Search Results

Search found 6394 results on 256 pages for 'regular expressions'.

Page 177/256 | < Previous Page | 173 174 175 176 177 178 179 180 181 182 183 184  | Next Page >

• Flash AS3 and XML: way to fix line breaks in htmlText that uses <b> tags in the xml?

  - by HeroicNate

  I'm importing text in from an xml file and i'm using htmlText to try to keep some styling with tags. I have both the regular and bold face font embedded, and the bolding works fine. The problem is that it ads spaces around the words in bold like a paragraph indent and then makes a line-break after them. What's going on, is there a way to fix? fromxmlText.htmlText = theXML.contenttext; If I pull the text in from a txt file it will work fine, but taking it out of an xml file causing funky formatting. lil' help?

  Read the article

• PostgreSQL 8.3 data types: xml vs varchar

  - by Sejanus

  There's xml data type in Postgres, I never used it before so I'd like to hear opinions. Downsides and upsides vs using regular varchar (or Text) column to store xml. The text I'm going to store is xml, well-formed, UTF-8. No need to search by it (I've read searching by xml is slow). This XML actually is data prepared for PDF generation with Apache FOP. XML can be generated dynamically from data found elsewhere (other Postgres tables), it's stored as is only so that I won't need to generate it twice. Kinda backup#2 for already generated PDF documents. Anything else to know? Good practices, performance, maintenance, etc?

  Read the article

• How do you authenticate user generated "apps" for your app?

  - by Brian Armstrong

  I'm think something like Facebook apps here. User generated pieces of code that people can write to interact with my app. I understand how an authenticated API works, but this seems a little more complicated because not only does the APP have to authenticate itself (with a regular api-key) but the USER using the app has to be authenticated somehow too, without giving the app free reign. I've been reading a bit here to see how FB does it: http://wiki.developers.facebook.com/index.php/How_Facebook_Authenticates_Your_Application And it looks like you have to pass a signature in addition to the api-key along with every call, but I'm having trouble wrapping my head around how this gets generated and used on the other end (my server). Figure there must be a simple explanation of this out there? Thanks! P.S. I'm building a Rails app if there are any applicable gems/plugins.

  Read the article

• python optparse, how to include additional info in usage output?

  - by CarpeNoctem

  Using python's optparse module I would like to add extra example lines below the regular usage output. My current help_print() output looks like this: usage: check_dell.py [options] options: -h, --help show this help message and exit -s, --storage checks virtual and physical disks -c, --chassis checks specified chassis components I would like it to include usage examples for the less *nix literate users at my work. Something like this: usage: check_dell.py [options] options: -h, --help show this help message and exit -s, --storage checks virtual and physical disks -c, --chassis checks specified chassis components Examples: check_dell -c all check_dell -c fans memory voltage check_dell -s How would I accomplish this? What optparse options allow for such? Current code: import optparse def main(): parser = optparse.OptionParser() parser.add_option('-s', '--storage', action='store_true', default=False, help='checks virtual and physical disks') parser.add_option('-c', '--chassis', action='store_true', default=False, help='checks specified chassis components') (opts, args) = parser.parse_args()

  Read the article

• Mirror a git repository by pulling?

  - by corydoras

  I am wondering if there is an easy way, ie like a simple cron job, to regularly pull from a remote git repository to a local read only mirror for backup purposes? Ideally it would pull all branches and tags, but the master/trunk/head would be sufficient. I just need a way to make sure that if the master git server dies, we have a backup location that we could manually fail over to. (I have been googling and reading documentation for help on how to do this for quite some time now and the furthest I have gotten is a bash script that does pull's on a regular interval.)

  Read the article

• [AS3] htmlText not showing bold or italics font

  - by Conor

  So I have a MovieClip asset with a dynamic textfield sitting inside of it. I export my .fla as a .swc to use within Flash Builder 4, and create instances of the asset with code, populating the text dynamically from XML. My issue is that even though I have htmlText enabled, bold and italics tags don't appear to be working. I have a feeling it is because when I created the asset in Flash CS4, the text field makes you specify the font, and the subset of that to use (Regular, Bold, Oblique, etc). Is there any way to get the htmlText to render bold and italics tags properly without having to completely rethink the way I'm creating all these fields?

  Read the article

• How to determine if code is running in Foundation or GUI?

  - by Mitch Cohen

  I'm writing a Mac app with two targets - a regular Cocoa GUI and a Foundation command-line tool. They do very similar things other than the GUI, so I'm sharing most of the code between the two. I'd like to do a few things slightly differently depending on which target is running. I can think of many ways to do this (#define something in the pch, check for existence of GUI definitions...). I'm curious if there's a standard or recommended way to do this. Thanks!

