } } don't know whether it is a bug in eclipse. thank you.

    Read the article

  • ORACLE: can we create global temp tables or any tables in stored proc?

    - by mrp
    Hi, below is the stored proc I wrote: create or replace procedure test005 as begin CREATE GLOBAL TEMPORARY TABLE TEMP_TRAN ( COL1 NUMBER(9), COL2 VARCHAR2(30), COL3 DATE ) ON COMMIT PRESERVE ROWS / INSERT INTO TEMP_TRAN VALUES(1,'D',sysdate); INSERT INTO TEMP_TRAN VALUES(2,'I',sysdate); INSERT INTO TEMP_TRAN VALUES(3,'s',sysdate); COMMIT; end; when i executed it , i get an error message mentioning: create or replace procedure test005 as begin CREATE GLOBAL TEMPORARY TABLE TEMP_TRAN ( COL1 NUMBER(9), COL2 VARCHAR2(30), COL3 DATE ) ON COMMIT PRESERVE ROWS / INSERT INTO TEMP_TRAN VALUES(1,'D',sysdate); INSERT INTO TEMP_TRAN VALUES(2,'I',sysdate); INSERT INTO TEMP_TRAN VALUES(3,'s',sysdate); COMMIT; end; Error at line 1 ORA-00955: name is already used by an existing object Script Terminated on line 1. I tried to drop the TEMP_TRAN and it says table doesn't exist. So there is no TEMP_TRAN table existed in system. why am I getting this error? I am using TOAD to create this stored proc. Any help would be highly appreciated.

    Read the article

  • Combinationally unique MySQL tables

    - by Jack Webb-Heller
    So, here's the problem (it's probably an easy one :P) This is my table structure: CREATE TABLE `users_awards` ( `user_id` int(11) NOT NULL, `award_id` int(11) NOT NULL, `duplicate` int(11) NOT NULL DEFAULT '0', UNIQUE KEY `award_id` (`award_id`) ) ENGINE=MyISAM DEFAULT CHARSET=latin1 So it's for a user awards system. I don't want my users to be granted the same award multiple times, which is why I have a 'duplicate' field. The query I'm trying is this (with sample data of 3 and 2) : INSERT INTO users_awards (user_id, award_id) VALUES ('3','2') ON DUPLICATE KEY UPDATE duplicate=duplicate+1 So my MySQL is a little rusty, but I set user_id to be a primary key, and award_id to be a UNIQUE key. This (kind of) created the desired effect. When user 1 was given award 2, it entered. If he/she got this twice, only one row would be in the table, and duplicate would be set to 1. And again, 2, etc. When user 2 was given award 1, it entered. If he/she got this twice, duplicate updated, etc. etc. But when user 1 is given award 1 (after user 2 has already been awarded it), user 2 (with award 1)'s duplicate field increases and nothing is added to user 1. Sorry if that's a little n00bish. Really appreciate the help! Jack

    Read the article

  • Non-normalized association with legacy tables in Rails and ActiveRecord

    - by Thomas Holmström
    I am building a Rails application accessing a legacy system. The data model contains Customers which can have one or more Subscriptions. A Subscription always belong to one and only one Customer. Though not needed, this association is represented through a join table "subscribes", which do not have an id column: Column | Type | Modifiers -----------------+---------+----------- customer_id | integer | not null subscription_id | integer | not null I have this coded as a has_and_belongs_to_many declarations in both Customer and Subscription class Customer < Activerecord::Base has_and_belongs_to_many :subscriptions, :join_table => "subscribes", :foreign_key => "customer_id", :association_foreign_key => "subscription_id" end class Subscription < Activerecord::Base has_and_belongs_to_many :customers, :join_table => "subscribes", :foreign_key => "subscription_id", :association_foreign_key => "customer_id" end The problem I have is that there can only ever be one customer for each subscription, not many, and the join table will always contain at most one row with a certain customer_id. And thus, I don't want the association "customers" on a Subscription which returns an array of (at most one) Customer, I really do want the relation "customer" which returns the Customer associated. Is there any way to force ActiveRecord to make this a 1-to-N relation even though the join table itself seems to make it an N-to-M relation? --Thomas

    Read the article

  • c++ tables of unions and structures

    - by newbDeveloper
    I was told to write a program, that creates a union and structure, then creates two-element arrays of unions and structures and fills their fields. I have created a union and a structure, but how to fill their fields in arrays ? #include <iostream> #include <stdlib.h> #include <stdio.h> using namespace std; union complex; union complex{ int i1; long double ld1; } u; struct Person { char* name; int age; bool sex; void show(){ printf("name %s, age %2.0d, sex %1d\n", name , age, sex); }; } person; int main(void) { Person *o = new Person[2]; complex *un = new complex[2]; un[0]->i1=i; system("pause"); return 0; } I've tried un[0]-i1=i; but it's not the proper way to do this.

