Search Results

Search found 35213 results on 1409 pages for 'text editors'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 21/1409 | < Previous Page | 17 18 19 20 21 22 23 24 25 26 27 28  | Next Page >

  • Writing text file on local server MVC 2.0

    - by Liado
    Hi, i'm trying to write a text file on remote server, i'm using the following code: [AcceptVerbs(HttpVerbs.Post)] public ActionResult Index(UserModels model) { if (!ModelState.IsValid) { return View("Index"); } try { using (StreamWriter w = new StreamWriter(Server.MapPath(TEXT_FILE_NAME), true)) { w.WriteLine(model.Email.ToString()); // Write the text } } catch { } the folder is still empty, can someone help? what should be the problem? Thanks

    Read the article

  • Reading a Text file in xcode

    - by Nicolaj Zefting
    First off, I'm a complete beginner. This might be a stupid question, but here it goes: I'm currently working on an App than contains Latin texts that the users can view and read. I'm using Xcode 4 with the storybord function. Theway the app is built: user selects author - then the book - then app shows the text. I am kind of confused because i need to have various text files, depending on the users choice.

    Read the article

  • Generating text file from database

    - by Goldmember
    I have a requirement to hand-code an text file from data residing in a SQL table. Just wondering if there are any best practices here. Should I write it as an XMLDocument first and transform using XSL or just use Streamwriter and skip transformation altogether? The generated text file will be in EDIFACT format, so layout is very specific.

    Read the article

  • Text extra aliased(jagged) in IE - looks terrible - but OK in FF and Chrome

    - by jon
    I am building a website - http://www.efficaxdevelopment.com As you can see when you load the page(in IE) the text on the page that isn't an image or the menu looks terrible, while in FF and Chrome the text looks fine. you can view the source on the page and the css is here http://www.efficaxdevelopment.com/styles/mainstyle.css Also, the sliding bar over the menu appears a few pixels left of where it appears in FF and IE. Any ideas?

    Read the article

  • Appcelerator Titanium - auto height table views break with shortish text

    - by ceejayoz
    I posted this on the Appcelerator Titanium dev Q&A site, but maybe someone here has had this issue... KitchenSink 1.1 illustrates this issue. In table_view_api_auto_height.js, changing row: addRow(0,'This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text.'); to something like: addRow(0,'This is some long text. This is some long text.'); results in incorrect left padding on the row. See screenshot:

    Read the article

  • Webrat says it can't find some text, but the text is actually there

    - by Jason
    I have a webpage that has a form button on it called "delete", and a cuke scenario that has the line: And I should see "delete" When I run the scenario, I get this error: expected the following element's content to include "delete" ...and it dumps the webrat page to stdout and the "delete" is, in fact, not there. So far so good. However, when I tell webrat to show me the page before the error happens: Then show me the page And I should see "delete" ...Safari fires up and shows me the page, and in Safari there's the "delete" button, totally there. Why is webrat not finding the form button? I've also had this same problem with form fields, such as text inputs that have a value in them when the page loads, but webrat says there's nothing there. Looking at it in Safari shows, again, that the field does have the right text in it. Is this a bug, or is webrat just not suitable for checking form elements? Is there a different way to do this? Thanks!

    Read the article

  • Lightweight PHP/HTML/CSS editor with code browser

    - by Nisto
    I'm looking for a freeware editor which has; syntax highlighting and a code browser (or code suggestions/hints). Preferably freeware license! I've tried out quite a few editors, but a lot of them are unfortunately very resource heavy and provides a lot more functions than I ever needed. So far, there's two editors that I really like, and is lightweight: jEdit and Notepad++. Although, unfortunately... Notepad++ doesn't have code browser support for both control structures and functions for PHP. Also, there's no code browser for HTML... I really liked jEdit as well, but there doesn't seem to be a code browser for it. Except for maybe Completion, but it's a bothersome plugin, and doesn't show the code browser unless you type something in and press CTRL+B. Other editors I've tried, but wasn't satisfied with: Adobe Dreamweaver CodeLobster PHP Edition Aptana Studio Komodo Edit EditPlus BlueFish PHP Designer 2007 - Personal PhpStorm Scriptly Eclipse UltraEdit Notepad2 EditPad Pro Rapid PHP EDIT I'm using Windows XP

    Read the article

  • 2D game editor with SDK or open format (Windows)

    - by Edward83
    I need 2d editor (Windows) for game like rpg. Mostly important features for me: Load tiles as classes with attributes, for example "tile1 with coordinates [25,30] is object of class FlyingMonster with speed=1.0f"; Export map to my own format (SDK) or open format which I can convert to my own; As good extension feature will be multi-tile brush. I wanna to choose one or many tiles into one brush and spread it on canvas.

    Read the article

  • Text editor with "forensic" capabilities?