  Read the article

• Regex to validate SMTP Responses?

  - by Alix Axel

  I'm writing a regular expression that can interactively validate SMTP responses codes, once the SMTP dialog is completed it should pass the following regex (some parentheses added for better readability): ^(220)(250){3,}(354)(250)(221)$ Or with(out) authentication: ^(220)(250)((334){2}(235))?(250){2,}(354)(250)(221)$ I'm trying to do rewrite the above regexes so that I can interactively check if the dialog is going as expected, otherwise politely send a QUIT command and close the connection saving bandwidth and time, but I'm having a hard time writing an optimal regex. So far I've managed to come up with: ^(220(250(334(235(250(354(250(221)?)?)?){0,})?){0,2})?)?$ Which, besides only matching authenticated connections, has some bugs... For instance, it matches: 220250334235250354250221 220250334334235250354250221 I've also tried the following modification: ^(220(250)?)?((334(235)?){2})?(250(354(250(221)?)?)?){0,}$ This one accepts non-authenticated responses but it fails to match 220250334 and wrongly matches 220250334334235250354250221 (at least 2 250 are needed before the 354 response code). Can someone help me out with this? Thanks in advance.

  Read the article

• Wpf- Is there any way to disable some of the default hotkeys in a RichTextBox?

  - by Justin

  I have several keybindings in my text editing application that no longer work now that I have switched from using a regular textbox to using a richtextbox. This is because the wpf richtextbox has several default hokeys such as "Ctrl+1", "Ctrl+2", and "Ctrl+5". My keybindings are defined in a view that contains the view that the richtextbox is in. I can't move the keybindings to the richtextbox; Is there any fix for this problem? Other than using a third-party control or creating my own richtextbox from textboxbase.

  Read the article

• PHP IP Validation Help

  - by Zubair1

  Hello, I am using this IP Validation Function that i came across while browsing, it has been working well until today i ran into a problem. For some reason the function won't validate this IP as valid: 203.81.192.26 I'm not too great with regular expressions, so would appreciate any help on what could be wrong. If you have another function, i would appreciate if you could post that for me. |--------------------------------------------| The code for the function is below: |--------------------------------------------| public static function validateIpAddress($ip_addr) { global $errors; $preg = '#^(?:(?:25[0-5]|2[0-4][0-9]|[01]?[0-9][0-9]?)\.){3}' . '(?:25[0-5]|2[0-4][0-9]|[01]?[0-9][0-9]?)$#'; if(preg_match($preg, $ip_addr)) { //now all the intger values are separated $parts = explode(".", $ip_addr); //now we need to check each part can range from 0-255 foreach($parts as $ip_parts) { if(intval($ip_parts) > 255 || intval($ip_parts) < 0) { $errors[] = "ip address is not valid."; return false; } return true; } return true; } else { $errors[] = "please double check the ip address."; return false; } }

  Read the article

• How do you protect code from leaking outside?

  - by cubex

  Besides open-sourcing your project and legislation, are there ways to prevent, or at least minimize the damages of code leaking outside your company/group? We obviously can't block Internet access (to prevent emailing the code) because programmer's need their references. We also can't block peripheral devices (USB, Firewire, etc.) The code matters most when it has some proprietary algorithms and in-house developed knowledge (as opposed to regular routine code to draw GUIs, connect to databases, etc.), but some applications (like accounting software and CRMs) are just that: complex collections of routine code that are simple to develop in principle, but will take years to write from scratch. This is where leaked code will come in handy to competitors. As far as I see it, preventing leakage relies almost entirely on human process. What do you think? What precautions and measures are you taking? And has code leakage affected you before?

  Read the article

• DataGridRow Cells property

  - by Michal Krawiec

  I would like to get to DataGridRow Cells property. It's a table of cells in a current DataGrid. But I cannot get access direct from code nor by Reflection: var x = dataGridRow.GetType().GetProperty("Cells") //returns null Is there any way to get this table? And related question - in Watch window (VS2008) regular properties have an icon of a hand pointing on a sheet of paper. But DataGridRow.Cells has an icon of a hand pointing on a sheet of paper with a little yellow envelope in a left bottom corner - what does it mean? Thanks for replies.

