Search Results

Search found 6394 results on 256 pages for 'regular expressions'.

Page 179/256 | < Previous Page | 175 176 177 178 179 180 181 182 183 184 185 186  | Next Page >

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • PostgreSQL String search for partial patterns removing exrtaneous characters

    - by tbrandao
    Looking for a simple SQL (PostgreSQL) regular expression or similar solution (maybe soundex) that will allow a flexible search. So that dashes, spaces and such are omitted during the search. As part of the search and only the raw characters are searched in the table.: Currently using: SELECT * FROM Productions WHERE part_no ~* '%search_term%' If user types UTR-1 it fails to bring up UTR1 or UTR 1 stored in the database. But the matches do not happen when a part_no has a dash and the user omits this character (or vice versa) EXAMPLE search for part UTR-1 should find all matches below. UTR1 UTR --1 UTR 1 any suggestions...

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • Which testing method to go with? [Rails]

    - by yuval
    I am starting a new project for a client today. I have done some rails projects before but never bothered writing tests for them. I'd like to change that starting with this new project. I am aware there are several testing tools, but am a bit confused as to which I should be using. I heard of RSpec, Mocha, Webrat, and Cucamber. Please keep in mind I never really wrote any regular tests, so my knowledge of testing in general is quite limited. How would you suggest I get started? Thanks!

    Read the article

  • Typed Arrays in Gecko 2: Float32Array concatenation and expansion.

    - by janesconference
    Hi all, I'm a bit confused with Javascript Typed Arrays. What I have several *Float32Array*s, that have no concat method. I'd like to concatenate them all inside another Float32Array, but: as I said before, there is no concatenation method if I try to write past the array length, the array is not expanded (aka this won't work - please note that event.frameBuffer and buffer are both Float32Array and that I don't know what the final length of my buffer will be): var length_now = buffer.length; for (var i = 0; i < event.frameBuffer.length; i += 1) { buffer [length_now + i] = event.frameBuffer[i]; } The only solution I found is to copy the Float32Array in a regular array, that's definitely not what I want. How would you do, stackoverflowers?

    Read the article

  • Testing file existence using NSURL

    - by Peter Hosey
    Snow Leopard introduced many new methods to use NSURL objects to refer to files, not pathnames or Core Services' FSRefs. However, there's one task I can't find a URL-based method for: Testing whether a file exists. I'm looking for a URL-based version of -[NSFileManager fileExistsAtPath:]. Like that method, it should return YES if the URL describes anything, whether it's a regular file, a directory, or anything else. I could attempt to look up various resource values, but none of them are explicitly guaranteed to not exist if the file doesn't, and some of them (e.g., NSURLEffectiveIconKey) could be costly if it does. I could just use NSFileManager's fileExistsAtPath:, but if there's a more modern method, I'd prefer to use that. Is there a simple method or function in Cocoa, CF, or Core Services that's guaranteed/documented to tell me whether a given file (or file-reference) URL refers to a file-system object that exists?

    Read the article

  • JTable custom cell renderer to create row header

    - by hhj
    Can somebody please explain how I would create row headers? I already have the data and header texts set in the JTable: all I want to know is how I can use a cell renderer to take that first column (i.e. the row header column) and make it look like the column headers (i.e. the first row). Right now its background is white, so it looks like regular data. I want it to appear gray (or non-opaque I guess??). Oh and it should also not be selectable. Thanks.

    Read the article

  • Theory of computation - Using the pumping lemma for CFLs

    - by Tony
    I'm reviewing my notes for my course on theory of computation and I'm having trouble understanding how to complete a certain proof. Here is the question: A = {0^n 1^m 0^n | n>=1, m>=1} Prove that A is not regular. It's pretty obvious that the pumping lemma has to be used for this. So, we have |vy| = 1 |vxy| <= p (p being the pumping length, = 1) uv^ixy^iz exists in A for all i = 0 Trying to think of the correct string to choose seems a bit iffy for this. I was thinking 0^p 1^q 0^p, but I don't know if I can obscurely make a q, and since there is no bound on u, this could make things unruly.. So, how would one go about this?