    Read the article

  • Database with 5 Tables with Insert and Select

    - by kirbby
    hi guys, my problem is that i have 5 tables and need inserts and selects. what i did is for every table a class and there i wrote the SQL Statements like this public class Contact private static String IDCont = "id_contact"; private static String NameCont = "name_contact"; private static String StreetCont = "street_contact"; private static String Street2Cont = "street2_contact"; private static String Street3Cont = "street3_contact"; private static String ZipCont = "zip_contact"; private static String CityCont = "city_contact"; private static String CountryCont = "country_contact"; private static String Iso2Cont = "iso2_contact"; private static String PhoneCont = "phone_contact"; private static String Phone2Cont = "phone2_contact"; private static String FaxCont = "fax_contact"; private static String MailCont = "mail_contact"; private static String Mail2Cont = "mail2_contact"; private static String InternetCont = "internet_contact"; private static String DrivemapCont = "drivemap_contact"; private static String PictureCont = "picture_contact"; private static String LatitudeCont = "latitude_contact"; private static String LongitudeCont = "longitude_contact"; public static final String TABLE_NAME = "contact"; public static final String SQL_CREATE = "CREATE TABLE IF NOT EXISTS " + TABLE_NAME + "(" + IDCont + "INTEGER not NULL," + NameCont + " TEXT not NULL," + StreetCont + " TEXT," + Street2Cont + " TEXT," + Street3Cont + " TEXT," + ZipCont + " TEXT," + CityCont + " TEXT," + CountryCont + " TEXT," + Iso2Cont + " TEXT," + PhoneCont + " TEXT," + Phone2Cont + " TEXT," + FaxCont + " TEXT," + MailCont + " TEXT," + Mail2Cont + " TEXT," + InternetCont + " TEXT," + //website of the contact DrivemapCont + " TEXT," + //a link to a drivemap to the contact PictureCont + " TEXT," + //a photo of the contact building (contact is not a person) LatitudeCont + " TEXT," + LongitudeCont + " TEXT," + "primary key(id_contact)" + "foreign key(iso2)"; and my insert looks like this public boolean SQL_INSERT_CONTACT(int IDContIns, String NameContIns, String StreetContIns, String Street2ContIns, String Street3ContIns, String ZipContIns, String CityContIns, String CountryContIns, String Iso2ContIns, String PhoneContIns, String Phone2ContIns, String FaxContIns, String MailContIns, String Mail2ContIns, String InternetContIns, String DrivemapContIns, String PictureContIns, String LatitudeContIns, String LongitudeContIns) { try{ db.execSQL("INSERT INTO " + "contact" + "(" + IDCont + ", " + NameCont + ", " + StreetCont + ", " + Street2Cont + ", " + Street3Cont + ", " + ZipCont + ", " + CityCont + ", " + CountryCont + ", " + Iso2Cont + ", " + PhoneCont + ", " + Phone2Cont + ", " + FaxCont + ", " + MailCont + ", " + Mail2Cont + ", " + InternetCont + ", " + DrivemapCont + ", " + PictureCont + ", " + LatitudeCont + ", " + LongitudeCont + ") " + "VALUES (" + IDContIns + ", " + NameContIns +", " + StreetContIns + ", " + Street2ContIns + ", " + Street3ContIns + ", " + ZipContIns + ", " + CityContIns + ", " + CountryContIns + ", " + Iso2ContIns + ", " + PhoneContIns + ", " + Phone2ContIns + ", " + FaxContIns + ", " + MailContIns + ", " + Mail2ContIns + ", " + InternetContIns + ", " + DrivemapContIns + ", " + PictureContIns + ", " + LatitudeContIns + ", " + LongitudeContIns +")"); return true; } catch (SQLException e) { return false; } } i have a DBAdapter class there i created the database public class DBAdapter { public static final String DB_NAME = "mol.db"; private static final int DB_VERSION = 1; private static final String TAG = "DBAdapter"; //to log private