Search Results

Search found 6743 results on 270 pages for 'regular joe'.

Page 196/270 | < Previous Page | 192 193 194 195 196 197 198 199 200 201 202 203  | Next Page >

• What is the best possible technology for pulling huge data from 4 remote servers

  - by Habib Ullah Bahar

  Hello, For one of our project, we need to pull huge real time stock data from 4 remote servers across two countries. The trivial process here, check the sources for a regular interval and save the update to database. But as these are real time stock data of more than 1000 companies, I have to pull every second, which isn't good in case of memory, bandwidth I think. Please give me suggestion on which technology/platform [We are flexible here. PHP, Python, Java, PERL - anyone of them will be OK for us] we should choose, it can be achieved easily and with better performance.

  Read the article

• a question on webpage data scraping using Java

  - by Gemma

  Hi there. I am now trying to implement a simple HTML webpage scraper using Java.Now I have a small problem. Suppose I have the following HTML fragment. <div id="sr-h-left" class="sr-comp"> <a class="link-gray-underline" id="compare_header" rel="nofollow" href="javascript:i18nCompareProd('/serv/main/buyer/ProductCompare.jsp?nxtg=41980a1c051f-0942A6ADCF43B802'); " Compare Showing 1 - 30 of 1,439 matches, The data I am interested is the integer 1.439 shown at the bottom.I am just wondering how can I get that integer out of the HTML. I am now considering using a regular expression,and then use the java.util.Pattern to help get the data out,but still not very clear about the process. I would be grateful if you guys could give me some hint or idea on this data scraping. Thanks a lot.

  Read the article

• Does DataType DataAnnotation Check the Expression?

  - by Jason

  I am currently using DataAnnotations within my ASP.NET MVC website to ensure data is properly validated. One question I wanted to verify (I think I know the answer, but I can't find verification online) - does the DataType DataAnnotation perform regular expression checks to ensure that you have received a valid e-mail/phone/currency/etc? [Required(ErrorMessage = "Price required")] [DataType(DataType.Currency, ErrorMessage = "Not a valid price")] [Range(0, double.MaxValue, ErrorMessage = "Price must be greater than 0.")] public decimal Price { get; set; } I believe the answer is no (meaning I have to provide my own, custom, RegularExpressionAttribute), but I wanted to double check before I do that for various field types.

  Read the article

• JTable custom cell renderer to create row header

  - by hhj

  Can somebody please explain how I would create row headers? I already have the data and header texts set in the JTable: all I want to know is how I can use a cell renderer to take that first column (i.e. the row header column) and make it look like the column headers (i.e. the first row). Right now its background is white, so it looks like regular data. I want it to appear gray (or non-opaque I guess??). Oh and it should also not be selectable. Thanks.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Redirect www.example.com/apple to food.example.com/fruits/apple

  - by Senthil

  I want to redirect users from www.example.com/apple to http://food.example.com/fruits/apple Note: This is a hardcoded redirection. Even a mapping if you will. "apple" will not be substituted with anything else. Nothing in the two URLs will change except for the domain of course. So there is no need for a regular expression to match the "apple" or anything else. There is already dozens of RewriteCond and RewriteRule things in the .htaccess file. I do not want them to be affected. This redirection is independent of those. I have access to the .htaccess file at the root of www.example.com and the httpd.conf What code should I put in .htaccess in order to achieve this? Or should I change the httpd.conf?

  Read the article

• What is a Web Framework ? How does it compare with LAMP

  - by Nishant

  I started web development in LAMP/WAMP and it was logical to me . There is a Web Server program called Apache which does the networking part of setting up a service on port 80 ( common port ) . If the request is regular HTML it uses the HTTP headers to transport files .And if the request for the file is a PHP one , it has a mod_php with which Apache invokes the PHP interpreter to process the file and it gives back HTML which is again transferred as usual HTML . Now the question is what is a Web Framework ? I came across Python based website creation and there is Flask . What is a flask , how does it compare with LAMP . Further are DJango / Ruby on Rails different from flask ? Can someone answer me and also give some good places to read on these .Thanks for your answers in advance . Further is things like LAMP slower than the common FRAMEWORKS because they claimn easy deplyment fo web apps .