    Read the article

  • a question on webpage data scraping using Java

    - by Gemma
    Hi there. I am now trying to implement a simple HTML webpage scraper using Java.Now I have a small problem. Suppose I have the following HTML fragment. <div id="sr-h-left" class="sr-comp"> <a class="link-gray-underline" id="compare_header" rel="nofollow" href="javascript:i18nCompareProd('/serv/main/buyer/ProductCompare.jsp?nxtg=41980a1c051f-0942A6ADCF43B802'); " Compare Showing 1 - 30 of 1,439 matches, The data I am interested is the integer 1.439 shown at the bottom.I am just wondering how can I get that integer out of the HTML. I am now considering using a regular expression,and then use the java.util.Pattern to help get the data out,but still not very clear about the process. I would be grateful if you guys could give me some hint or idea on this data scraping. Thanks a lot.

    Read the article

  • Access denied when using RunWithElevatedPrivileges?

    - by James123
    I want regular user can access the "User Information List" in Mysite root site. I am using "RunWithElevatedPrivileges" method. Still throwing access denied error. per example my root site collection for mysite is "http://network.test.com". the user want assess userinformation list this site collection. How can he access that? SPSecurity.RunWithElevatedPrivileges(delegate { using (SPSite site = new SPSite(SPContext.Current.Web.Site.ID)) { ServerContext sc = ServerContext.Current; UserProfileManager upm = new UserProfileManager(sc); UserProfile up = null; //get current user's profile (visitor) if (upm.UserExists(SPContext.Current.Web.CurrentUser.LoginName)) { up =upm.GetUserProfile(SPContext.Current.Web.CurrentUser.LoginName); SPWeb web = SPContext.Current.Web; SPList userInformationList = web.Lists["User Information List"];

    Read the article

  • Different EF Property DataType than Storage Layer Possible?

    - by dj_kyron
    Hi, I am putting together a WCF Data Service for PatientEntities using Entity Framework. My solution needs to address these requirements: Property DateOfBirth of entity Patient is stored in SQL Server as string. It would be ideal if the entity class did not also use the "string" type but rather a DateTime type. (I would expect this to be possible since we're abstracting away from the storage layer). Where could a conversion mechanism be put in place that would convert to and from DateTime/string so that the entity and SQL Server are in sync?. I cannot change the storage layer's structure, so I have to work around it. WCF Data Services (Read-only, so no need for saving changes) need to be used since clients will be able to use LINQ expressions to consume the service. They can generate results based on any given query scenario they need and not be constrained by a single method such as GetPatient(int ID). I've tried to use DTOs, but run into problem of mapping the ObjectContext to a DTO, I don't think that is theoretically possible...or too complicated if it is. I've tried to use Self Tracking Entities but they require the metadata from the .edmx file if I'm correct, and this isn't allowing a different property data type. I also want to add customizations to my Entity getter methods so that a property "MRN" of type "string" needs to have .Replace("MR~", string.Empty) performed before it is returned. I can add this to the getter methods but the problem with that is Entity Framework will overwrite that next time it refreshes the entity classes. Is there a permanent place I can put these? Should I use POCO instead? How would that work with WCF Data Services? Where would the service grab the metadata?

    Read the article

  • Forumotion profile customization using jQuery based on URL

    - by Harvengure
    The idea is have a jQuery snippet (I like Jquery...I can understand it better then regular javascript) that will detect that when it has been run on a profile with a url such as "http://customize.forum-motion.com/profile.forum?mode=viewprofile&u=1" (just as an example)...then upon detecting that it is a url of a profile...fetch data from a specific (and most likely hidden) element before wrapping that data in css tags and appending it to the heady of the current document. In short I'm trying to figure out how to make a sort of profile customization system where users can create their own css. The biggest problem I am having so far is figuring out how to make it so that the snippet can figure out what URL its being run on. Is there a function that can do this in jQuery at all?