    - by Timo
    This is what happened: I wrote a perl script using TextWrangler and managed to change the encoding to UTF8 BOM, which inserts te BOM marker at the start of the file. Perl promptly misses the #! and mayhem ensues. It then takes me the better part of an afternoon to figure this out since most text editors do not show the BOM marker even with various "show invisibles" options turned on. Now, I've learned my lesson, I should have used less immediately, etc. etc.. What I'm wondering though is whether there is a text editor out there that lets you see every single byte of the file, even if they are "invisible"?

    Read the article

  • Drawing multiple triangles at once isn't working

    - by Deukalion
    I'm trying to draw multiple triangles at once to make up a "shape". I have a class that has an array of VertexPositionColor, an array of Indexes (rendered by this Triangulation class): http://www.xnawiki.com/index.php/Polygon_Triangulation So, my "shape" has multiple points of VertexPositionColor but I can't render each triangle in the shape to "fill" the shape. It only draws the first triangle. struct ShapeColor { // Properties (not all properties) VertexPositionColor[] Points; int[] Indexes; } First method that I've tried, this should work since I iterate through the index array that always are of "3s", so they always contain at least one triangle. //render = ShapeColor for (int i = 0; i < render.Indexes.Length; i += 3) { device.DrawUserIndexedPrimitives<VertexPositionColor> ( PrimitiveType.TriangleList, new VertexPositionColor[] { render.Points[render.Indexes[i]], render.Points[render.Indexes[i+1]], render.Points[render.Indexes[i+2]] }, 0, 3, new int[] { 0, 1, 2 }, 0, 1 ); } or the method that should work: device.DrawUserIndexedPrimitives<VertexPositionColor> ( PrimitiveType.TriangleList, render.Points, 0, render.Points.Length, render.Indexes, 0, render.Indexes.Length / 3, VertexPositionColor.VertexDeclaration ); No matter what method I use this is the "typical" result from my Editor (in Windows Forms with XNA) It should show a filled shape, because the indexes are right (I've checked a dozen of times) I simply click the screen (gets the world coordinates, adds a point from a color, when there are 3 points or more it should start filling out the shape, it only draws the lines (different method) and only 1 triangle). The Grid isn't rendered with "this" shape. Any ideas?

    Read the article

  • Box2D physics editor for complex bodies

    - by Paul Manta
    Is there any editor out there that would allow me to define complex entities, with joins connecting their multiple bodies, instead of regular single body entities? For example, an editor that would allow me to 'define' a car as having a main body with two circles as wheels, connected through joints. Clarification: I realize I haven't been clear enough about what I need. I'd like to make my engine data-driven, so all entities (and therefore their Box2D bodies) should be defined externally, not in code. I'm looking for a program like Code 'N' Web's PhysicsEditor, except that one only handles single body entities, no joints or anything like that. Like PhysicsEditor, the program should be configurable so that I can save the data in whatever format I want to. Does anyone know of any such software?

    Read the article

  • Change input text to regular text on blur and ability to edit jQuery

    - by eknown
    I'm creating a form where I'm eliminating the use of a save button. The form is made up of input text boxes and textareas. After the user enters data into the input field, I want to trigger an onBlur function and change the input into a span that contains the information that the user entered. I also want to have the ability to edit this information, so if the user clicks on the newly created span with text, it will turn back into the input field with the current information for their editing pleasure. For reference, I'm looking to have a functionality pretty much like on editing a photo title on Flickr. If possible, I'd also like to have the textbox show "saving..." for half a second after the blur to reflect interaction with server.

    Read the article

  • Game editor integration with the engine?

    - by Daniel
    What I am trying to figure out is what is the best way to integrate the editor(level, effects, model, etc...) in the most effective way? Now the first thing I thought would be to create the game engine(*) extremely modular. For example I took the example of game states. You could have multiple game states that all have their own update() and draw() methods among others. Each game state class would inherit from a base GameState class. This allows for a more modular approach and a useful one at that. Now would the most efficient approach be to implement the editor along with the modular engine, or create two different designs for both the game, and editor? I thought to take the game state example and extend it to window states, and well could be used for a lot more systems. Is there a better implementation of this design(game state) for use in other systems used in the engine? *: Now I know the term game engine is sorta irrelevant, and misused in many situations. What I am referring to as the "game engine" is the combination of the systems that the game must interact with for short. Also this is more of a theory / design question than an implementation. Even though both mix, i'd rather like to have a more general idea on how the editor is built in an efficient way and still using the same engine code as what the game uses. Thanks, Daniel P.S If you need more clarification or extra bits just leave a comment.