  Read the article

• Numbering Regex Submatches

  - by gentlylisped

  Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

  Read the article

• How can I remove sensitive data from the debug_backtrace function?

  - by RenderIn

  I am using print_r(debug_backtrace(), true) to retrieve a string representation of the debug backtrace. This works fine, as print_r handles recursion. When I tried to recursively iterate through the debug_backtrace() return array before turning it into a string it ran into recursion and never ended. Is there some simple way I can remove certain sensitive key/value pairs from the backtrace array? Perhaps some way to turn the array to a string using print_r, then back to an array with the recursive locations changed to the string RECURSION, which I could the iterate through. I don't want to execute regular expressions on the string representation if possible.

  Read the article

• Using C# and gppg, how would I construct an abstract syntax tree?

  - by Rupert

  Is there a way to do this almost out-of-the-box? I could go and write a big method that would use the collected tokens to figure out which leaves should be put in which branches and in the end populate a TreeNode object, but since gppg already handled everything by using supplied regular expressions, I was wondering if there's an easier way? Even if not, any pointers as to how best to approach the problem of creating an AST would be appreciated. Apologies if I said anything silly, I'm only just beginning to play the compiler game. :)

  Read the article

• Access denied when using RunWithElevatedPrivileges?

  - by James123

  I want regular user can access the "User Information List" in Mysite root site. I am using "RunWithElevatedPrivileges" method. Still throwing access denied error. per example my root site collection for mysite is "http://network.test.com". the user want assess userinformation list this site collection. How can he access that? SPSecurity.RunWithElevatedPrivileges(delegate { using (SPSite site = new SPSite(SPContext.Current.Web.Site.ID)) { ServerContext sc = ServerContext.Current; UserProfileManager upm = new UserProfileManager(sc); UserProfile up = null; //get current user's profile (visitor) if (upm.UserExists(SPContext.Current.Web.CurrentUser.LoginName)) { up =upm.GetUserProfile(SPContext.Current.Web.CurrentUser.LoginName); SPWeb web = SPContext.Current.Web; SPList userInformationList = web.Lists["User Information List"];

  Read the article

• Which testing method to go with? [Rails]

  - by yuval

  I am starting a new project for a client today. I have done some rails projects before but never bothered writing tests for them. I'd like to change that starting with this new project. I am aware there are several testing tools, but am a bit confused as to which I should be using. I heard of RSpec, Mocha, Webrat, and Cucamber. Please keep in mind I never really wrote any regular tests, so my knowledge of testing in general is quite limited. How would you suggest I get started? Thanks!

  Read the article

• How to use a different assembly name for different configurations?

  - by Mark Ingram

  In Visual Studio 2008 (and others) when creating a .NET or silverlight application if you look at your project properties, it seems like you can only have one assembly name - across all configurations. I would like to compile my application as: MyAppDebug - in debug mode and just MyApp - in release mode Does anyone know if this is possible? Edit: It seems some people are questioning the reasoning behind the question, so I'll explain a little further: I'm working on a Silverlight application which gets automatically uploaded to our test site when I to a "build solution". The trouble is, the test team are now testing the online version, whilst I work on a new one. So, I want to have a url like .\MyApp.html for the regular version that the QA team will test and then .\MyApp.html?version=debug for the current version that I'm working on.

  Read the article

• Obtaining references to function objects on the execution stack from the frame object?

  - by Marcin

  Given the output of inspect.stack(), is it possible to get the function objects from anywhere from the stack frame and call these? If so, how? (I already know how to get the names of the functions.) Here is what I'm getting at: Let's say I'm a function and I'm trying to determine if my caller is a generator or a regular function? I need to call inspect.isgeneratorfunction() on the function object. And how do you figure out who called you? inspect.stack(), right? So if I can somehow put those together, I'll have the answer to my question. Perhaps there is an easier way to do this?