final Context context; private SQLiteDatabase db; public DBAdapter(Context context) { this.context = context; OpenHelper openHelper = new OpenHelper(this.context); this.db = openHelper.getWritableDatabase(); } public static class OpenHelper extends SQLiteOpenHelper { public OpenHelper(Context context) { super(context, DB_NAME, null, DB_VERSION); } @Override public void onCreate(SQLiteDatabase db) { // TODO Auto-generated method stub db.execSQL(Contact.SQL_CREATE); db.execSQL(Country.SQL_CREATE); db.execSQL(Picture.SQL_CREATE); db.execSQL(Product.SQL_CREATE); db.execSQL(Project.SQL_CREATE); } @Override public void onUpgrade(SQLiteDatabase db, int oldVersion, int newVersion) { // TODO Auto-generated method stub Log.w(TAG, "Upgrading database from version " + oldVersion + " to " + newVersion + ", which will destroy all old data"); db.execSQL(Contact.SQL_DROP); db.execSQL(Country.SQL_DROP); db.execSQL(Picture.SQL_DROP); db.execSQL(Product.SQL_DROP); db.execSQL(Project.SQL_DROP); onCreate(db); } i found so many different things and tried them but i didn't get anything to work... i need to know how can i access the database in my activity and how i can get the insert to work and is there sth wrong in my code? thanks for your help thats how i tried to get it into my activity public class MainTabActivity extends TabActivity { private Context context; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.maintabactivity); TabHost mTabHost = getTabHost(); Intent intent1 = new Intent().setClass(this,MapOfLight.class); //Intent intent2 = new Intent().setClass(this,Test.class); //Testactivity //Intent intent2 = new Intent().setClass(this,DetailView.class); //DetailView Intent intent2 = new Intent().setClass(this,ObjectList.class); //ObjectList //Intent intent2 = new Intent().setClass(this,Gallery.class); //Gallery Intent intent3 = new Intent().setClass(this,ContactDetail.class); mTabHost.addTab(mTabHost.newTabSpec("tab_mol").setIndicator(this.getText(R.string.mol), getResources().getDrawable(R.drawable.ic_tab_mol)).setContent(intent1)); mTabHost.addTab(mTabHost.newTabSpec("tab_highlights").setIndicator(this.getText(R.string.highlights),getResources().getDrawable(R.drawable.ic_tab_highlights)).setContent(intent2)); mTabHost.addTab(mTabHost.newTabSpec("tab_contacts").setIndicator(this.getText(R.string.contact),getResources().getDrawable(R.drawable.ic_tab_contact)).setContent(intent3)); mTabHost.setCurrentTab(1); SQLiteDatabase db; DBAdapter dh = null; OpenHelper openHelper = new OpenHelper(this.context); dh = new DBAdapter(this); db = openHelper.getWritableDatabase(); dh.SQL_INSERT_COUNTRY("AT", "Austria", "AUT"); } } i tried it with my country table because it has only 3 columns public class Country { private static String Iso2Count = "iso2_country"; private static String NameCount = "name_country"; private static String FlagCount = "flag_image_url_country"; public static final String TABLE_NAME = "country"; public static final String SQL_CREATE = "CREATE TABLE IF NOT EXISTS " + TABLE_NAME + "(" + Iso2Count + " TEXT not NULL," + NameCount + " TEXT not NULL," + FlagCount + " TEXT not NULL," + "primary key(iso2_country)"; public boolean SQL_INSERT_COUNTRY(String Iso2CountIns, String NameCountIns, String FlagCountIns) { try{ db.execSQL("INSERT INTO " + "country" + "(" + Iso2Count + ", " + NameCount + ", " + FlagCount + ") " + "VALUES ( " + Iso2CountIns + ", " + NameCountIns +", " + FlagCountIns + " )"); return true; } catch (SQLException e) { return false; } } another question is it better to put the insert and select from each table into a separate class, so i have 1 class for each table or put them all into the DBAdapter class?