  Read the article

• Multiple Forms on the Same Page with Rails

  - by Eric Koslow

  So I'm building a rails app for high school students and I've hit a problem when it comes to creating users. I want the students to only be able to create accounts if they select their school and type in their school's password correctly. What is the correct / easiest way of doing this? Should I create a gatekeeper to the user#new action that they have to pass first or if their a way that on the same page a student can submit to forms. One would be the regular username, email, password using: form_for @user do ... end But then creating another form for the high-school / high-school password selection. Ideally the controller would be able to get the params of the high-school form, validate those, then go on to create the user from the user params. Is this possible using rails? My setup: Rails 3 and Ruby 1.9.2dev Thank you!

  Read the article

• C pointers and addresses

  - by yCalleecharan

  Hi, I always thought that *&p = p = &*p in C. I tried this code: #include <stdio.h> #include <stdlib.h> char a[] = "programming"; char *ap = &a[4]; int main(void) { printf("%x %x %x\n", ap, &*(ap), *&(ap)); /* line 13 */ printf("%x %x %x\n\n", ap+1, &*(ap+1), *&(ap+1)); /* line 14 */ } The first printf line (line 13) gives me the addresses: 40b0a8 40b0a8 40b0a8 which are the same as expected. But when I added the second printf line, Borland complains: "first.c": E2027 Must take address of a memory location in function main at line 14 I was expecting to get: 40b0a9 40b0a9 40b0a9. It seems that the expression *&(ap+1) on line 14 is the culprit here. I thought all three pointer expressions on line 14 are equivalent. Why am I thinking wrong? A second related question: The line char *ap = a; points to the first element of array a. I used char *ap = &a[4]; to point to the 5th element of array a. Is the expression char *ap = a; same as the expression char *ap = &a[0]; Is the last expression only more verbose than the previous one? Thanks a lot...

  Read the article

• Python access an object byref / Need tagging

  - by Aaron C. de Bruyn

  I need to suck data from stdin and create a object. The incoming data is between 5 and 10 lines long. Each line has a process number and either an IP address or a hash. For example: pid=123 ip=192.168.0.1 - some data pid=123 hash=ABCDEF0123 - more data hash=ABCDEF123 - More data ip=192.168.0.1 - even more data I need to put this data into a class like: class MyData(): pid = None hash = None ip = None lines = [] I need to be able to look up the object by IP, HASH, or PID. The tough part is that there are multiple streams of data intermixed coming from stdin. (There could be hundreds or thousands of processes writing data at the same time.) I have regular expressions pulling out the PID, IP, and HASH that I need, but how can I access the object by any of those values? My thought was to do something like this: myarray = {} for each line in sys.stdin.readlines(): if pid and ip: #If we can get a PID out of the line myarray[pid] = MyData().pid = pid #Create a new MyData object, assign the PID, and stick it in myarray accessible by PID. myarray[pid].ip = ip #Add the IP address to the new object myarray[pid].lines.append(data) #Append the data myarray[ip] = myarray[pid] #Take the object by PID and create a key from the IP. <snip>do something similar for pid and hash, hash and ip, etc...</snip> This gives my an array with two keys (a PID and an IP) and they both point to the same object. But on the next iteration of the loop, if I find (for example) an IP and HASH and do: myarray[hash] = myarray[ip] The following is False: myarray[hash] == myarray[ip] Hopefully that was clear. I hate to admit that waaay back in the VB days, I remember being able handle objects byref instead of byval. Is there something similar in Python? Or am I just approaching this wrong?

  Read the article

• what the true nature of @ in Transct-SQL

  - by Richard77

  Hello, I reading some old ScottGu's blogs on Linq2SQL. Now I'm doing the SPROC part. I'd like to know what's the exact meaning of @variable. See this from ScottGu's Blog ALTER PROCEDURE dbo.GetCustomersDetails ( @customerID nchar(5), @companyName nvarchar(40) output ) AS SELECT @companyName = CompanyName FROM Customers WHERE CustomerID = @customerID SELECT * FROM Orders WHERE CustomerID = @customerID ORDER BY OrderID I'm kind of lost as, so far, I've though of anything preceded by a '@' as a placeholder for user input. But, in the example above, it looks like '@companyName' is used as a regular variable like in C# for instance (SELECT @companyName = ...). But, @companyName is not known yet. So, what the true nature a something preceded by a '@' like above? a vriable? a simple placeholder to accommodate user entered value? Thanks for helping

  Read the article

• sharing web user controls across projects.