  Read the article

• SQL Server T-SQL statement to replace/delete sub-strings

  - by StefanE

  Hi, I have a table with 6 columns containing HTML content with some markups in it and now when moving to a new designed site most of this HTML code has to be deleted. More or less all tags except <B> and </B>. Is there a nice way of doing this, identify all tags end delete them within the data? I'm sure there are no < symbols in the test so a regular expression would maybe work? My alternative is to fetch every row, process it and update the database but I'm guessing this is possible to do in T-SQL directly. My server is an MSSQL 2008 and is located in a hosted environment but I can fetch a local copy if needed. Thanks, Stefan

  Read the article

• Capturing the contents of <select>

  - by joey mueller

  I'm trying to use a regular expression to capture the contents of all option values inside an HTML select element For example, in: <select name="test"> <option value="blah">one</option> <option value="mehh">two</option> <option value="rawr">three</option> </select> I'd like to capture one two and three into an array. My current code is var pages = responseDetails.responseText.match(/<select name="page" .+?>(?:\s*<option .+?>([^<]+)<\/option>)+\s*<\/select>/); for (var c = 0; c<pages.length; c++) { alert(pages[c]); } But it only captures the last value, in this case, "three". How can I modify this to capture all of them? Thanks!

  Read the article

• Open C: Directly with `FileStream` without `CreateFile` API

  - by DxCK

  I trying to open C: directly with FileStream without success: new FileStream("C:", FileMode.Open, FileAccess.Read, FileShare.ReadWrite); System.UnauthorizedAccessException was unhandled Message="Access to the path 'C:\' is denied." Source="mscorlib" StackTrace: in System.IO.__Error.WinIOError(Int32 errorCode, String maybeFullPath) in System.IO.FileStream.Init(String path, FileMode mode, FileAccess access, Int32 rights, Boolean useRights, FileShare share, Int32 bufferSize, FileOptions options, SECURITY_ATTRIBUTES secAttrs, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share, Int32 bufferSize, FileOptions options, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share) in ReadingMftNewTest.Program.Main(String[] args) in D:\CS\2008\ReadingMftNewTest\ReadingMftNewTest\Program.cs:line 76 Note that i openning "C:" but the error says "C:\", where did this slash came from? :\ Is there any chance to open C: without using the CreateFile API? I really don't want be depending on WIN32 API because this code should also run on Mono that dont support WIN32 API, but successfully openning devices with regular FileStream (Mono 1 Microsoft 0).

  Read the article

• Integrating iCalendar in Moodle

  - by user61255

  Hi all, I am working on a Moodle project and I have downloaded and installed the latest build(1.9) on my system. I'm using this framework for the very first time so presently trying to get familiar with the environment and the documentation. My need is to embed an iCal kinda calendar on Moodle's front page using the PHP iCalendar API. I downloaded the latest version of PHP iCalendar but kinda needed some help figuring things out further. I am trying to build a plug-in sorta thing which allows you to put a custom-built calendar (in place of the regular Moodle calendar) on your Moodle site. Has anyone ever worked with something similar before? Any suggestions?!! Thanks in advance! --eureka

  Read the article

• Django's manage.py shell won't indent

  - by hora

  I seem to have run into a strange bug or more likely some setting I am unfamiliar with on my system that is not allowing me to tab when I am in Django's shell (python manage.py shell is how I run it). For obvious reasons this is proving to be annoying since I can't do any loops or conditonals in the shell. If I hit tab it completes all functions that are available to me, like bash does in a terminal. I've tried just using spaces for my indents but I always get an indentation error. Does anyone know why this is happening and what I can do to get tab to work in my shell again? (It may be relevant to know that this is on a Ubuntu 9.04 system). Edit: tab works fine in the regular pythong shell, it's only in django's that it doesn't. Thanks.

  Read the article

• Eclipse keyword highlighting in in my own text editor

  - by Torok Balint

  I made a simple text editor in eclipse to which I added some simple WordRule based syntax highlighting to highlight the language keywords. The problem is that when a keyword is part of an identifier (eg. "import" is part of "extra_import"), then "import" is highlighted in "extra_import". How can I stop eclipse to highlight a a keyword if it is only a sub string of another string? Anlther question; is there a regular expression based IRule? What is the purpose of WhitespaceRule? White spaces are usually not highlighted. Thaks

  Read the article

• Should i use HttpResponse.End() for a fast webapp?