    Read the article

  • Does DataType DataAnnotation Check the Expression?

    - by Jason
    I am currently using DataAnnotations within my ASP.NET MVC website to ensure data is properly validated. One question I wanted to verify (I think I know the answer, but I can't find verification online) - does the DataType DataAnnotation perform regular expression checks to ensure that you have received a valid e-mail/phone/currency/etc? [Required(ErrorMessage = "Price required")] [DataType(DataType.Currency, ErrorMessage = "Not a valid price")] [Range(0, double.MaxValue, ErrorMessage = "Price must be greater than 0.")] public decimal Price { get; set; } I believe the answer is no (meaning I have to provide my own, custom, RegularExpressionAttribute), but I wanted to double check before I do that for various field types.

    Read the article

  • What is the best possible technology for pulling huge data from 4 remote servers

    - by Habib Ullah Bahar
    Hello, For one of our project, we need to pull huge real time stock data from 4 remote servers across two countries. The trivial process here, check the sources for a regular interval and save the update to database. But as these are real time stock data of more than 1000 companies, I have to pull every second, which isn't good in case of memory, bandwidth I think. Please give me suggestion on which technology/platform [We are flexible here. PHP, Python, Java, PERL - anyone of them will be OK for us] we should choose, it can be achieved easily and with better performance.

    Read the article

  • Obtaining references to function objects on the execution stack from the frame object?

    - by Marcin
    Given the output of inspect.stack(), is it possible to get the function objects from anywhere from the stack frame and call these? If so, how? (I already know how to get the names of the functions.) Here is what I'm getting at: Let's say I'm a function and I'm trying to determine if my caller is a generator or a regular function? I need to call inspect.isgeneratorfunction() on the function object. And how do you figure out who called you? inspect.stack(), right? So if I can somehow put those together, I'll have the answer to my question. Perhaps there is an easier way to do this?

    Read the article

  • ASP.NET MVC controllers with identical names

    - by Anton Gogolev
    Hi! Here's what I'm trying to do. I have an ASP.NET MVC web application, where I'd like to have a separate "admin" area (accessible via http://example.com/admin) and a regular area, available for all users. In both these parts of the site I have a /blogs section, but when accessing http://example.com/admin/blogs I want to be presented with admin interface for blogs, whereas usual http://example.com/blogs should just list all blogs. And the problem itself is: how do I get ASP.NET MVC to instantiate appropriate controllers, provided that there are two BlogsControllers: one in Site.Admin namespace, and the other is in Site.Sitefront namespace? Granted, I could rename admin controller to BlogsAdminController, but I'd like to keep the names as they already are.

    Read the article

  • Redirect www.example.com/apple to food.example.com/fruits/apple

    - by Senthil
    I want to redirect users from www.example.com/apple to http://food.example.com/fruits/apple Note: This is a hardcoded redirection. Even a mapping if you will. "apple" will not be substituted with anything else. Nothing in the two URLs will change except for the domain of course. So there is no need for a regular expression to match the "apple" or anything else. There is already dozens of RewriteCond and RewriteRule things in the .htaccess file. I do not want them to be affected. This redirection is independent of those. I have access to the .htaccess file at the root of www.example.com and the httpd.conf What code should I put in .htaccess in order to achieve this? Or should I change the httpd.conf?

    Read the article

  • Positioning elements outside an Activity on Android

    - by Aleksander Kmetec
    Is there a way to absolutely position an UI element on Android so that it is located outside an Activity? For example: can you create a fullscreen ImageView simply by moving/resizing an ImageView inside an existing regular Activity instead of creating a new fullscreen activity? EDIT: Re-reading my question I see I wasn't very clear about what I'm trying to accomplish. I'd like to temporarily extend an element to cover the notification bar at the top of the screen. I need to create a semitranslucent fullscreen overlay but since translucent activities cannot cover the notification bar I'm trying to find out if it's possible for an element to break out of activity's bounds and resize itself to fill the whole screen, top to bottom.