    Read the article

  • A logical problem with two tables

    - by Luke
    Hey guys, I created a list for fixtures. $result = mysql_query("SELECT date FROM ".TBL_FIXTURES." WHERE compname = '$comp_name' GROUP BY date"); $i = 1; $d = "Start"; while ($row = mysql_fetch_assoc($result)) { $odate = $row['date']; $date=date("F j Y", $row['date']); echo "<p>Fixture $i - $d to $date</p>"; } As you can see from the query, the date is displayed from the fixtures table. The way my system works is that when a fixture is "played", it is removed from this table. Therefore when the entire round of fixtures are complete, there wont be any dates for that round in this table. They will be in another table. Is there anyway I can run an other query for dates at the same time, and display only dates from the fixtures table if there isnt a date in the results table? "SELECT * FROM ".TBL_CONF_RESULTS." WHERE compid = '$_GET[id]' && type2 = '2' ORDER BY date" That would be the second query!

    Read the article

  • tables wrapping to next line when width 100%

    - by jmo
    I'm encountering some weirdness with tables in css. The layout is fairly simple, a fixed-width nav bar on the left and the content on the right. When the content includes a table with a width of 100% the table ends up getting pushed down until it has room to take up the full width of the screen (instead of just the area to the right of the nav bar). If I remove the width=100% from the table's css, then it looks fine, but obviously the table doesn't grow to fill the space of the div. The problem is that i want the table to grow and shrink with the window but still stay in the bounds of its div. Thanks. Here's a simple example: <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd"> <html> <head> <title>Test</title> <style type="text/css"> #content { padding-right:20px; background:white; overflow:hidden; margin:20px; } #content .column { position:relative; padding-bottom: 20010px; margin-bottom: -20000px; } #center { width:100%; padding-top:15px; } body { min-width:700px; } #left { width: 330px; padding: 0 10px; padding-top:10px; float:left; } .tableData { width:100%; } </style> </head> <body> <div id="content"> <div class="column" id="left"> <div> Some text goes in here<br/> some more text<br/> some more text<br/> some more text<br/> some more text<br/> some more text<br/> </div> </div> <div class="column" id="center"> Some text at the top; <hr/> <table class="tableData"> <thead> <tr><th>A</th><th>B</th><th>C</th></tr> </thead> <tbody> <tr> <td>A1 A1 A1 A1</td> <td>B1 B1 B1 B1</td> <td>C1 C1 C1 C1 C</td> </tr> <tr> <td>A2 A2 A2 A2 </td> <td>B2 B2 B2 B2 </td> <td>C2 C2 C2 C2</td> </tr> <tr> <td>A3 A3 A3 A3 A3 </td> <td>B3 B3 B3 B3 B3 </td> <td>C3 C3 C3 C3 C3</td> </tr> <tr> <td>A4 A4 A4 A4 A4</td> <td>B4 B4 B4 B4 B4</td> <td>C4 C4 C4 C4 C4</td> </tr> </tbody> </table> </div> </div> </body> </html>

    Read the article

  • Mapping Drive Error - System Error 1808

    - by Julian Easterling
    A vendor is attempting to map and preserve a network drive using nt authority/system; so it stays persistent when the interactive session of the server is lost. They were able to do this on one server (Windows 2008 R2) but not a second computer (also Windows 2008 R2). D:\PsExec.exe -s cmd.exe PsExec v1.98 - Execute processes remotely Copyright (C) 2001-2010 Mark Russinovich Sysinternals - www.sysinternals.com Microsoft Windows [Version 6.1.7600] Copyright (c) 2009 Microsoft Corporation. all rights reserved. C:\Windows\system32>whoami nt authority\system C:\Windows\system32>net use New connections will be remembered. Status Local Remote Network -------------------------------------------------------------------- OK X: \\netapp1\share1 Microsoft Windows Network The command completed successfully. C:\Windows\system32>net use q: \\netapp1\share1 System error 1808 has occurred. The account used is a computer account. Use your global user account or local user account to access this server. C:\Windows\system32> I am unsure on how to set up a "machine account mapping" which will preserve the drive letter of the Netapp path being mapped, so that the service account running a Windows service can continue to access the share after interactive logon has expired on the server. Since they were able to do this on one server but not another, I'm not sure how to troubleshoot the problem? Any suggestions?

    Read the article

  • System Information (msinfo32.exe) Can't Collect Information

    - by ptanne
    I have Windows XP Pro, service pack 1, IE 6 and 32GB of free space, 75GB total. I have had nothing but trouble after trying to install service pack 2 even though I used System Restore. The installation was incomplete and my computer has never been the same. I attempted to install sp2 four or five times and sp3 once, always with the same result. I've tried reinstalling XP Pro but that didn't fix the problem. My XP Pro disk now has a scratch on it and refuses to work. Dell would not replace it stating that my computer was out of warranty. I'm currently trying Reimage which is supposed to return a computer to the original configuration and replace missing or damaged files. Believe it or not, Ripley, it stops in the middle of the operation and, so far, the Reimage techs haven't been able to figure out why. Of the many problems that I still have is that System Information can't collect information. The Help and Support sections that display system info also don't work. Is there some way that I can fix this? I can't afford to throw my computer away, yet. Thank you for listening, Pam Galvin