  - by Kyle

  I've done this using a regular .cs file that just extends System.Web.UI.UserControl and then included the assembly of the project that contains the control into other projects. I've also created .ascx files in one project then copied all ascx files from a specified folder in the properties-Build Events-Pre-build event. Now what I want to do is a combination of those two: I want to be able to use ascx files that I build in one project, in all of my other projects but I want to include them just using assembly references rather than having to copy them to my "secondary" projects as that seems a ghetto way to accomplish what I want to do. It works yes, but it's not very elegant. Can anyone let me know if this even possible, and if so, what the best way to approach this is?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• C# Threads.Abort()

  - by Betamoo

  If a thread is running a function func1 that calls another function func2 inside it... Then I called thread.Abort() Will this stop func1 only OR func1 and func2 and all the functions func1 has called?? Thanks Edit: Here are more detail: func1 is called in a new thread, it continuously calls func2 on regular basis... func2 begin doing some work only if some array is not null.. it finishes it and return When supervisor wants to save data, it aborts Thread of func1- and then makes array null, saves data, then fill in the array with new one.. and starts Thread with func1 again.. Sometimes exception is raised because array is null in func2.. so func1 abort did not affect func2

  Read the article

• regex to format a float in php

  - by Itamar Bar-Lev

  I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

  Read the article

• Using Regex groups in bash

  - by AlexeyMK

  Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

  Read the article

• Using string.Format for simple things?

  - by Gerrie Schenck

  In my early .Net programming days, I used string.Format() only for complex string concatenations, for example to compile strings as Problem with customer order 234 of date 2/2/2002 and payment id 55543. But now I use string.Format for almost every string concatenation I have to do, also simple ones such as prefixing a string with something. Console.WriteLine(string.Format("\t\t{0}", myString)); Is there any possible overhead on this? Maybe I should use the regular + operator to do these simple operations? What's your opinion on this?

  Read the article

• F# List SelectMany

  - by Tuomas Hietanen

  This is quite simple question but I didn't find an answer: Is there any Seq/List operation in F# to match the LINQ SelectMany? I know I can use System.Linq in F# if I want to. I know I can make a recursive method and use F# Computation Expressions (and make even more powerful things). But if I try to prove that F# List operations are more powerful than LINQ... .Where = List.filter .Select = List.map .Aggregate = List.fold ... In C# SelectMany usage syntax is pretty simple: var flattenedList = from i in items1 from j in items2 select ... Is there any easy direct match, List.flatten, List.bind or something like that? SelectMany has a couple of signatures, but the most complex one seems to be: IEnumerable<TResult> SelectMany<TSource, TCollection, TResult>( this IEnumerable<TSource> source, Func<TSource, IEnumerable<TCollection>> collectionSelector, Func<TSource, TCollection, TResult> resultSelector ); In F# terms this would be: ('a -> 'b list) -> ('a -> 'b -> 'c) -> 'a list -> 'c list

  Read the article

• Open C: Directly with `FileStream` without `CreateFile` API

  - by DxCK

  I trying to open C: directly with FileStream without success: new FileStream("C:", FileMode.Open, FileAccess.Read, FileShare.ReadWrite); System.UnauthorizedAccessException was unhandled Message="Access to the path 'C:\' is denied." Source="mscorlib" StackTrace: in System.IO.__Error.WinIOError(Int32 errorCode, String maybeFullPath) in System.IO.FileStream.Init(String path, FileMode mode, FileAccess access, Int32 rights, Boolean useRights, FileShare share, Int32 bufferSize, FileOptions options, SECURITY_ATTRIBUTES secAttrs, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share, Int32 bufferSize, FileOptions options, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share) in ReadingMftNewTest.Program.Main(String[] args) in D:\CS\2008\ReadingMftNewTest\ReadingMftNewTest\Program.cs:line 76 Note that i openning "C:" but the error says "C:\", where did this slash came from? :\ Is there any chance to open C: without using the CreateFile API? I really don't want be depending on WIN32 API because this code should also run on Mono that dont support WIN32 API, but successfully openning devices with regular FileStream (Mono 1 Microsoft 0).

  Read the article

• Convert PDF to PDF/A-1

  - by AZtec

  I know this probably is not strictly a programming-question (well maybe it is, i don't know) but i'm having serious problems trying to convert a regular pdf (with hyperlinks, bookmarks, images, embedded fonts etc.) into a PDF/A-1 format. I get all kinds of errors when i check it with pdfaPilot. How can i prepare a pdf so no problems will occur when i try to convert to PDF/A-1. Most problems can be fixed with pdfaPilot but apparently not all. One of the problems i get is with the XMP Metadata which are "not properly defined". Wat exactly does this mean, and can i do something to prevent this. Another one is: "Syntax problem: Array with more than 8191 elements" (i hope this one is solvable) I hope someone can help me out here, since i'm in a tight spot right now with deadlines that are killing me.

  Read the article

< Previous Page | 173 174 175 176 177 178 179 180 181 182 183 184  | Next Page >