    Read the article

  • How to use a different assembly name for different configurations?

    - by Mark Ingram
    In Visual Studio 2008 (and others) when creating a .NET or silverlight application if you look at your project properties, it seems like you can only have one assembly name - across all configurations. I would like to compile my application as: MyAppDebug - in debug mode and just MyApp - in release mode Does anyone know if this is possible? Edit: It seems some people are questioning the reasoning behind the question, so I'll explain a little further: I'm working on a Silverlight application which gets automatically uploaded to our test site when I to a "build solution". The trouble is, the test team are now testing the online version, whilst I work on a new one. So, I want to have a url like .\MyApp.html for the regular version that the QA team will test and then .\MyApp.html?version=debug for the current version that I'm working on.

    Read the article

  • Javascript substrings multiline replace by RegExp

    - by Radek Šimko
    Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

    Read the article

  • background-color hex to js variable (jquery)

    - by Ezdaroth
    I'm kinda new to javascript and jquery and now I'm facing a problem: I need to post some data to php and one bit of the data needs to be the background color hex of div X. Jquery has css("background-color") function and with it I can get rgb value of the background into a javascript variable. The css function seems to return a string like this rgb(0, 70, 255). I couldn't find any way to get hex of the background-color (even tho it's set as hex in css). So it seems like I need to convert it. I found a function for converting rgb to hex, but it needs to be called with three different variables, r, g and b. So I would need to parse the string rgb(x,xx,xxx) into var r=x; var g=xx; var b=xxx; somehow. I tried to google parsing strings with javascript, but didn't really understand the regular expressions thing. Could someone tell me if there's a way to get background-color of div as hex, or explain how to convert the string into 3 different variables.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • What is a Web Framework ? How does it compare with LAMP

    - by Nishant
    I started web development in LAMP/WAMP and it was logical to me . There is a Web Server program called Apache which does the networking part of setting up a service on port 80 ( common port ) . If the request is regular HTML it uses the HTTP headers to transport files .And if the request for the file is a PHP one , it has a mod_php with which Apache invokes the PHP interpreter to process the file and it gives back HTML which is again transferred as usual HTML . Now the question is what is a Web Framework ? I came across Python based website creation and there is Flask . What is a flask , how does it compare with LAMP . Further are DJango / Ruby on Rails different from flask ? Can someone answer me and also give some good places to read on these .Thanks for your answers in advance . Further is things like LAMP slower than the common FRAMEWORKS because they claimn easy deplyment fo web apps .

    Read the article

  • Integrating iCalendar in Moodle

    - by user61255
    Hi all, I am working on a Moodle project and I have downloaded and installed the latest build(1.9) on my system. I'm using this framework for the very first time so presently trying to get familiar with the environment and the documentation. My need is to embed an iCal kinda calendar on Moodle's front page using the PHP iCalendar API. I downloaded the latest version of PHP iCalendar but kinda needed some help figuring things out further. I am trying to build a plug-in sorta thing which allows you to put a custom-built calendar (in place of the regular Moodle calendar) on your Moodle site. Has anyone ever worked with something similar before? Any suggestions?!! Thanks in advance! --eureka

    Read the article

  • Capturing the contents of <select>

    - by joey mueller
    I'm trying to use a regular expression to capture the contents of all option values inside an HTML select element For example, in: <select name="test"> <option value="blah">one</option> <option value="mehh">two</option> <option value="rawr">three</option> </select> I'd like to capture one two and three into an array. My current code is var pages = responseDetails.responseText.match(/<select name="page" .+?>(?:\s*<option .+?>([^<]+)<\/option>)+\s*<\/select>/); for (var c = 0; c<pages.length; c++) { alert(pages[c]); } But it only captures the last value, in this case, "three". How can I modify this to capture all of them? Thanks!

    Read the article

< Previous Page | 175 176 177 178 179 180 181 182 183 184 185 186  | Next Page >