  - by acidzombie24

  HttpResponse.End() seems to throw an exception according to msdn. Right now i have the choice of returning a value to say end thread (it only goes 2 functions deep) or i can call end(). I know that throwing exceptions is significantly slower (read the comment for a C#/.NET test) so if i want a fast webapp should i consider not calling it when it is trivially easy to not call it? -edit- I do have a function call in certain functions and in the constructor in classes to ensure the user is logged in. So i call HttpResponse.End() in enough places although hopefully in regular site usage it doesn't occur too often.

  Read the article

• HttpContext User value changing on its own?

  - by larryq

  Hi everyone, I'm working on an ASP.Net 2.0 application and am having a strange issue involving the HttpContext User. It appears to be changing on its own when I go to a particular page/directory. All of our pages inherit from a base page. In that base page's Page_Load() method we run an authorization check to see if the user can see the page they're going to. We retrieve the user to check against with this code: GenericPrincipal objPrincipal = (GenericPrincipal)Context.User; When I go to this unusual directory the User value isn't me, it's some other username I've never heard of. This username isn't authorized to see these pages, so authorization fails. This mysterious directory isn't a virtual web, just a regular directory in our website, however I've noticed it has its own Web.Config file. I'm guessing that's a cause of the trouble here. My question is, how can I investigate this further, in determining what's changing the User value when I go to this directory?

  Read the article

• Suppressing the language select button iPhone

  - by AWinter

  I'm working on an application now that contains an account register section. One field with secureTextEntry = NO (for registering only). The idea is this make registration faster and hopefully increases the number of signups. It's simple enough for me to just place a regular UITextField but if the user has any additional language keyboards then it's possible for the user to enter non-password friendly characters. Unlike in when secureTextEntry = YES. I know I can do textField.keyboardType = UIKeyboardTypeASCIICapable to get the text field to display the ASCII keyboard first, but the user will still have the keyboard switch button which will allow them to get to undesirable characters. Is there a simple method for suppressing the international button or forcing ASCII only keyboard with no international button? [EDIT] Another perhaps better option might be to suppress multi byte keyboards or even to display the text in the case that secureTextEntry = YES any ideas here? [EDIT AGAIN] I've decided it's a really bad idea to suppress the international button as non-multibyte characters should all be allowed.

  Read the article

• How to Redirect Subdomains to Other Domain

  - by Codex73

  What I'm trying to accomplish with htaccess mod-rewrite: Redirect all sub-domains to new domain name w rewrite rule. e.g. test1.olddomain.com === test1.newdomain.com test2.olddomain.com === test2.newdomain.com test3.olddomain.com === test3.newdomain.com This is what I have so far which of course is wrong: Options +FollowSymLinks RewriteEngine on RewriteCond %{HTTP_HOST} ^olddomain\.com$ [NC] RewriteRule ^(.*)$ http://www.newdomain.com/$1 [R=301,L] RewriteCond %{HTTP_HOST} ^www\.olddomain\.com$ [NC] RewriteRule ^(.*) http://www.newdomain.com/$1 [R=301,L] RewriteRule [a-zA-Z]+\.olddomain.com$ http://$1.newdomain.com/ [R=301,L] Since I'm not a Regular Expression junkie just yet, I need your help... Thanks for any help you can give here. I know also we can compile these first two conditions into one. Note: The reason I don't redirect all domain using DNS is that a lot of directories need special rewrite rules in order to maintain positions on SEO.

  Read the article

• Regex for recursive "wiki-style" lists

  - by Syd Miller

  I'm trying to create a Regular Expression to match "wiki style" lists as in (using preg_replace_callback() ): * List Item 1 * List Item 2 *# List Item 2.1 *# List Item 2.2 * List Item 3 Asterisks denote Unordered Lists while Number-Signs denote Ordered Lists. I'm trying to get this so it can match infinite depth and so that * and # can be mixed. I tried the following expression (and variations of it): /\s([*#]{1,}) ([\S ]+)\s/si But it doesn't seem to want to work. What am I doing wrong? Or is there a better way of accomplishing this?

  Read the article

< Previous Page | 192 193 194 195 196 197 198 199 200 201 202 203  | Next Page >