    Read the article

  • Problem recreating BCD on Windows 7 64bit - The requested system device cannot be found

    - by Domchi
    NVIDIA drivers upgrade crashed my Windows 7 installation, so I'm working to undo the damage. What I can do: I can boot Windows install from the USB drive, and I can boot the Hiren's Boot CD. Although automated Windows repair fails, I can get to command prompt when I boot Windows install from USB drive, and I can see my drive and all my data. What I cannot do: I cannot boot into Windows - I get this message: Windows failed to start. A recent hardwware or software change might be the cause. To fix the problem: 1.insert windos cd and run a repair your computer option. File: /boot/bcd Status: 0xc000000f Info: an error occured while attempting to read the boot configuration data. It seems that something is wrong with my /Boot/BCD, so I'm trying to recreate it from scratch. I've tried all the methods detailed here (including Windows repair which fails), and I'm left with the last one (near the bottom of that page). When I type the following command as in the tutorial: bcdedit.exe /import c:\boot\bcd.temp ...it fails with the following error: The store import operation has failed. The requested system device cannot be found. Many Google results say that I must use diskpart to set my partition active, however it's already set as active. Also, when I try this: bcdedit /enum It fails with similar message: The boot configuration data store could not be opened. The requested system device cannot be found. Does anyone know what does that error message mean, and what is the requested system device? I'd like to avoid having to reinstall Windows since all the files on disk seem to be fine.

    Read the article

  • Printer deployment via Group Policy not working on a single system

    - by Aron Rotteveel
    One of my coworkers just got a new laptop running Windows 7 Pro x64. We use a GPO to deploy the printers to every system, but for some reason it is not working on this system. I have been breaking my head over this for the past 3 hours now without any result. The strange thing is that gpresult /H seems to indicate that the GPO did run. The hardware: Laptop: Windows 7 Professional x64 Print server: Windows Server 2008 x64 R1 HP Color LaserJet 2605dn HP LaserJet P2015 Driver packages on server: HP universal printer driver PCL5, both X86 as X64 Oddities and other info: GPO working flawlessly on every other system, including my own Windows 7 Ultimate X64 laptop gpresult /H shows the GPO being ran Windows Firewall completely disabled on the new laptop Below is the output for gpresult /H (in Dutch sadly, but I think you'll recognize it): Beleidsregels Windows-instellingen Printerverbindingen Pad Dominerend groepsbeleidsobject \\Server2008\HP Color LaserJet 2605dn Printers \\Server2008\HP LaserJet P2015 Printers Beheersjablonen Beleidsdefinities (ADMX-bestanden) opgehaald van de lokale computer. Configuratiescherm/Printers Beleid Instelling Dominerend groepsbeleidsobject Beperkingen van point-and-print Uitgeschakeld Printers Like I said, I have been trying to figure this out for the past few hours or so without any result, so you are my last hope. Any help is appreciated.

    Read the article

  • How to find cause of main file system going to read only mode

    - by user606521
    Ubuntu 12.04 File system goes to readonly mode frequently. First of all I have read this question file system is going into read only mode frequently already. But I have to know if it's not caused by something else than dying hard drive. This is server provided by my client and I am just runing there some node.js workers + one node.js server and I am using mongodb. From time to time (every 20-50h) system suddenly makes filesystem read only, mongodb process fails (due read-only fs) and my node workers/server (which are started by forever) are just killed. Here is the log from dmesg - I can see there some errors and messages that FS is going to read-only, and there is also some JOURNAL error but I would like to find cause of those errors.. http://speedy.sh/Ux2VV/dmesg.log.txt edit smartctl -t long /dev/sda smartctl 5.41 2011-06-09 r3365 [x86_64-linux-3.5.0-23-generic] (local build) Copyright (C) 2002-11 by Bruce Allen, http://smartmontools.sourceforge.net SMART support is: Unavailable - device lacks SMART capability. A mandatory SMART command failed: exiting. To continue, add one or more '-T permissive' options. What I am doing wrong? Same is for sda2. Morover now when I type any command that not exists in shell I get this: Sorry, command-not-found has crashed! Please file a bug report at: https://bugs.launchpad.net/command-not-found/+filebug Please include the following information with the report:

    Read the article

< Previous Page | 93 94 95 96 97 98 99 100 101 102 103 104  | Next Page >