    Read the article

  • ASP.NET Conditionally Change ButtonField text at runTime

    - by Rodney Vinyard
    ASP.NET Conditionally Change ButtonField text at runTime   <asp:ButtonField CommandName="Edit" HeaderText="" Text="Edit" ButtonType="Link" />       protected void gvRequests_RowDataBound(object sender, GridViewRowEventArgs e)     {         if (e.Row.RowType == DataControlRowType.DataRow)         {             //----------------------------------------------------             // If status = "Saved", change buttonField.LinkButton.Text to "Copy"             //----------------------------------------------------             if (e.Row.Cells[(int)gCol.Status].Text == "Saved")             {                 //----------------------------------------------------                 // no !                 //----------------------------------------------------                 //string x = e.Row.Cells[(int)gCol.EditLink].Text;                 //e.Row.Cells[(int)gCol.EditLink].Text = "Copy";                   //----------------------------------------------------                 // yes !                 //----------------------------------------------------                 LinkButton linkButton = (LinkButton)e.Row.Cells[(int)gCol.EditLink].Controls[0];                 linkButton.Text = "Copy";             }         }     }

    Read the article

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • Send SMS text messages for FREE using Java ME

    - by hinkmond
    Here's a way to get around those nasty SMS text messages charges (and maybe a way to get around the Pakistan SMS text censors too!). Use this Java ME SMS text app for your Java ME mobile phone, called JaxtrSMS: See: JaxtrSMS free Java ME SMS Here's a quote: JaxtrSMS lets you send FREE SMS and txt messages to any mobile phone in the world. Best of all, the receiver does not have to have the JaxtrSMS app. International and local SMS/texting can be expensive but with JaxtrSMS you can text anyone in the world for FREE! Great! Now, you can send 2,000 text messages from your phone every month and not worry about a huge bill. You don't send 2,000 text message in a month? Well, get it for your teenage kids then. They certainly send 2,000 text messages in a month... Hinkmond

    Read the article

  • 3D game editor with C++ support and Bullet Physics

    - by Raghav Bali
    I am very new to game development and hence the question. Is there any open-source game editor that uses Bullet Physics engine with C++ code edit support.I have read about blender but it allows python based editing(if I am not wrong here). I need an editor to quickly draw the needed objects and concentrate more on the logic on their interactions(mostly magnetism based). This(my project) is part of an already existing legacy code in C++ which is forcing the dependency. Also, is there any physics engine which provides support for magnetism? Any help will surely be great. Thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Changing Text colour in text field by dropdown menu - Visual Studio 2008

    - by Wayne
    Hey, i'm just doing some testing on Visual Studio 2008, what i'm trying to do is to change the text colour inside the multi-textfield which isn't working and I don't know why... Public Class Form1 Dim ColourValue As Color Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load rbBlue.Checked = False rbRed.Checked = False rbGreen.Checked = False End Sub Private Sub rbRed_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbRed.CheckedChanged txtSpace.BackColor = Color.Red End Sub Private Sub rbBlue_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbBlue.CheckedChanged txtSpace.BackColor = Color.Blue End Sub Private Sub rbGreen_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbGreen.CheckedChanged txtSpace.BackColor = Color.Green End Sub Private Sub cbColours_SelectedValueChanged(ByVal sender As Object, ByVal e As System.EventArgs) Handles cbColours.SelectedValueChanged ColourValue = cbColours.SelectedValue txtSpace.BackColor = ColourValue End Sub End Class Basically i have the radio buttons that would change the background colour of the textfield, but i just need the dropdown menu to change the text colour. Many thanks :)

    Read the article

  • knockout bind text label to dropdown value selected option text

    - by Adam Levitt
    Is there a simple way to bind the textbox of a div to change based on the text value of the selected option in a dropdown on the same page? <div data-bind="text: dropdownValue"></div> <select> <option value="1">Value1</option> <option value="2">Value2</option> </select> Please note, I don't want to put the values into the select element using javascript. I'd like to bind to the value straight from the HTML. I can also include jQuery to make it work.

    Read the article

  • When page loads display 1st image text - hide all other text

    - by Jonah1289
    Hi I have created http://techavid.com/design/test3.html and when you load the page you see there are 3 images. The sun image is focused(in color), while the others are greyed out until clicked. That is how it should be for the images. Also when you load the page you see under each image it's own text(i.e. 1st: Sun, 2nd: Airplane, 3rd: Nano), but on page load I only want 1st:Sun to display and hide all other text until their respective image is clicked. Any idea how to do this? thanks :) J

    Read the article

  • Game Editor - When screen is clicked, how do you identify which object that is clicked?

    - by Deukalion
    I'm trying to create a Game Editor, currently just placing different types of Shapes and such. I'm doing this in Windows Forms while drawing the 3D with XNA. So, if I have a couple of Shapes on the screen and I click the screen I want to be able to identify "which" of these objects you clicked. What is the best method for this? Since having two objects one behind the other, it should be able to recognize the one in front and not the one behind it and also if I rotate the camera and click on the one behind it - it should identify it and not the first one. Are there any smart ways to go about this?

    Read the article

  • How one could use a live editor

    - by Sathvik
    I was thinking about a live editing environment where code / a source file is synchronized so that, changes made by one user would be carried across to all others editing the file. Something like Google Wave, but for code. Could this kind of an environment be better for the code, as changes are shared instantly? (with revision-control, of course) Has anyone tried (or has had a need for) using a shared environment for code?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 17 18 19 20 21 22 23 24 25 26 27 28  | Next Page >